F484379

General Info

Members Datasets Scaffolds Average Seq Length
877 555 706 199

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10003923|JGI25153J46596_100039237
Length 221
Sequence MDTDQLIRSLAADNAHRAPRVGAMLTMALLVAAPLSILIFATFLGVRPDVMSAMHNPFFDMKFAVTLSLAIPAIIVSLHLSRPXALMRGWGWLLLLPVGLLAVAIGGEAMMAPAMPMTMRMMGKNSRVCLLAIPAMSLPLLAGALFGLRHGAPXHVSAGLAATLYASHCTDXSPLFVATWYTLATALVAAIGALVGSRVLRYXDVLRQIAVXLEIRAFIGP

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
30 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
31 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
32 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
33 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
34 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
37 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
38 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
39 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
40 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
41 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
42 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
43 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
44 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
48 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
49 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
52 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
53 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
54 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
55 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
56 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
57 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
58 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
59 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
60 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
61 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
62 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
63 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
64 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
65 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
66 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
67 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
68 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
69 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
70 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
71 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
72 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
73 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
74 2922368715
75 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
76 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
77 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
78 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
79 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
80 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
81 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
82 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
83 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
84 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
85 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
86 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
87 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
88 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
89 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
90 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
91 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
92 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
93 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
94 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
95 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
96 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
97 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
98 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
99 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
100 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
101 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
102 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
103 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
104 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
105 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
106 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
107 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
108 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
109 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
110 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
111 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
112 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
113 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
114 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
115 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
116 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
117 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
118 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
119 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
120 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
121 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
122 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
123 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
124 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
125 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
126 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
127 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
128 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
129 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
130 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
131 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
132 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
133 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
134 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
135 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
136 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
137 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
138 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
139 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
140 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
141 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
142 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
143 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
144 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
145 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
146 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
147 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
148 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
149 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
152 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
153 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
154 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
155 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
156 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
157 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
158 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
159 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
160 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
161 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
162 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
163 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
164 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
165 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
166 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
167 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
168 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
169 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
170 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
171 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
172 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
173 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
174 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
175 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
176 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
177 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
178 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
179 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
180 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
181 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
182 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
183 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
184 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
185 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
186 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
187 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
188 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
189 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
190 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
191 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
192 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
193 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
194 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
195 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
196 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
197 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
198 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
199 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
200 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
201 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
202 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
203 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
204 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
205 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
206 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
207 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
208 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
209 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
210 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
211 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
212 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
213 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
214 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
215 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
216 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
217 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
218 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
219 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
220 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
221 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
222 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
223 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
224 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
225 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
226 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
227 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
228 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
229 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
230 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
231 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
232 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
233 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
234 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
235 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
236 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
237 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
238 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
239 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
240 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
241 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
242 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
243 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
248 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
249 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
295 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
296 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
297 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
298 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
300 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
304 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
305 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
306 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
307 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
308 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
309 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
310 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
311 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
312 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
313 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
314 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
315 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
316 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
317 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
320 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
321 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
322 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
323 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
324 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
325 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
326 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
327 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
328 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
329 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
330 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
331 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
332 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
333 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
334 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
335 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
336 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
337 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
338 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
339 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
340 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
341 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
342 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
343 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
344 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
345 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
346 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
347 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
348 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
352 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
353 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
354 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
355 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
356 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
357 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
366 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
367 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
368 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
369 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
370 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
371 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
372 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
373 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
374 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
375 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
376 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
377 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
378 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
379 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
380 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
381 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
382 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
383 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
384 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
385 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
389 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
392 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
393 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
394 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
395 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
396 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
399 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
400 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
401 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
402 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
403 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
404 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
405 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
406 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
407 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
408 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
409 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
410 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
411 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
412 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
413 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
414 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
417 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
418 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
419 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
420 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
421 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
422 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
423 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
424 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
425 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
426 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
427 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
445 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
446 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
447 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
448 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
449 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
450 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
451 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
452 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
453 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
454 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
455 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
456 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
457 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
469 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
483 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
484 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
488 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
489 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
490 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
491 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
492 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
493 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
494 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
495 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
496 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
497 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
498 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
499 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
500 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
501 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
502 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
503 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
504 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
505 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
506 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
507 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
508 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
509 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
510 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
511 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
512 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
513 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
514 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
515 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
516 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
517 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
518 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
519 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
520 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
523 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
524 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
525 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
526 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
527 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
528 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
529 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
530 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
531 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
532 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
533 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
534 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
535 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
536 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
537 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
538 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
539 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
540 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
541 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
542 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
543 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
544 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
545 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
546 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
547 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
548 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
549 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
550 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
551 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
552 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
553 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
554 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
555 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.37
Metatranscriptomes 0.23
Isolates 19.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.23
Nodule 16.31
Rhizoplane 4.33
Rhizosphere 55.64
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2514 2010549000 Bacteria 1433
2 JGI25153J46596_10003303 3300003215 Bacteria 9062
3 JGI25153J46596_10003923 3300003215 Bacteria 8157
4 JGI25153J46596_10006581 3300003215 Bacteria 5856
5 JGI25153J46596_10052382 3300003215 Bacteria 1162
6 JGI25153J46596_10058684 3300003215 Bacteria 1057
7 Ga0006777J48905_1010854 3300003308 Bacteria 1365
8 rootH1_10049032 3300003323 Bacteria 3344
9 JGI25160J50197_1000499 3300003354 Bacteria 23457
10 JGI25160J50197_1001057 3300003354 Bacteria 14153
11 JGI25160J50197_1013323 3300003354 Bacteria 2809
12 Ga0007429J51699_1020681 3300003579 Bacteria 1064
13 Ga0055531_10037619 3300003794 Bacteria 1468
14 Ga0055543_1001388 3300004625 Bacteria 9680
15 Ga0055543_1033406 3300004625 Bacteria 890
16 Ga0065165_1001679 3300005262 Bacteria 22393
17 Ga0065165_1002181 3300005262 Bacteria 17639
18 Ga0065165_1004782 3300005262 Bacteria 8086
19 Ga0065165_1020739 3300005262 Bacteria 2303
20 Ga0070658_10014422 3300005327 Bacteria 6341
21 Ga0070658_10204640 3300005327 Bacteria 1666
22 Ga0070658_10430515 3300005327 Bacteria 1135
23 Ga0070683_100012219 3300005329 Bacteria 7455
24 Ga0070683_100121264 3300005329 Bacteria 2470
25 Ga0070690_100025612 3300005330 Bacteria 3632
26 Ga0070670_100083877 3300005331 Bacteria 2738
27 Ga0068869_100266211 3300005334 Bacteria 1374
28 Ga0070666_10120234 3300005335 Bacteria 1821
29 Ga0070666_10135389 3300005335 Bacteria 1714
30 Ga0070680_100052054 3300005336 Bacteria 3342
31 Ga0070680_100053852 3300005336 Bacteria 3284
32 Ga0070682_100185706 3300005337 Bacteria 1456
33 Ga0068868_100405742 3300005338 Bacteria 1177
34 Ga0070660_100038698 3300005339 Bacteria 3622
35 Ga0070660_100364394 3300005339 Bacteria 1191
36 Ga0070661_100135097 3300005344 Bacteria 1855
37 Ga0070661_100620230 3300005344 Bacteria 876
38 Ga0070692_10072645 3300005345 Bacteria 1836
39 Ga0070668_100030576 3300005347 Bacteria 4094
40 Ga0070668_100229052 3300005347 Bacteria 1535
41 Ga0070669_100056356 3300005353 Bacteria 2881
42 Ga0070671_100005407 3300005355 Bacteria 10186
43 Ga0070671_100514230 3300005355 Bacteria 1031
44 Ga0070667_100087671 3300005367 Bacteria 2671
45 Ga0070667_100198335 3300005367 Bacteria 1780
46 Ga0070667_100494030 3300005367 Bacteria 1121
47 Ga0070709_10005587 3300005434 Bacteria 6809
48 Ga0070709_10035327 3300005434 Bacteria 3037
49 Ga0070709_10043739 3300005434 Bacteria 2771
50 Ga0070714_100076342 3300005435 Bacteria 2909
51 Ga0070714_100099186 3300005435 Bacteria 2563
52 Ga0070714_100841110 3300005435 Bacteria 890
53 Ga0070713_100005894 3300005436 Bacteria 8424
54 Ga0070713_100171313 3300005436 Bacteria 1945
55 Ga0070713_101307497 3300005436 Bacteria 703
56 Ga0070710_10057100 3300005437 Bacteria 2211
57 Ga0070701_10085110 3300005438 Bacteria 1721
58 Ga0070711_100004477 3300005439 Bacteria 8255
59 Ga0070700_100087976 3300005441 Bacteria 2021
60 Ga0070700_100508332 3300005441 Bacteria 928
61 Ga0070663_100711303 3300005455 Bacteria 855
62 Ga0070678_100232464 3300005456 Bacteria 1538
63 Ga0070662_100129504 3300005457 Bacteria 1944
64 Ga0070681_10033224 3300005458 Bacteria 5179
65 Ga0070681_10573160 3300005458 Bacteria 1042
66 Ga0070681_10659162 3300005458 Bacteria 962
67 Ga0070681_11002842 3300005458 Bacteria 755
68 Ga0068867_100126985 3300005459 Bacteria 1977
69 Ga0068867_100265251 3300005459 Bacteria 1402
70 Ga0070679_100035252 3300005530 Bacteria 4964
71 Ga0070679_100145568 3300005530 Bacteria 2347
72 Ga0070684_100005320 3300005535 Bacteria 9856
73 Ga0070684_100017131 3300005535 Bacteria 5939
74 Ga0070686_100029356 3300005544 Bacteria 3345
75 Ga0070693_100057000 3300005547 Bacteria 2257
76 Ga0070665_100111156 3300005548 Bacteria 2743
77 Ga0070665_100195513 3300005548 Bacteria 2023
78 Ga0070665_100282608 3300005548 Bacteria 1661
79 Ga0070665_100429724 3300005548 Bacteria 1330
80 Ga0070665_100563301 3300005548 Bacteria 1152
81 Ga0068855_100312338 3300005563 Bacteria 1739
82 Ga0068855_100762712 3300005563 Bacteria 1031
83 Ga0070664_100542670 3300005564 Bacteria 1075
84 Ga0068857_100074563 3300005577 Bacteria 3024
85 Ga0068854_100029620 3300005578 Bacteria 3791
86 Ga0068854_100070125 3300005578 Bacteria 2561
87 Ga0068854_100122597 3300005578 Bacteria 1975
88 Ga0068856_100000061 3300005614 Bacteria 100823
89 Ga0068856_100249706 3300005614 Bacteria 1789
90 Ga0068852_100447299 3300005616 Bacteria 1278
91 Ga0068852_100692450 3300005616 Bacteria 1029
92 Ga0068859_100338953 3300005617 Bacteria 1598
93 Ga0068864_100769369 3300005618 Bacteria 945
94 Ga0068861_100562730 3300005719 Bacteria 1041
95 Ga0068863_100262860 3300005841 Bacteria 1669
96 Ga0068858_100061945 3300005842 Bacteria 3459
97 Ga0068858_100505572 3300005842 Bacteria 1168
98 Ga0068862_100030238 3300005844 Bacteria 4564
99 Ga0081455_10006207 3300005937 Bacteria 12886
100 Ga0081539_10118064 3300005985 Bacteria 1322
101 Ga0070717_10149604 3300006028 Bacteria 2019
102 Ga0070717_10337192 3300006028 Bacteria 1346
103 Ga0075365_10117999 3300006038 Bacteria 1828
104 Ga0075365_10153997 3300006038 Bacteria 1600
105 Ga0075368_10002832 3300006042 Bacteria 5723
106 Ga0075363_100021392 3300006048 Bacteria 3257
107 Ga0075363_100044231 3300006048 Bacteria 2358
108 Ga0075364_10026956 3300006051 Bacteria 3668
109 Ga0075364_10198404 3300006051 Bacteria 1360
110 Ga0070715_10129947 3300006163 Bacteria 1211
111 Ga0070715_10158970 3300006163 Bacteria 1115
112 Ga0070716_100109247 3300006173 Bacteria 1711
113 Ga0070716_100691892 3300006173 Bacteria 778
114 Ga0070712_100093359 3300006175 Bacteria 2209
115 Ga0075367_10001143 3300006178 Bacteria 11052
116 Ga0075367_10103413 3300006178 Bacteria 1743
117 Ga0075366_10185826 3300006195 Bacteria 1263
118 Ga0075370_10001011 3300006353 Bacteria 11646
119 Ga0075370_10016339 3300006353 Bacteria 3992
120 Ga0075370_10184080 3300006353 Bacteria 1230
121 Ga0068865_100018327 3300006881 Bacteria 4515
122 Ga0097620_100338916 3300006931 Bacteria 1598
123 Ga0099825_1030152 3300006941 Bacteria 2431
124 Ga0079104_1050574 3300006946 Bacteria 927
125 Ga0099794_10062107 3300007265 Bacteria 1816
126 Ga0105240_10016135 3300009093 Bacteria 10123
127 Ga0105240_10073391 3300009093 Bacteria 4225
128 Ga0105240_10404415 3300009093 Bacteria 1537
129 Ga0111539_10235262 3300009094 Bacteria 2133
130 Ga0105245_10033898 3300009098 Bacteria 4525
131 Ga0105245_10351092 3300009098 Bacteria 1461
132 Ga0105245_10625225 3300009098 Bacteria 1105
133 Ga0105247_10019485 3300009101 Bacteria 4073
134 Ga0105247_10048323 3300009101 Bacteria 2613
135 Ga0114129_10028910 3300009147 Bacteria 7853
136 Ga0105243_10026251 3300009148 Bacteria 4458
137 Ga0105243_10088511 3300009148 Bacteria 2544
138 Ga0105241_10047364 3300009174 Bacteria 3269
139 Ga0105248_10339830 3300009177 Bacteria 1690
140 Ga0105237_10015388 3300009545 Bacteria 7963
141 Ga0105237_10039605 3300009545 Bacteria 4758
142 Ga0105237_10085795 3300009545 Bacteria 3138
143 Ga0105237_10973237 3300009545 Bacteria 855
144 Ga0105238_10008473 3300009551 Bacteria 10294
145 Ga0105249_10080028 3300009553 Bacteria 3035
146 Ga0105249_10950212 3300009553 Bacteria 927
147 Ga0105239_10060340 3300010375 Bacteria 4163
148 Ga0105239_10117346 3300010375 Bacteria 2954
149 Ga0105239_10178770 3300010375 Bacteria 2374
150 Ga0105239_10189212 3300010375 Bacteria 2304
151 Ga0105239_10866580 3300010375 Bacteria 1036
152 Ga0105239_10869689 3300010375 Bacteria 1034
153 Ga0105246_10467604 3300011119 Bacteria 1064
154 Ga0105246_10590744 3300011119 Bacteria 958
155 Ga0157371_10255897 3300013102 Bacteria 1261
156 Ga0157370_10225861 3300013104 Bacteria 1733
157 Ga0157369_10411964 3300013105 Bacteria 1401
158 Ga0157374_10013080 3300013296 Bacteria 7239
159 Ga0163162_10063695 3300013306 Bacteria 3731
160 Ga0157372_10082842 3300013307 Bacteria 3632
161 Ga0157375_10112897 3300013308 Bacteria 2818
162 Ga0163163_10059718 3300014325 Bacteria 3773
163 Ga0163163_10619338 3300014325 Bacteria 1146
164 Ga0157379_10106063 3300014968 Bacteria 2522
165 Ga0157376_10104262 3300014969 Bacteria 2485
166 Ga0157376_10564534 3300014969 Bacteria 1128
167 Ga0214544_1000368 3300021320 Bacteria 79177
168 Ga0214542_1002192 3300021321 Bacteria 40482
169 Ga0214545_1000203 3300021324 Bacteria 79176
170 Ga0214543_1000322 3300021327 Bacteria 76376
171 Ga0213872_10049093 3300021361 Bacteria 1917
172 Ga0213874_10035272 3300021377 Bacteria 1469
173 Ga0209563_101338 3300025230 Bacteria 6707
174 Ga0209677_101571 3300025253 Bacteria 9700
175 Ga0209673_1013588 3300025273 Bacteria 3203
176 Ga0209564_1006232 3300025295 Bacteria 6507
177 Ga0209758_1000011 3300025297 Bacteria 1049685
178 Ga0209758_1000365 3300025297 Bacteria 80645
179 Ga0209758_1000530 3300025297 Bacteria 60826
180 Ga0209758_1017170 3300025297 Bacteria 3621
181 Ga0209758_1017378 3300025297 Bacteria 3587
182 Ga0209758_1020271 3300025297 Bacteria 3155
183 Ga0209758_1034766 3300025297 Bacteria 1998
184 Ga0207426_1000429 3300025302 Bacteria 68612
185 Ga0207426_1000620 3300025302 Bacteria 45305
186 Ga0207426_1003972 3300025302 Bacteria 7544
187 Ga0207426_1020710 3300025302 Bacteria 2283
188 Ga0209257_1001196 3300025304 Bacteria 32644
189 Ga0209257_1021309 3300025304 Bacteria 2358
190 Ga0209257_1023725 3300025304 Bacteria 2147
191 Ga0207692_10364644 3300025898 Bacteria 893
192 Ga0207642_10012943 3300025899 Bacteria 3028
193 Ga0207680_10536558 3300025903 Bacteria 835
194 Ga0207647_10015401 3300025904 Bacteria 5243
195 Ga0207685_10086553 3300025905 Bacteria 1309
196 Ga0207685_10105399 3300025905 Bacteria 1213
197 Ga0207699_10006782 3300025906 Bacteria 5568
198 Ga0207699_10049144 3300025906 Bacteria 2482
199 Ga0207645_10058724 3300025907 Bacteria 2456
200 Ga0207705_10046241 3300025909 Bacteria 3127
201 Ga0207705_10068073 3300025909 Bacteria 2577
202 Ga0207707_10001362 3300025912 Bacteria 22693
203 Ga0207707_10049987 3300025912 Bacteria 3643
204 Ga0207707_10233802 3300025912 Bacteria 1599
205 Ga0207695_10000008 3300025913 Bacteria 1058268
206 Ga0207695_10258535 3300025913 Bacteria 1639
207 Ga0207671_10011774 3300025914 Bacteria 7083
208 Ga0207671_10031938 3300025914 Bacteria 3921
209 Ga0207671_10040633 3300025914 Bacteria 3442
210 Ga0207671_10043493 3300025914 Bacteria 3321
211 Ga0207693_10026503 3300025915 Bacteria 4588
212 Ga0207660_10015194 3300025917 Bacteria 5080
213 Ga0207660_10258126 3300025917 Bacteria 1377
214 Ga0207657_10061869 3300025919 Bacteria 3207
215 Ga0207657_10164356 3300025919 Bacteria 1801
216 Ga0207657_10798305 3300025919 Bacteria 730
217 Ga0207649_10519037 3300025920 Bacteria 908
218 Ga0207652_10234377 3300025921 Bacteria 1654
219 Ga0207694_10402564 3300025924 Bacteria 1138
220 Ga0207694_10639544 3300025924 Bacteria 896
221 Ga0207687_10096569 3300025927 Bacteria 2166
222 Ga0207687_10115447 3300025927 Bacteria 2000
223 Ga0207700_10072969 3300025928 Bacteria 2649
224 Ga0207664_10058593 3300025929 Bacteria 3064
225 Ga0207664_10203318 3300025929 Bacteria 1711
226 Ga0207690_10181652 3300025932 Bacteria 1584
227 Ga0207690_10631081 3300025932 Bacteria 877
228 Ga0207690_10734547 3300025932 Bacteria 813
229 Ga0207706_10353261 3300025933 Bacteria 1278
230 Ga0207706_10443400 3300025933 Bacteria 1123
231 Ga0207709_10785145 3300025935 Bacteria 768
232 Ga0207669_10014469 3300025937 Bacteria 3954
233 Ga0207704_10008022 3300025938 Bacteria 5022
234 Ga0207691_10082354 3300025940 Bacteria 2891
235 Ga0207689_10255575 3300025942 Bacteria 1449
236 Ga0207661_10000647 3300025944 Bacteria 22491
237 Ga0207661_10136863 3300025944 Bacteria 2104
238 Ga0207679_10313492 3300025945 Bacteria 1356
239 Ga0207712_10022330 3300025961 Bacteria 4165
240 Ga0207668_10119454 3300025972 Bacteria 1993
241 Ga0207640_10027127 3300025981 Bacteria 3487
242 Ga0207640_10086930 3300025981 Bacteria 2154
243 Ga0207640_10883235 3300025981 Bacteria 780
244 Ga0207658_10032320 3300025986 Bacteria 3724
245 Ga0207658_10273022 3300025986 Bacteria 1446
246 Ga0207677_10063269 3300026023 Bacteria 2571
247 Ga0207677_10409811 3300026023 Bacteria 1152
248 Ga0207703_10276738 3300026035 Bacteria 1523
249 Ga0207703_10305746 3300026035 Bacteria 1452
250 Ga0207639_10261818 3300026041 Bacteria 1513
251 Ga0207639_11004289 3300026041 Bacteria 781
252 Ga0207678_10013371 3300026067 Bacteria 7202
253 Ga0207678_10080801 3300026067 Bacteria 2783
254 Ga0207678_10083464 3300026067 Bacteria 2733
255 Ga0207678_10194046 3300026067 Bacteria 1736
256 Ga0207702_10000674 3300026078 Bacteria 37110
257 Ga0207702_10215304 3300026078 Bacteria 1788
258 Ga0207702_10992317 3300026078 Bacteria 833
259 Ga0207641_10076872 3300026088 Bacteria 2888
260 Ga0207641_10801116 3300026088 Bacteria 932
261 Ga0207641_11191159 3300026088 Bacteria 761
262 Ga0207648_10047082 3300026089 Bacteria 3780
263 Ga0207674_10063637 3300026116 Bacteria 3724
264 Ga0207674_10546076 3300026116 Bacteria 1119
265 Ga0207675_100048738 3300026118 Bacteria 3953
266 Ga0207683_10094651 3300026121 Bacteria 2663
267 Ga0207683_10235765 3300026121 Bacteria 1669
268 Ga0207698_10003453 3300026142 Bacteria 9514
269 Ga0207698_10623627 3300026142 Bacteria 1065
270 Ga0207698_10885991 3300026142 Bacteria 899
271 Ga0207698_10983397 3300026142 Bacteria 854
272 Ga0209389_1000001 3300027296 Bacteria 463799
273 Ga0209389_1000134 3300027296 Bacteria 65168
274 Ga0209589_1000033 3300027357 Bacteria 140561
275 Ga0209489_100040 3300027361 Bacteria 164986
276 Ga0209489_111101 3300027361 Bacteria 9483
277 Ga0209700_100007 3300027363 Bacteria 454608
278 Ga0209588_1004014 3300027671 Bacteria 4119
279 Ga0209813_10131903 3300027866 Bacteria 880
280 Ga0207428_10183872 3300027907 Bacteria 1578
281 Ga0268266_10538096 3300028379 Bacteria 1118
282 Ga0268265_10090485 3300028380 Bacteria 2444
283 Ga0265334_10174106 3300028573 Bacteria 753
284 Ga0307517_10001507 3300028786 Bacteria 38891
285 Ga0307515_10001890 3300028794 Bacteria 46604
286 Ga0307515_10146506 3300028794 Bacteria 2497
287 Ga0265330_10004294 3300031235 Bacteria 7255
288 Ga0265330_10022396 3300031235 Bacteria 2875
289 Ga0265330_10052689 3300031235 Bacteria 1782
290 Ga0265328_10132228 3300031239 Bacteria 934
291 Ga0265325_10012793 3300031241 Bacteria 4788
292 Ga0265340_10001084 3300031247 Bacteria 15490
293 Ga0265331_10033872 3300031250 Bacteria 2523
294 Ga0265316_10073164 3300031344 Bacteria 2640
295 Ga0265314_10046551 3300031711 Bacteria 3059
296 Ga0265314_10066984 3300031711 Bacteria 2420
297 Ga0265342_10026217 3300031712 Bacteria 3656
298 Ga0265342_10052344 3300031712 Bacteria 2434
299 Ga0265342_10057114 3300031712 Bacteria 2311
300 Ga0265342_10076950 3300031712 Bacteria 1933
301 Ga0307516_10173919 3300031730 Bacteria 1892
302 Ga0307406_10330526 3300031901 Bacteria 1183
303 Ga0307411_10662386 3300032005 Bacteria 905
304 Ga0307507_10269626 3300033179 Bacteria 1077
305 Ga0307510_10174924 3300033180 Bacteria 1719
306 Ga0307510_10223192 3300033180 Bacteria 1393
307 Ga0373926_0053807 3300035083 Bacteria 1457
308 Ga0373934_0005198 3300035086 Bacteria 4815
309 Ga0373934_0081513 3300035086 Bacteria 1300
310 Ga0373936_0092746 3300035113 Bacteria 1267
311 Ga0373945_0044654 3300035116 Bacteria 1612
312 Ga0373953_0001814 3300035117 Bacteria 6309
313 Ga0373953_0019930 3300035117 Bacteria 2501
314 Ga0373954_0001141 3300035118 Bacteria 10672
315 Ga0373954_0029735 3300035118 Bacteria 2518
316 Ga0373954_0083523 3300035118 Bacteria 1528
317 Ga0373956_0001770 3300035119 Bacteria 8897
318 Ga0373956_0195527 3300035119 Bacteria 958
319 Ga0373957_0007539 3300035120 Bacteria 3484
320 Ga0373946_0005588 3300035171 Bacteria 4538
321 Ga0373955_0004475 3300035172 Bacteria 6185
322 Ga0373955_0212974 3300035172 Bacteria 1152
323 Ga0373955_0226510 3300035172 Bacteria 1118
324 Ga0373924_0021211 3300035410 Bacteria 2533
325 Ga0373927_0014532 3300035695 Bacteria 5208
326 Ga0373933_0001421 3300035724 Bacteria 14039
327 Ga0373933_0065194 3300035724 Bacteria 2205
328 Ga0373933_0404125 3300035724 Bacteria 891
329 Ga0373947_0047982 3300035725 Bacteria 2561
330 Ga0373937_0007299 3300036401 Bacteria 9566
331 Ga0373937_0331486 3300036401 Bacteria 1440
332 Ga0373937_0922757 3300036401 Bacteria 822
333 Ga0373925_0122404 3300037068 Bacteria 2020
334 Ga0373925_0141888 3300037068 Bacteria 1881
335 Ga0395899_0041384 3300037312 Bacteria 3443
336 Ga0395900_0186988 3300037418 Bacteria 2102
337 Ga0395905_0102508 3300037471 Bacteria 2686
338 Ga0395905_0145412 3300037471 Bacteria 2230
339 Ga0436364_0561281 3300037853 Bacteria 1137
340 Ga0436364_0717928 3300037853 Bacteria 4338
341 Ga0436364_1277279 3300037853 Bacteria 828
342 Ga0436364_1318234 3300037853 Unclassified 1978
343 Ga0395901_0051992 3300038443 Bacteria 4259
344 Ga0436365_0925272 3300039437 Bacteria 2488
345 Ga0436365_1553711 3300039437 Bacteria 2029
346 Ga0436365_1718107 3300039437 Bacteria 1102
347 Ga0436361_0510643 3300039447 Bacteria 4751
348 Ga0436363_0263740 3300039450 Bacteria 1576
349 Ga0436363_1267944 3300039450 Bacteria 2006
350 Ga0436363_1409159 3300039450 Bacteria 1727
351 Ga0436363_1457984 3300039450 Bacteria 1314
352 Ga0451793_0734750 3300041452 Bacteria 788
353 Ga0451833_0114762 3300041491 Bacteria 678
354 Ga0451837_1556812 3300041494 Bacteria 1081
355 Ga0451841_1439108 3300041498 Bacteria 1019
356 Ga0439432_077789 3300042006 Bacteria 1007
357 Ga0466972_0000333 3300044658 Bacteria 26290
358 Ga0466972_0001204 3300044658 Bacteria 12446
359 Ga0466972_0045878 3300044658 Bacteria 2117
360 Ga0466972_0068108 3300044658 Bacteria 1700
361 Ga0466972_0136439 3300044658 Bacteria 1155
362 Ga0466965_0004174 3300044683 Bacteria 6420
363 Ga0466965_0100487 3300044683 Bacteria 1479
364 Ga0466965_0113323 3300044683 Bacteria 1395
365 Ga0466966_0001059 3300044684 Bacteria 17577
366 Ga0466961_0000050 3300044693 Bacteria 71289
367 Ga0466961_0150419 3300044693 Bacteria 1454
368 Ga0466964_0129581 3300044706 Bacteria 1147
369 Ga0466971_0112091 3300044719 Bacteria 1259
370 Ga0466968_0039031 3300044735 Bacteria 1997
371 Ga0466968_0306567 3300044735 Bacteria 765
372 Ga0466970_0115905 3300044765 Bacteria 1465
373 Ga0466960_0144541 3300044901 Bacteria 1266
374 Ga0466960_0328481 3300044901 Bacteria 868
375 Ga0466959_0021131 3300045049 Bacteria 4798
376 Ga0466959_0051834 3300045049 Bacteria 3007
377 Ga0466967_0061854 3300045976 Bacteria 3322
378 Ga0466967_0251988 3300045976 Bacteria 1687
379 Ga0466967_0327055 3300045976 Bacteria 1480
380 Ga0495617_096947 3300046452 Bacteria 960
381 Ga0495592_0002728 3300046454 Bacteria 12506
382 Ga0495592_0047069 3300046454 Bacteria 3213
383 Ga0495592_0260114 3300046454 Bacteria 1143
384 Ga0495603_0032466 3300046455 Bacteria 3141
385 Ga0495603_0057507 3300046455 Bacteria 2301
386 Ga0495590_0090057 3300046457 Bacteria 1085
387 Ga0495629_0001074 3300046459 Bacteria 21800
388 Ga0495629_0005031 3300046459 Bacteria 9895
389 Ga0495629_0026310 3300046459 Bacteria 4134
390 Ga0495638_0004210 3300046460 Bacteria 10952
391 Ga0495638_0051206 3300046460 Bacteria 2575
392 Ga0495638_0127108 3300046460 Bacteria 1501
393 Ga0495651_0009631 3300046462 Bacteria 7425
394 Ga0495651_0023884 3300046462 Bacteria 4754
395 Ga0495653_0000513 3300046463 Bacteria 29794
396 Ga0495653_0033029 3300046463 Bacteria 4103
397 Ga0495653_0113799 3300046463 Unclassified 1940
398 Ga0495653_0206827 3300046463 Bacteria 1328
399 Ga0495653_0510714 3300046463 Bacteria 748
400 Ga0495582_0017699 3300046473 Bacteria 3897
401 Ga0495582_0037422 3300046473 Bacteria 2669
402 Ga0495662_0054440 3300046476 Bacteria 1933
403 Ga0495664_0021307 3300046477 Bacteria 3744
404 Ga0495664_0029770 3300046477 Bacteria 3195
405 Ga0495664_0070298 3300046477 Bacteria 2090
406 Ga0495664_0298499 3300046477 Bacteria 972
407 Ga0495584_0037173 3300046491 Bacteria 2460
408 Ga0495584_0220107 3300046491 Bacteria 965
409 Ga0495585_0128800 3300046492 Bacteria 1333
410 Ga0495594_0039656 3300046499 Bacteria 2576
411 Ga0495594_0208631 3300046499 Bacteria 1114
412 Ga0495607_0080723 3300046501 Bacteria 1788
413 Ga0495606_0051812 3300046507 Bacteria 2674
414 Ga0495606_0060685 3300046507 Bacteria 2421
415 Ga0495606_0076418 3300046507 Bacteria 2093
416 Ga0495606_0126528 3300046507 Bacteria 1523
417 Ga0495608_0003659 3300046511 Bacteria 11051
418 Ga0495608_0052451 3300046511 Bacteria 2700
419 Ga0495608_0069403 3300046511 Bacteria 2302
420 Ga0495618_0026681 3300046514 Bacteria 3594
421 Ga0495618_0138442 3300046514 Bacteria 1557
422 Ga0495618_0153232 3300046514 Bacteria 1472
423 Ga0495618_0190725 3300046514 Bacteria 1300
424 Ga0495620_0155146 3300046515 Bacteria 891
425 Ga0495628_0019165 3300046516 Bacteria 5658
426 Ga0495628_0051823 3300046516 Bacteria 3243
427 Ga0495628_0238003 3300046516 Bacteria 1362
428 Ga0495628_0349865 3300046516 Bacteria 1086
429 Ga0495630_0061703 3300046517 Bacteria 2815
430 Ga0495632_0115767 3300046519 Bacteria 1256
431 Ga0495632_0141115 3300046519 Bacteria 1118
432 Ga0495643_0003266 3300046522 Bacteria 11998
433 Ga0495643_0096143 3300046522 Bacteria 1523
434 Ga0495648_0025071 3300046524 Bacteria 4045
435 Ga0495648_0038462 3300046524 Bacteria 3059
436 Ga0495648_0054190 3300046524 Bacteria 2424
437 Ga0495648_0093359 3300046524 Bacteria 1678
438 Ga0495666_0225819 3300046526 Bacteria 857
439 Ga0495652_0005984 3300046529 Bacteria 11374
440 Ga0495652_0008160 3300046529 Bacteria 9575
441 Ga0495652_0019338 3300046529 Bacteria 6067
442 Ga0495652_0120287 3300046529 Bacteria 2096
443 Ga0495652_0271441 3300046529 Bacteria 1246
444 Ga0495652_0451840 3300046529 Bacteria 899
445 Ga0495654_0164218 3300046530 Bacteria 973
446 Ga0495654_0257755 3300046530 Bacteria 724
447 Ga0495665_0061181 3300046531 Bacteria 1988
448 Ga0495640_0006879 3300046533 Bacteria 8960
449 Ga0495640_0014950 3300046533 Bacteria 5853
450 Ga0495640_0031760 3300046533 Bacteria 3767
451 Ga0495640_0100149 3300046533 Bacteria 1903
452 Ga0495587_0001598 3300046536 Bacteria 15082
453 Ga0495587_0013619 3300046536 Bacteria 5110
454 Ga0495587_0095823 3300046536 Bacteria 1712
455 Ga0495598_0060766 3300046537 Bacteria 1165
456 Ga0495645_0002141 3300046543 Bacteria 13403
457 Ga0495645_0010435 3300046543 Bacteria 6511
458 Ga0495645_0027111 3300046543 Bacteria 4161
459 Ga0495645_0081830 3300046543 Bacteria 2316
460 Ga0495622_0004871 3300046557 Bacteria 6216
461 Ga0495622_0005145 3300046557 Bacteria 6065
462 Ga0495622_0008198 3300046557 Bacteria 4841
463 Ga0495667_0001954 3300046559 Bacteria 13634
464 Ga0495667_0003789 3300046559 Bacteria 10155
465 Ga0495667_0065521 3300046559 Bacteria 2376
466 Ga0495656_0014355 3300046615 Bacteria 2969
467 Ga0495668_0039397 3300046616 Bacteria 2638
468 Ga0495634_0005582 3300046642 Bacteria 9653
469 Ga0495634_0027479 3300046642 Bacteria 3958
470 Ga0495634_0037946 3300046642 Bacteria 3288
471 Ga0495634_0176203 3300046642 Bacteria 1341
472 Ga0495611_0073552 3300046648 Bacteria 1565
473 Ga0495611_0115048 3300046648 Bacteria 1253
474 Ga0495625_0031145 3300046660 Bacteria 3970
475 Ga0495625_0093039 3300046660 Bacteria 2082
476 Ga0495625_0117316 3300046660 Bacteria 1814
477 Ga0495625_0307638 3300046660 Bacteria 1012
478 Ga0495635_0000211 3300046663 Bacteria 36892
479 Ga0495635_0009100 3300046663 Bacteria 6933
480 Ga0495635_0065754 3300046663 Bacteria 2487
481 Ga0495661_0051691 3300046665 Bacteria 2480
482 Ga0495661_0103149 3300046665 Bacteria 1602
483 Ga0495588_0004633 3300046674 Bacteria 6071
484 Ga0495588_0062386 3300046674 Bacteria 1932
485 Ga0495588_0504143 3300046674 Bacteria 634
486 Ga0495657_0002321 3300046675 Bacteria 16025
487 Ga0495657_0002878 3300046675 Bacteria 14291
488 Ga0495657_0041738 3300046675 Bacteria 3137
489 Ga0495657_0203959 3300046675 Bacteria 1204
490 Ga0495599_0000957 3300046678 Bacteria 16146
491 Ga0495599_0009965 3300046678 Bacteria 5817
492 Ga0495623_0008391 3300046679 Bacteria 6718
493 Ga0495623_0105087 3300046679 Unclassified 1716
494 Ga0495623_0134398 3300046679 Bacteria 1477
495 Ga0495646_0004069 3300046680 Bacteria 9174
496 Ga0495646_0029662 3300046680 Bacteria 3419
497 Ga0495647_0270857 3300046681 Bacteria 760
498 Ga0495658_0272120 3300046683 Bacteria 1068
499 Ga0495669_0001263 3300046684 Bacteria 10477
500 Ga0495613_0037912 3300046689 Bacteria 3573
501 Ga0495624_0024346 3300046690 Bacteria 3984
502 Ga0495624_0032066 3300046690 Bacteria 3409
503 Ga0495624_0442618 3300046690 Bacteria 779
504 Ga0495670_0187578 3300046691 Bacteria 1093
505 Ga0495671_0136054 3300046692 Bacteria 1198
506 Ga0495671_0233492 3300046692 Bacteria 889
507 Ga0495649_0088179 3300046694 Bacteria 1655
508 Ga0495600_0018484 3300046809 Bacteria 4442
509 Ga0495600_0196736 3300046809 Bacteria 1295
510 Ga0495581_0047799 3300047315 Bacteria 2472
511 Ga0495604_0007021 3300047317 Bacteria 8928
512 Ga0495604_0010845 3300047317 Bacteria 7237
513 Ga0495604_0060125 3300047317 Bacteria 2910
514 Ga0495604_0217186 3300047317 Bacteria 1318
515 Ga0495604_0424672 3300047317 Bacteria 872
516 Ga0495674_0014461 3300047319 Bacteria 7387
517 Ga0495674_0078849 3300047319 Bacteria 2829
518 Ga0495672_0022620 3300047320 Bacteria 4083
519 Ga0495672_0072588 3300047320 Bacteria 1943
520 Ga0495676_0232485 3300047321 Bacteria 1266
521 Ga0495680_0002152 3300047322 Bacteria 20441
522 Ga0495680_0006158 3300047322 Bacteria 11190
523 Ga0495683_0006277 3300047323 Bacteria 6505
524 Ga0495683_0052360 3300047323 Bacteria 2038
525 Ga0495687_006711 3300047443 Bacteria 6978
526 Ga0495675_0001324 3300047444 Bacteria 15012
527 Ga0495675_0013770 3300047444 Bacteria 5112
528 Ga0495675_0140641 3300047444 Bacteria 1496
529 Ga0495673_0025026 3300047469 Bacteria 2873
530 Ga0495673_0040211 3300047469 Bacteria 2115
531 Ga0495684_0009757 3300047471 Bacteria 7409
532 Ga0495684_0015063 3300047471 Bacteria 5954
533 Ga0495593_0002923 3300047673 Bacteria 10287
534 Ga0495593_0045925 3300047673 Bacteria 2329
535 Ga0495602_0008570 3300048088 Bacteria 10678
536 Ga0495602_0021077 3300048088 Bacteria 6423
537 Ga0495602_0030714 3300048088 Bacteria 5091
538 Ga0495602_0361858 3300048088 Bacteria 1044
539 Ga0495614_0207256 3300048089 Bacteria 888
540 Ga0495614_0228878 3300048089 Bacteria 847
541 Ga0495626_0085703 3300048091 Bacteria 1393
542 Ga0496100_0046258 3300048903 Bacteria 2797
543 Ga0496100_0115295 3300048903 Bacteria 1873
544 Ga0496100_0410972 3300048903 Bacteria 1032
545 Ga0496101_0064650 3300048904 Bacteria 2665
546 Ga0496101_0346570 3300048904 Bacteria 1167
547 Ga0496101_0449642 3300048904 Bacteria 1016
548 Ga0496102_0013546 3300048905 Bacteria 7067
549 Ga0496102_0074983 3300048905 Bacteria 3109
550 Ga0496102_0134081 3300048905 Bacteria 2320
551 Ga0496103_0001419 3300048906 Bacteria 16061
552 Ga0496103_0313010 3300048906 Bacteria 1010
553 Ga0496104_0000281 3300048907 Bacteria 45166
554 Ga0496104_0017222 3300048907 Bacteria 6575
555 Ga0496104_0076195 3300048907 Bacteria 3194
556 Ga0496105_0001556 3300048908 Bacteria 16238
557 Ga0496105_0043773 3300048908 Bacteria 3692
558 Ga0496105_0750816 3300048908 Bacteria 745
559 Ga0496106_0092949 3300048909 Bacteria 2331
560 Ga0496107_0079034 3300048910 Bacteria 2398
561 Ga0496107_0170664 3300048910 Bacteria 1614
562 Ga0496107_0241254 3300048910 Bacteria 1345
563 Ga0496108_0031684 3300048911 Bacteria 4388
564 Ga0496108_0664591 3300048911 Bacteria 905
565 Ga0496109_0042089 3300048912 Bacteria 4137
566 Ga0496109_0467788 3300048912 Bacteria 1191
567 Ga0496110_0017063 3300048913 Bacteria 6069
568 Ga0496111_0012540 3300048914 Bacteria 5744
569 Ga0496111_0446829 3300048914 Bacteria 954
570 Ga0496112_0063890 3300048915 Bacteria 3631
571 Ga0496112_0510412 3300048915 Bacteria 1137
572 Ga0496112_0753467 3300048915 Bacteria 900
573 Ga0496113_0019873 3300048916 Bacteria 4709
574 Ga0496114_0246333 3300048917 Bacteria 1572
575 Ga0496114_0543782 3300048917 Bacteria 1026
576 Ga0496115_0062942 3300048918 Bacteria 2993
577 Ga0496115_0076566 3300048918 Bacteria 2719
578 Ga0496115_0863477 3300048918 Bacteria 700
579 Ga0496116_0017881 3300048919 Bacteria 5486
580 Ga0496117_0036555 3300048920 Bacteria 3673
581 Ga0496117_0175564 3300048920 Bacteria 1238
582 Ga0496118_0050512 3300048921 Bacteria 3190
583 Ga0496118_0071041 3300048921 Bacteria 2509
584 Ga0496118_0120363 3300048921 Bacteria 1713
585 Ga0496119_0003040 3300048922 Bacteria 17756
586 Ga0496119_0012475 3300048922 Bacteria 6896
587 Ga0496119_0087263 3300048922 Bacteria 1781
588 Ga0496120_0001511 3300048923 Bacteria 27505
589 Ga0496120_0037387 3300048923 Bacteria 2881
590 Ga0496121_0035087 3300048924 Bacteria 4500
591 Ga0496121_0037152 3300048924 Bacteria 4329
592 Ga0496121_0038503 3300048924 Bacteria 4232
593 Ga0496121_0108305 3300048924 Bacteria 2125
594 Ga0496121_0134436 3300048924 Bacteria 1844
595 Ga0496122_0092534 3300048925 Bacteria 2055
596 Ga0496124_0160271 3300048927 Bacteria 1754
597 Ga0496124_0217659 3300048927 Bacteria 1439
598 Ga0496124_0499655 3300048927 Bacteria 816
599 Ga0496125_0005006 3300048928 Bacteria 14960
600 Ga0496125_0032889 3300048928 Bacteria 4599
601 Ga0496125_0064965 3300048928 Bacteria 2895
602 Ga0496125_0085777 3300048928 Bacteria 2384
603 Ga0496126_0021354 3300048929 Bacteria 6322
604 Ga0496126_0047223 3300048929 Bacteria 3943
605 Ga0496126_0086673 3300048929 Bacteria 2760
606 Ga0496126_0114989 3300048929 Bacteria 2340
607 Ga0496126_0259762 3300048929 Bacteria 1445
608 Ga0496126_0362016 3300048929 Bacteria 1184
609 Ga0496126_0390969 3300048929 Bacteria 1130
610 Ga0495678_122823 3300049459 Bacteria 869
611 Ga0495682_0013260 3300049460 Bacteria 3141
612 Ga0501032_0020769 3300049569 Bacteria 4571
613 Ga0501033_0227030 3300049570 Bacteria 1327
614 Ga0501034_0021647 3300049571 Bacteria 6549
615 Ga0501036_0017928 3300049572 Bacteria 5927
616 Ga0501037_0138928 3300049573 Bacteria 1739
617 Ga0501038_0103532 3300049574 Bacteria 2367
618 Ga0501039_0769530 3300049575 Bacteria 751
619 Ga0501043_0041816 3300049579 Bacteria 3600
620 Ga0501046_0185966 3300049580 Bacteria 1551
621 Ga0501047_0102897 3300049581 Bacteria 2735
622 Ga0501047_0378134 3300049581 Bacteria 1251
623 Ga0501070_0408029 3300049586 Bacteria 1098
624 Ga0501073_0258633 3300049589 Bacteria 1201
625 Ga0501083_0129674 3300049744 Bacteria 1653
626 Ga0501035_0124945 3300049822 Bacteria 2246
627 Ga0501044_0298142 3300049823 Bacteria 1541
628 nmdc:mga00v17_400694_c1 3300050491 Bacteria 892
629 nmdc:mga00v17_89033_c1 3300050491 Bacteria 1936
630 nmdc:mga0yw44_101706_c1 3300050492 Bacteria 1831
631 nmdc:mga0yw44_75092_c1 3300050492 Bacteria 2107
632 nmdc:mga0k408_85095_c1 3300050493 Bacteria 1856
633 nmdc:mga06z11_43720_c1 3300050494 Bacteria 2256
634 nmdc:mga06z11_74165_c2 3300050494 Bacteria 1412
635 nmdc:mga04h51_154717_c1 3300050495 Bacteria 879
636 nmdc:mga07m45_16335_c2 3300050496 Bacteria 2353
637 nmdc:mga07m45_26528_c1 3300050496 Bacteria 3185
638 nmdc:mga05p37_45593_c1 3300050507 Bacteria 5391
639 nmdc:mga0sz30_113942_c1 3300050516 Bacteria 1186
640 nmdc:mga0sz30_45004_c1 3300050516 Bacteria 1861
641 nmdc:mga0sz30_56005_c1 3300050516 Bacteria 1679
642 Ga0495601_0020087 3300053077 Bacteria 4077
643 Ga0495601_0217757 3300053077 Bacteria 1247
644 Ga0495612_0002992 3300053078 Bacteria 7013
645 Ga0495612_0153146 3300053078 Bacteria 1004
646 Ga0500610_0230352 3300053079 Bacteria 870
647 Ga0500635_0059747 3300053080 Bacteria 1327
648 Ga0495655_0003802 3300053083 Bacteria 2526
649 Ga0495595_0029835 3300053084 Bacteria 2443
650 Ga0495595_0077938 3300053084 Bacteria 1575
651 Ga0495619_0018508 3300053085 Bacteria 4418
652 Ga0495619_0085957 3300053085 Bacteria 2125
653 Ga0500643_000319 3300053087 Bacteria 38698
654 Ga0500644_0010834 3300053088 Bacteria 2475
655 Ga0500644_0045021 3300053088 Bacteria 1484
656 Ga0500644_0156910 3300053088 Bacteria 917
657 Ga0500646_0041681 3300053090 Bacteria 1294
658 Ga0500647_0122682 3300053091 Bacteria 1229
659 Ga0500583_0028724 3300053092 Bacteria 2416
660 Ga0500566_0001751 3300053094 Bacteria 12748
661 Ga0500566_0014704 3300053094 Bacteria 4597
662 Ga0500641_0040581 3300053096 Bacteria 1880
663 Ga0500650_0001020 3300053098 Bacteria 7972
664 Ga0500554_090924 3300053102 Bacteria 1014
665 Ga0500555_009494 3300053103 Bacteria 2783
666 Ga0500555_104108 3300053103 Bacteria 719
667 Ga0500556_0105739 3300053104 Bacteria 1088
668 Ga0500557_000173 3300053105 Bacteria 13018
669 Ga0500569_128001 3300053109 Bacteria 849
670 Ga0500572_003830 3300053111 Bacteria 3418
671 Ga0500608_019451 3300053122 Bacteria 3114
672 Ga0500618_010338 3300053125 Bacteria 2507
673 Ga0500618_076717 3300053125 Bacteria 749
674 Ga0500642_0000057 3300053130 Bacteria 67011
675 Ga0500642_0005979 3300053130 Bacteria 3971
676 Ga0500652_030150 3300053131 Bacteria 2120
677 Ga0500658_0031793 3300053134 Bacteria 2066
678 Ga0500658_0122116 3300053134 Bacteria 1155
679 Ga0500559_0000763 3300053136 Bacteria 21093
680 Ga0500559_0011045 3300053136 Bacteria 3866
681 Ga0500559_0098307 3300053136 Bacteria 1346
682 Ga0500568_0006307 3300053139 Bacteria 5972
683 Ga0500568_0028856 3300053139 Bacteria 2309
684 Ga0500577_0000095 3300053142 Bacteria 21049
685 Ga0500579_127838 3300053143 Bacteria 1202
686 Ga0500586_000083 3300053145 Bacteria 16354
687 Ga0500588_0117499 3300053146 Bacteria 934
688 Ga0500590_015151 3300053148 Bacteria 3980
689 Ga0500590_023107 3300053148 Bacteria 3231
690 Ga0500604_0010681 3300053151 Bacteria 2459
691 Ga0500616_0000031 3300053153 Bacteria 415013
692 Ga0500616_0000034 3300053153 Bacteria 396651
693 Ga0500616_0019195 3300053153 Bacteria 3854
694 Ga0500619_001130 3300053154 Bacteria 4632
695 Ga0500622_0009308 3300053156 Bacteria 5443
696 Ga0500622_0011211 3300053156 Bacteria 4891
697 Ga0500634_0072918 3300053161 Bacteria 1791
698 Ga0500638_009092 3300053162 Bacteria 4276
699 Ga0500636_0000102 3300053177 Bacteria 43520
700 Ga0500636_0002288 3300053177 Bacteria 10633
701 Ga0500637_0056671 3300053178 Bacteria 2239
702 Ga0500645_063301 3300053730 Bacteria 1067
703 Ga0500599_003327 3300053736 Bacteria 1957
704 Ga0500601_010092 3300053737 Bacteria 1055
705 Ga0500661_004840 3300055283 Bacteria 2518
706 Ga0466962_0047405 3300061719 Bacteria 2053

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053088 Ga0500644_0045021 Ga0500644_0045021_949_1473 158
2 3300035119 Ga0373956_0195527 Ga0373956_0195527_109_672 164
3 3300037068 Ga0373925_0141888 Ga0373925_0141888_866_1429 164
4 3300046463 Ga0495653_0113799 Ga0495653_0113799_1247_1810 164
5 3300046511 Ga0495608_0052451 Ga0495608_0052451_255_818 164
6 3300046514 Ga0495618_0138442 Ga0495618_0138442_77_640 164
7 3300048088 Ga0495602_0030714 Ga0495602_0030714_1249_1812 164
8 3300037068 Ga0373925_0122404 Ga0373925_0122404_46_609 166
9 3300009147 Ga0114129_10028910 Ga0114129_1002891010 169
10 3300050507 nmdc:mga05p37_45593_c1 nmdc:mga05p37_45593_c1_290_928 169
11 3300046660 Ga0495625_0031145 Ga0495625_0031145_3388_3948 170
12 3300046674 Ga0495588_0504143 Ga0495588_0504143_43_603 170
13 3300049459 Ga0495678_122823 Ga0495678_122823_30_590 170
14 3300053103 Ga0500555_104108 Ga0500555_104108_129_689 170
15 3300053730 Ga0500645_063301 Ga0500645_063301_467_1027 170
16 3300005327 Ga0070658_10014422 Ga0070658_100144224 171
17 3300025909 Ga0207705_10046241 Ga0207705_100462413 171
18 3300005458 Ga0070681_10659162 Ga0070681_106591621 172
19 3300025912 Ga0207707_10233802 Ga0207707_102338022 172
20 3300025932 Ga0207690_10734547 Ga0207690_107345472 172
21 3300026041 Ga0207639_11004289 Ga0207639_110042891 172
22 3300005435 Ga0070714_100099186 Ga0070714_1000991864 173
23 3300025929 Ga0207664_10058593 Ga0207664_100585934 173
24 3300048906 Ga0496103_0313010 Ga0496103_0313010_35_673 173
25 3300048908 Ga0496105_0750816 Ga0496105_0750816_82_720 173
26 3300048910 Ga0496107_0241254 Ga0496107_0241254_58_696 173
27 3300048911 Ga0496108_0664591 Ga0496108_0664591_124_762 173
28 3300046683 Ga0495658_0272120 Ga0495658_0272120_102_737 176
29 3300048929 Ga0496126_0390969 Ga0496126_0390969_131_775 176
30 3300046473 Ga0495582_0037422 Ga0495582_0037422_1099_1737 180
31 3300047315 Ga0495581_0047799 Ga0495581_0047799_1807_2445 180
32 3300004625 Ga0055543_1033406 Ga0055543_10334061 181
33 3300049581 Ga0501047_0378134 Ga0501047_0378134_349_981 181
34 3300053125 Ga0500618_076717 Ga0500618_076717_40_684 181
35 3300053142 Ga0500577_0000095 Ga0500577_0000095_4463_5104 181
36 3300003354 JGI25160J50197_1013323 JGI25160J50197_10133232 182
37 3300005262 Ga0065165_1001679 Ga0065165_100167910 182
38 3300005336 Ga0070680_100053852 Ga0070680_1000538522 182
39 3300005337 Ga0070682_100185706 Ga0070682_1001857062 182
40 3300005434 Ga0070709_10043739 Ga0070709_100437392 182
41 3300005436 Ga0070713_100171313 Ga0070713_1001713132 182
42 3300005458 Ga0070681_10033224 Ga0070681_100332242 182
43 3300005530 Ga0070679_100035252 Ga0070679_1000352526 182
44 3300005563 Ga0068855_100762712 Ga0068855_1007627121 182
45 3300006028 Ga0070717_10337192 Ga0070717_103371921 182
46 3300006946 Ga0079104_1050574 Ga0079104_10505741 182
47 3300009093 Ga0105240_10404415 Ga0105240_104044151 182
48 3300013307 Ga0157372_10082842 Ga0157372_100828422 182
49 3300025302 Ga0207426_1000620 Ga0207426_10006207 182
50 3300025906 Ga0207699_10006782 Ga0207699_100067822 182
51 3300025912 Ga0207707_10001362 Ga0207707_1000136225 182
52 3300025917 Ga0207660_10015194 Ga0207660_100151945 182
53 3300025921 Ga0207652_10234377 Ga0207652_102343772 182
54 3300025928 Ga0207700_10072969 Ga0207700_100729692 182
55 3300035083 Ga0373926_0053807 Ga0373926_0053807_66_710 182
56 3300035113 Ga0373936_0092746 Ga0373936_0092746_271_915 182
57 3300035116 Ga0373945_0044654 Ga0373945_0044654_171_809 182
58 3300035118 Ga0373954_0083523 Ga0373954_0083523_253_897 182
59 3300035171 Ga0373946_0005588 Ga0373946_0005588_340_984 182
60 3300035410 Ga0373924_0021211 Ga0373924_0021211_772_1416 182
61 3300035695 Ga0373927_0014532 Ga0373927_0014532_3202_3846 182
62 3300035724 Ga0373933_0065194 Ga0373933_0065194_1093_1737 182
63 3300046454 Ga0495592_0047069 Ga0495592_0047069_2392_3036 182
64 3300046473 Ga0495582_0017699 Ga0495582_0017699_1315_1959 182
65 3300046477 Ga0495664_0298499 Ga0495664_0298499_172_810 182
66 3300046514 Ga0495618_0026681 Ga0495618_0026681_1290_1934 182
67 3300046517 Ga0495630_0061703 Ga0495630_0061703_1028_1672 182
68 3300046531 Ga0495665_0061181 Ga0495665_0061181_382_1026 182
69 3300046533 Ga0495640_0006879 Ga0495640_0006879_5651_6295 182
70 3300046642 Ga0495634_0176203 Ga0495634_0176203_332_970 182
71 3300046680 Ga0495646_0029662 Ga0495646_0029662_894_1538 182
72 3300046681 Ga0495647_0270857 Ga0495647_0270857_103_741 182
73 3300046690 Ga0495624_0032066 Ga0495624_0032066_930_1568 182
74 3300047317 Ga0495604_0217186 Ga0495604_0217186_54_698 182
75 3300047320 Ga0495672_0072588 Ga0495672_0072588_323_961 182
76 3300047471 Ga0495684_0009757 Ga0495684_0009757_5682_6326 182
77 3300048907 Ga0496104_0000281 Ga0496104_0000281_24687_25325 182
78 3300048917 Ga0496114_0246333 Ga0496114_0246333_334_972 182
79 3300048924 Ga0496121_0038503 Ga0496121_0038503_1801_2439 182
80 3300048929 Ga0496126_0086673 Ga0496126_0086673_731_1369 182
81 3300048929 Ga0496126_0114989 Ga0496126_0114989_116_754 182
82 3300053078 Ga0495612_0153146 Ga0495612_0153146_101_739 182
83 3300039437 Ga0436365_1718107 Ga0436365_1718107_399_1037 183
84 3300042006 Ga0439432_077789 Ga0439432_077789_334_972 183
85 3300048929 Ga0496126_0021354 Ga0496126_0021354_421_1059 183
86 3300003215 JGI25153J46596_10006581 JGI25153J46596_100065814 184
87 3300003794 Ga0055531_10037619 Ga0055531_100376192 184
88 3300005262 Ga0065165_1004782 Ga0065165_10047829 184
89 3300005456 Ga0070678_100232464 Ga0070678_1002324642 184
90 3300005548 Ga0070665_100111156 Ga0070665_1001111563 184
91 3300025295 Ga0209564_1006232 Ga0209564_10062324 184
92 3300025297 Ga0209758_1000011 Ga0209758_1000011226 184
93 3300025304 Ga0209257_1001196 Ga0209257_100119614 184
94 3300035086 Ga0373934_0081513 Ga0373934_0081513_78_716 184
95 3300035172 Ga0373955_0212974 Ga0373955_0212974_364_1002 184
96 3300036401 Ga0373937_0331486 Ga0373937_0331486_421_1059 184
97 3300039450 Ga0436363_1267944 Ga0436363_1267944_209_847 184
98 3300041494 Ga0451837_1556812 Ga0451837_1556812_410_1048 184
99 3300044658 Ga0466972_0001204 Ga0466972_0001204_11407_12045 184
100 3300046529 Ga0495652_0120287 Ga0495652_0120287_766_1404 184
101 3300046559 Ga0495667_0065521 Ga0495667_0065521_1381_2025 184
102 3300047320 Ga0495672_0022620 Ga0495672_0022620_455_1093 184
103 3300053077 Ga0495601_0217757 Ga0495601_0217757_329_967 184
104 3300053084 Ga0495595_0029835 Ga0495595_0029835_988_1626 184
105 3300053085 Ga0495619_0085957 Ga0495619_0085957_1432_2070 184
106 3300053104 Ga0500556_0105739 Ga0500556_0105739_222_860 184
107 3300053139 Ga0500568_0006307 Ga0500568_0006307_437_1075 184
108 3300005330 Ga0070690_100025612 Ga0070690_1000256122 185
109 3300005334 Ga0068869_100266211 Ga0068869_1002662112 185
110 3300005339 Ga0070660_100038698 Ga0070660_1000386985 185
111 3300005347 Ga0070668_100229052 Ga0070668_1002290522 185
112 3300005353 Ga0070669_100056356 Ga0070669_1000563562 185
113 3300005367 Ga0070667_100087671 Ga0070667_1000876711 185
114 3300005438 Ga0070701_10085110 Ga0070701_100851102 185
115 3300005441 Ga0070700_100087976 Ga0070700_1000879762 185
116 3300005455 Ga0070663_100711303 Ga0070663_1007113031 185
117 3300005459 Ga0068867_100126985 Ga0068867_1001269853 185
118 3300005544 Ga0070686_100029356 Ga0070686_1000293563 185
119 3300005548 Ga0070665_100429724 Ga0070665_1004297242 185
120 3300005578 Ga0068854_100029620 Ga0068854_1000296205 185
121 3300005578 Ga0068854_100070125 Ga0068854_1000701252 185
122 3300005844 Ga0068862_100030238 Ga0068862_1000302382 185
123 3300006881 Ga0068865_100018327 Ga0068865_1000183272 185
124 3300009094 Ga0111539_10235262 Ga0111539_102352622 185
125 3300009098 Ga0105245_10033898 Ga0105245_100338985 185
126 3300009098 Ga0105245_10625225 Ga0105245_106252252 185
127 3300009148 Ga0105243_10026251 Ga0105243_100262513 185
128 3300009177 Ga0105248_10339830 Ga0105248_103398302 185
129 3300009545 Ga0105237_10973237 Ga0105237_109732371 185
130 3300009553 Ga0105249_10080028 Ga0105249_100800284 185
131 3300010375 Ga0105239_10117346 Ga0105239_101173463 185
132 3300011119 Ga0105246_10590744 Ga0105246_105907441 185
133 3300013306 Ga0163162_10063695 Ga0163162_100636952 185
134 3300013308 Ga0157375_10112897 Ga0157375_101128971 185
135 3300014968 Ga0157379_10106063 Ga0157379_101060632 185
136 3300014969 Ga0157376_10564534 Ga0157376_105645342 185
137 3300025899 Ga0207642_10012943 Ga0207642_100129432 185
138 3300025907 Ga0207645_10058724 Ga0207645_100587242 185
139 3300025919 Ga0207657_10164356 Ga0207657_101643562 185
140 3300025927 Ga0207687_10096569 Ga0207687_100965692 185
141 3300025935 Ga0207709_10785145 Ga0207709_107851451 185
142 3300025937 Ga0207669_10014469 Ga0207669_100144693 185
143 3300025938 Ga0207704_10008022 Ga0207704_100080225 185
144 3300025940 Ga0207691_10082354 Ga0207691_100823544 185
145 3300025942 Ga0207689_10255575 Ga0207689_102555752 185
146 3300025961 Ga0207712_10022330 Ga0207712_100223305 185
147 3300025981 Ga0207640_10027127 Ga0207640_100271275 185
148 3300025981 Ga0207640_10086930 Ga0207640_100869302 185
149 3300025986 Ga0207658_10032320 Ga0207658_100323203 185
150 3300026067 Ga0207678_10083464 Ga0207678_100834642 185
151 3300026118 Ga0207675_100048738 Ga0207675_1000487382 185
152 3300026121 Ga0207683_10094651 Ga0207683_100946511 185
153 3300026142 Ga0207698_10983397 Ga0207698_109833972 185
154 3300027907 Ga0207428_10183872 Ga0207428_101838722 185
155 3300028380 Ga0268265_10090485 Ga0268265_100904852 185
156 3300031711 Ga0265314_10066984 Ga0265314_100669843 185
157 3300031712 Ga0265342_10052344 Ga0265342_100523442 185
158 3300033180 Ga0307510_10223192 Ga0307510_102231921 185
159 3300046459 Ga0495629_0001074 Ga0495629_0001074_16270_16908 185
160 3300046463 Ga0495653_0510714 Ga0495653_0510714_28_666 185
161 3300046491 Ga0495584_0037173 Ga0495584_0037173_1695_2333 185
162 3300046499 Ga0495594_0039656 Ga0495594_0039656_1404_2042 185
163 3300046514 Ga0495618_0153232 Ga0495618_0153232_351_989 185
164 3300046519 Ga0495632_0115767 Ga0495632_0115767_285_923 185
165 3300046529 Ga0495652_0005984 Ga0495652_0005984_9872_10510 185
166 3300046533 Ga0495640_0014950 Ga0495640_0014950_2670_3308 185
167 3300046537 Ga0495598_0060766 Ga0495598_0060766_47_685 185
168 3300046557 Ga0495622_0004871 Ga0495622_0004871_3472_4110 185
169 3300046615 Ga0495656_0014355 Ga0495656_0014355_1528_2166 185
170 3300046642 Ga0495634_0037946 Ga0495634_0037946_2133_2771 185
171 3300046648 Ga0495611_0073552 Ga0495611_0073552_420_1058 185
172 3300046663 Ga0495635_0009100 Ga0495635_0009100_3146_3784 185
173 3300046674 Ga0495588_0062386 Ga0495588_0062386_1119_1757 185
174 3300046675 Ga0495657_0002878 Ga0495657_0002878_11089_11727 185
175 3300046684 Ga0495669_0001263 Ga0495669_0001263_1199_1837 185
176 3300046689 Ga0495613_0037912 Ga0495613_0037912_1368_2006 185
177 3300046690 Ga0495624_0024346 Ga0495624_0024346_1862_2500 185
178 3300046691 Ga0495670_0187578 Ga0495670_0187578_87_725 185
179 3300046692 Ga0495671_0233492 Ga0495671_0233492_105_743 185
180 3300046809 Ga0495600_0018484 Ga0495600_0018484_1245_1883 185
181 3300047317 Ga0495604_0060125 Ga0495604_0060125_1451_2089 185
182 3300047317 Ga0495604_0424672 Ga0495604_0424672_205_849 185
183 3300047673 Ga0495593_0045925 Ga0495593_0045925_1419_2057 185
184 3300048089 Ga0495614_0207256 Ga0495614_0207256_111_749 185
185 3300048903 Ga0496100_0410972 Ga0496100_0410972_332_970 185
186 3300048905 Ga0496102_0134081 Ga0496102_0134081_132_770 185
187 3300048908 Ga0496105_0001556 Ga0496105_0001556_1378_2016 185
188 3300048918 Ga0496115_0062942 Ga0496115_0062942_411_1049 185
189 3300048920 Ga0496117_0175564 Ga0496117_0175564_138_776 185
190 3300048922 Ga0496119_0003040 Ga0496119_0003040_14242_14880 185
191 3300048923 Ga0496120_0001511 Ga0496120_0001511_15213_15851 185
192 3300048924 Ga0496121_0035087 Ga0496121_0035087_1728_2366 185
193 3300048925 Ga0496122_0092534 Ga0496122_0092534_930_1568 185
194 3300048927 Ga0496124_0499655 Ga0496124_0499655_142_780 185
195 3300048928 Ga0496125_0032889 Ga0496125_0032889_381_1019 185
196 3300053122 Ga0500608_019451 Ga0500608_019451_1487_2125 185
197 3300053136 Ga0500559_0000763 Ga0500559_0000763_6038_6676 185
198 3300053136 Ga0500559_0098307 Ga0500559_0098307_28_666 185
199 3300053736 Ga0500599_003327 Ga0500599_003327_845_1483 185
200 3300055283 Ga0500661_004840 Ga0500661_004840_429_1067 185
201 3300003215 JGI25153J46596_10058684 JGI25153J46596_100586842 186
202 3300005614 Ga0068856_100000061 Ga0068856_10000006174 186
203 3300005937 Ga0081455_10006207 Ga0081455_100062073 186
204 3300006163 Ga0070715_10129947 Ga0070715_101299472 186
205 3300006941 Ga0099825_1030152 Ga0099825_10301524 186
206 3300025297 Ga0209758_1017170 Ga0209758_10171702 186
207 3300025905 Ga0207685_10105399 Ga0207685_101053992 186
208 3300026078 Ga0207702_10000674 Ga0207702_1000067428 186
209 3300027296 Ga0209389_1000001 Ga0209389_1000001231 186
210 3300027361 Ga0209489_111101 Ga0209489_1111017 186
211 3300027363 Ga0209700_100007 Ga0209700_100007194 186
212 3300044684 Ga0466966_0001059 Ga0466966_0001059_9614_10252 186
213 3300044693 Ga0466961_0000050 Ga0466961_0000050_13561_14199 186
214 3300044693 Ga0466961_0150419 Ga0466961_0150419_675_1313 186
215 3300045049 Ga0466959_0021131 Ga0466959_0021131_3209_3847 186
216 3300045976 Ga0466967_0061854 Ga0466967_0061854_683_1321 186
217 3300004625 Ga0055543_1001388 Ga0055543_10013884 187
218 3300005262 Ga0065165_1002181 Ga0065165_100218115 187
219 3300021320 Ga0214544_1000368 Ga0214544_100036839 187
220 3300021321 Ga0214542_1002192 Ga0214542_100219229 187
221 3300021324 Ga0214545_1000203 Ga0214545_100020339 187
222 3300021327 Ga0214543_1000322 Ga0214543_100032239 187
223 3300021377 Ga0213874_10035272 Ga0213874_100352722 187
224 3300025297 Ga0209758_1020271 Ga0209758_10202713 187
225 3300025302 Ga0207426_1020710 Ga0207426_10207103 187
226 3300035118 Ga0373954_0029735 Ga0373954_0029735_1153_1785 187
227 3300035172 Ga0373955_0226510 Ga0373955_0226510_14_646 187
228 3300037471 Ga0395905_0145412 Ga0395905_0145412_940_1578 187
229 3300037853 Ga0436364_1318234 Ga0436364_1318234_1149_1787 187
230 3300039450 Ga0436363_0263740 Ga0436363_0263740_654_1292 187
231 3300039450 Ga0436363_1457984 Ga0436363_1457984_463_1119 187
232 3300044658 Ga0466972_0000333 Ga0466972_0000333_22201_22839 187
233 3300044658 Ga0466972_0068108 Ga0466972_0068108_501_1139 187
234 3300044683 Ga0466965_0100487 Ga0466965_0100487_431_1069 187
235 3300044735 Ga0466968_0039031 Ga0466968_0039031_1184_1822 187
236 3300044765 Ga0466970_0115905 Ga0466970_0115905_733_1371 187
237 3300046476 Ga0495662_0054440 Ga0495662_0054440_48_686 187
238 3300046516 Ga0495628_0238003 Ga0495628_0238003_552_1184 187
239 3300046516 Ga0495628_0349865 Ga0495628_0349865_242_874 187
240 3300046529 Ga0495652_0271441 Ga0495652_0271441_337_969 187
241 3300046536 Ga0495587_0095823 Ga0495587_0095823_666_1298 187
242 3300046543 Ga0495645_0081830 Ga0495645_0081830_65_697 187
243 3300046675 Ga0495657_0203959 Ga0495657_0203959_352_984 187
244 3300046679 Ga0495623_0105087 Ga0495623_0105087_78_710 187
245 3300047444 Ga0495675_0140641 Ga0495675_0140641_832_1464 187
246 3300048927 Ga0496124_0217659 Ga0496124_0217659_651_1289 187
247 3300053094 Ga0500566_0014704 Ga0500566_0014704_2819_3457 187
248 3300053111 Ga0500572_003830 Ga0500572_003830_604_1242 187
249 3300053130 Ga0500642_0000057 Ga0500642_0000057_10110_10748 187
250 3300053177 Ga0500636_0000102 Ga0500636_0000102_11714_12352 187
251 3300005355 Ga0070671_100514230 Ga0070671_1005142302 188
252 3300005434 Ga0070709_10005587 Ga0070709_100055872 188
253 3300005436 Ga0070713_100005894 Ga0070713_1000058946 188
254 3300005437 Ga0070710_10057100 Ga0070710_100571003 188
255 3300005439 Ga0070711_100004477 Ga0070711_1000044774 188
256 3300005548 Ga0070665_100195513 Ga0070665_1001955132 188
257 3300005618 Ga0068864_100769369 Ga0068864_1007693691 188
258 3300006048 Ga0075363_100044231 Ga0075363_1000442312 188
259 3300006163 Ga0070715_10158970 Ga0070715_101589701 188
260 3300006175 Ga0070712_100093359 Ga0070712_1000933592 188
261 3300025898 Ga0207692_10364644 Ga0207692_103646442 188
262 3300025905 Ga0207685_10086553 Ga0207685_100865532 188
263 3300025906 Ga0207699_10049144 Ga0207699_100491442 188
264 3300025915 Ga0207693_10026503 Ga0207693_100265033 188
265 3300026067 Ga0207678_10194046 Ga0207678_101940462 188
266 3300026088 Ga0207641_10801116 Ga0207641_108011161 188
267 3300028786 Ga0307517_10001507 Ga0307517_100015077 188
268 3300046463 Ga0495653_0033029 Ga0495653_0033029_3201_3845 188
269 3300046690 Ga0495624_0442618 Ga0495624_0442618_53_691 188
270 3300048915 Ga0496112_0753467 Ga0496112_0753467_59_697 188
271 3300048928 Ga0496125_0005006 Ga0496125_0005006_10883_11527 188
272 3300053079 Ga0500610_0230352 Ga0500610_0230352_138_776 188
273 3300003215 JGI25153J46596_10003303 JGI25153J46596_100033036 189
274 3300005441 Ga0070700_100508332 Ga0070700_1005083322 189
275 3300025297 Ga0209758_1000365 Ga0209758_100036574 189
276 3300031250 Ga0265331_10033872 Ga0265331_100338723 189
277 3300037853 Ga0436364_0561281 Ga0436364_0561281_43_681 189
278 3300039437 Ga0436365_1553711 Ga0436365_1553711_1334_1972 189
279 3300003215 JGI25153J46596_10052382 JGI25153J46596_100523822 190
280 3300025297 Ga0209758_1017378 Ga0209758_10173783 190
281 3300025981 Ga0207640_10883235 Ga0207640_108832351 190
282 3300031901 Ga0307406_10330526 Ga0307406_103305261 190
283 iso_pu_bacteria 2989771324 2989775569 190
284 3300005329 Ga0070683_100012219 Ga0070683_1000122198 191
285 3300005535 Ga0070684_100005320 Ga0070684_1000053209 191
286 3300010375 Ga0105239_10189212 Ga0105239_101892123 191
287 3300025912 Ga0207707_10049987 Ga0207707_100499874 191
288 3300025913 Ga0207695_10258535 Ga0207695_102585353 191
289 3300025944 Ga0207661_10000647 Ga0207661_1000064718 191
290 3300028573 Ga0265334_10174106 Ga0265334_101741062 191
291 3300031235 Ga0265330_10052689 Ga0265330_100526892 191
292 3300031712 Ga0265342_10076950 Ga0265342_100769502 191
293 3300035086 Ga0373934_0005198 Ga0373934_0005198_442_1080 191
294 3300035117 Ga0373953_0001814 Ga0373953_0001814_3005_3643 191
295 3300035118 Ga0373954_0001141 Ga0373954_0001141_2864_3502 191
296 3300035119 Ga0373956_0001770 Ga0373956_0001770_5665_6303 191
297 3300035120 Ga0373957_0007539 Ga0373957_0007539_1377_2015 191
298 3300035172 Ga0373955_0004475 Ga0373955_0004475_3093_3731 191
299 3300035724 Ga0373933_0001421 Ga0373933_0001421_575_1213 191
300 3300036401 Ga0373937_0007299 Ga0373937_0007299_2435_3073 191
301 3300046454 Ga0495592_0002728 Ga0495592_0002728_8071_8709 191
302 3300046459 Ga0495629_0005031 Ga0495629_0005031_2764_3402 191
303 3300046462 Ga0495651_0009631 Ga0495651_0009631_497_1135 191
304 3300046463 Ga0495653_0000513 Ga0495653_0000513_21361_21999 191
305 3300046499 Ga0495594_0208631 Ga0495594_0208631_247_885 191
306 3300046511 Ga0495608_0003659 Ga0495608_0003659_8101_8739 191
307 3300046516 Ga0495628_0019165 Ga0495628_0019165_3061_3699 191
308 3300046529 Ga0495652_0019338 Ga0495652_0019338_2676_3314 191
309 3300046533 Ga0495640_0031760 Ga0495640_0031760_913_1551 191
310 3300046536 Ga0495587_0001598 Ga0495587_0001598_2313_2951 191
311 3300046543 Ga0495645_0010435 Ga0495645_0010435_3549_4187 191
312 3300046559 Ga0495667_0003789 Ga0495667_0003789_6754_7392 191
313 3300046642 Ga0495634_0005582 Ga0495634_0005582_3290_3928 191
314 3300046663 Ga0495635_0000211 Ga0495635_0000211_8530_9168 191
315 3300046675 Ga0495657_0002321 Ga0495657_0002321_7027_7665 191
316 3300046678 Ga0495599_0000957 Ga0495599_0000957_6828_7466 191
317 3300046680 Ga0495646_0004069 Ga0495646_0004069_5323_5961 191
318 3300047317 Ga0495604_0010845 Ga0495604_0010845_4037_4675 191
319 3300047319 Ga0495674_0014461 Ga0495674_0014461_4438_5076 191
320 3300047322 Ga0495680_0006158 Ga0495680_0006158_6754_7392 191
321 3300047444 Ga0495675_0001324 Ga0495675_0001324_6402_7040 191
322 3300047471 Ga0495684_0015063 Ga0495684_0015063_2642_3280 191
323 3300047673 Ga0495593_0002923 Ga0495593_0002923_6497_7135 191
324 3300048088 Ga0495602_0008570 Ga0495602_0008570_2490_3128 191
325 3300053077 Ga0495601_0020087 Ga0495601_0020087_781_1419 191
326 3300053085 Ga0495619_0018508 Ga0495619_0018508_2313_2951 191
327 iso_pu_bacteria 2508501009 2508541867 192
328 iso_pu_bacteria 2508501042 2508692589 192
329 iso_pu_bacteria 2510065057 2510306137 192
330 iso_pu_bacteria 2511231028 2511397100 192
331 iso_pu_bacteria 2513237091 2513615026 192
332 iso_pu_bacteria 2513237092 2513622969 192
333 iso_pu_bacteria 2513237095 2513647429 192
334 iso_pu_bacteria 2513237102 2513699548 192
335 iso_pu_bacteria 2513237139 2513878435 192
336 iso_pu_bacteria 2513237161 2514009517 192
337 iso_pu_bacteria 2515154112 2515625999 192
338 iso_pu_bacteria 2517093001 2517104068 192
339 iso_pu_bacteria 2524023205 2524436372 192
340 iso_pu_bacteria 2528768022 2528849073 192
341 iso_pu_bacteria 2617270735 2617346714 192
342 iso_pu_bacteria 2744054633 2745080674 192
343 iso_pu_bacteria 2791355196 2793064438 192
344 iso_pu_bacteria 2802429603 2805919141 192
345 iso_pu_bacteria 2816332527 2818236466 192
346 iso_pu_bacteria 2824600985 2824607086 192
347 iso_pu_bacteria 2824609381 2824612968 192
348 iso_pu_bacteria 2824617872 2824621923 192
349 iso_pu_bacteria 2824626560 2824631609 192
350 iso_pu_bacteria 2824635225 2824641701 192
351 iso_pu_bacteria 2824644064 2824649357 192
352 iso_pu_bacteria 2824653114 2824659468 192
353 iso_pu_bacteria 2824661429 2824668510 192
354 iso_pu_bacteria 2824679649 2824682934 192
355 iso_pu_bacteria 2824704595 2824713660 192
356 iso_pu_bacteria 2824714736 2824719190 192
357 iso_pu_bacteria 2824723954 2824729601 192
358 iso_pu_bacteria 2824753945 2824758464 192
359 iso_pu_bacteria 2824763712 2824770048 192
360 iso_pu_bacteria 2824773399 2824775213 192
361 iso_pu_bacteria 2838122688 2838128885 192
362 iso_pu_bacteria 2841941048 2841944968 192
363 iso_pu_bacteria 2841949485 2841953392 192
364 iso_pu_bacteria 2841957949 2841959781 192
365 iso_pu_bacteria 2841966195 2841972137 192
366 iso_pu_bacteria 2841974524 2841978117 192
367 iso_pu_bacteria 2841983080 2841986260 192
368 iso_pu_bacteria 2842038055 2842040565 192
369 iso_pu_bacteria 2842045827 2842046489 192
370 iso_pu_bacteria 2847930680 2847937240 192
371 iso_pu_bacteria 2847939898 2847947654 192
372 iso_pu_bacteria 2849076700 2849078490 192
373 iso_pu_bacteria 2857509624 2857512850 192
374 iso_pu_bacteria 2874590934 2874598852 192
375 iso_pu_bacteria 2874612657 2874614662 192
376 iso_pu_bacteria 2874645413 2874652308 192
377 iso_pu_bacteria 2876761206 2876766181 192
378 iso_pu_bacteria 2876771140 2876778891 192
379 iso_pu_bacteria 2876818435 2876824214 192
380 iso_pu_bacteria 2879074833 2879082684 192
381 iso_pu_bacteria 2879099564 2879107047 192
382 iso_pu_bacteria 2879127579 2879132155 192
383 iso_pu_bacteria 2879142872 2879148318 192
384 iso_pu_bacteria 2881364244 2881371543 192
385 iso_pu_bacteria 2881665667 2881671839 192
386 iso_pu_bacteria 2885383462 2885388304 192
387 iso_pu_bacteria 2885409591 2885415600 192
388 iso_pu_bacteria 2888378607 2888385366 192
389 iso_pu_bacteria 2888388044 2888392882 192
390 iso_pu_bacteria 2888419890 2888425502 192
391 iso_pu_bacteria 2893066018 2893066082 192
392 iso_pu_bacteria 2904666416 2904674390 192
393 iso_pu_bacteria 2904711408 2904712069 192
394 iso_pu_bacteria 2906626472 2906627430 192
395 iso_pu_bacteria 2906643746 2906649365 192
396 iso_pu_bacteria 2908775508 2908781088 192
397 iso_pu_bacteria 2915993759 2915999789 192
398 iso_pu_bacteria 2921208531 2921211847 192
399 iso_pu_bacteria 2922368715 2922372500 192
400 iso_pu_bacteria 2922393267 2922397153 192
401 iso_pu_bacteria 2929615660 2929620936 192
402 iso_pu_bacteria 2929624759 2929626233 192
403 iso_pu_bacteria 2932784394 2932784888 192
404 iso_pu_bacteria 2932809354 2932809922 192
405 iso_pu_bacteria 2932818245 2932818335 192
406 iso_pu_bacteria 2932828146 2932828725 192
407 iso_pu_bacteria 2933577622 2933583194 192
408 iso_pu_bacteria 2935608549 2935609746 192
409 iso_pu_bacteria 2935616580 2935619855 192
410 iso_pu_bacteria 2935638405 2935638837 192
411 iso_pu_bacteria 2935648319 2935654209 192
412 iso_pu_bacteria 2935656913 2935663098 192
413 iso_pu_bacteria 2935665750 2935666313 192
414 iso_pu_bacteria 2935675223 2935676642 192
415 iso_pu_bacteria 2935684952 2935685025 192
416 iso_pu_bacteria 2935694250 2935694721 192
417 iso_pu_bacteria 2935703347 2935703842 192
418 iso_pu_bacteria 2935713505 2935713578 192
419 iso_pu_bacteria 2935722832 2935724198 192
420 iso_pu_bacteria 2935732158 2935733444 192
421 iso_pu_bacteria 2935741537 2935742823 192
422 iso_pu_bacteria 2935750917 2935750990 192
423 iso_pu_bacteria 2935760218 2935760481 192
424 iso_pu_bacteria 2935769743 2935772027 192
425 iso_pu_bacteria 2935777560 2935784202 192
426 iso_pu_bacteria 2935785616 2935787585 192
427 iso_pu_bacteria 2935793552 2935796217 192
428 iso_pu_bacteria 2935801545 2935801979 192
429 iso_pu_bacteria 2935810662 2935810748 192
430 iso_pu_bacteria 2935819856 2935822908 192
431 iso_pu_bacteria 2935827899 2935828331 192
432 iso_pu_bacteria 2935837841 2935839746 192
433 iso_pu_bacteria 2935847175 2935848490 192
434 iso_pu_bacteria 2935855204 2935857830 192
435 iso_pu_bacteria 2935864058 2935868828 192
436 iso_pu_bacteria 2935873716 2935874243 192
437 iso_pu_bacteria 2935908558 2935909706 192
438 iso_pu_bacteria 2935916978 2935917430 192
439 iso_pu_bacteria 2935926038 2935927187 192
440 iso_pu_bacteria 2935934488 2935936969 192
441 iso_pu_bacteria 2935942939 2935944728 192
442 iso_pu_bacteria 2935951376 2935953165 192
443 iso_pu_bacteria 2935959822 2935961330 192
444 iso_pu_bacteria 2935967501 2935970005 192
445 iso_pu_bacteria 2935975950 2935980291 192
446 iso_pu_bacteria 2935984226 2935986944 192
447 iso_pu_bacteria 2935992306 2935992832 192
448 iso_pu_bacteria 2936002035 2936002745 192
449 iso_pu_bacteria 2936011229 2936017254 192
450 iso_pu_bacteria 2936019824 2936025756 192
451 iso_pu_bacteria 2936028420 2936034589 192
452 iso_pu_bacteria 2936037263 2936037832 192
453 iso_pu_bacteria 2936046547 2936052646 192
454 iso_pu_bacteria 2936055302 2936062071 192
455 iso_pu_bacteria 2937091812 2937095149 192
456 iso_pu_bacteria 2940556831 2940558207 192
457 iso_pu_bacteria 2941538514 2941540913 192
458 iso_pu_bacteria 2960652885 2960656070 192
459 iso_pu_bacteria 2964656573 2964658090 192
460 iso_pu_bacteria 2970184632 2970187350 192
461 iso_pu_bacteria 3005483717 3005484879 192
462 iso_pu_bacteria 3005506211 3005508507 192
463 iso_pu_bacteria 3005587118 3005587157 192
464 iso_pu_bacteria 3005594810 3005600210 192
465 iso_pu_bacteria 3005710791 3005715725 192
466 iso_pu_bacteria 3005718088 3005723070 192
467 iso_pu_bacteria 8006926726 8006930877 192
468 iso_pu_bacteria 8016511872 8016520752 192
469 iso_pu_bacteria 8016522445 8016528784 192
470 iso_pu_bacteria 8016530956 8016533965 192
471 iso_pu_bacteria 8016539877 8016547193 192
472 iso_pu_bacteria 8016548790 8016554936 192
473 iso_pu_bacteria 8016557553 8016563303 192
474 iso_pu_bacteria 8016566248 8016572306 192
475 iso_pu_bacteria 8016575299 8016576489 192
476 iso_pu_bacteria 8016595262 8016601055 192
477 iso_pu_bacteria 8016603502 8016609398 192
478 iso_pu_bacteria 8016613128 8016615512 192
479 iso_pu_bacteria 8016630954 8016639272 192
480 iso_pu_bacteria 8017057580 8017064833 192
481 iso_pu_bacteria 8019530166 8019533738 192
482 iso_pu_bacteria 8019538911 8019545931 192
483 iso_pu_bacteria 8019547302 8019552795 192
484 iso_pu_bacteria 8019576017 8019584208 192
485 iso_pu_bacteria 8019586578 8019591969 192
486 iso_pu_bacteria 8019597564 8019599317 192
487 iso_pu_bacteria 8019608314 8019609040 192
488 iso_pu_bacteria 8019619141 8019619726 192
489 iso_pu_bacteria 8019629233 8019633388 192
490 iso_pu_bacteria 8019638758 8019646509 192
491 iso_pu_bacteria 8019648815 8019649257 192
492 iso_pu_bacteria 8019659431 8019661272 192
493 iso_pu_bacteria 8019668869 8019670812 192
494 iso_pu_bacteria 8019678201 8019685387 192
495 iso_pu_bacteria 8019687851 8019690978 192
496 iso_pu_bacteria 8055742211 8055745201 192
497 3300009551 Ga0105238_10008473 Ga0105238_100084735 193
498 3300013296 Ga0157374_10013080 Ga0157374_100130806 193
499 3300025914 Ga0207671_10031938 Ga0207671_100319382 193
500 3300025924 Ga0207694_10402564 Ga0207694_104025642 193
501 3300005335 Ga0070666_10120234 Ga0070666_101202341 195
502 3300005985 Ga0081539_10118064 Ga0081539_101180642 195
503 3300009093 Ga0105240_10016135 Ga0105240_100161352 195
504 3300009098 Ga0105245_10351092 Ga0105245_103510922 195
505 3300009101 Ga0105247_10048323 Ga0105247_100483232 195
506 3300009174 Ga0105241_10047364 Ga0105241_100473641 195
507 3300009545 Ga0105237_10085795 Ga0105237_100857953 195
508 3300010375 Ga0105239_10178770 Ga0105239_101787701 195
509 3300025903 Ga0207680_10536558 Ga0207680_105365581 195
510 3300025913 Ga0207695_10000008 Ga0207695_10000008708 195
511 3300025914 Ga0207671_10011774 Ga0207671_100117742 195
512 3300025927 Ga0207687_10115447 Ga0207687_101154472 195
513 3300026142 Ga0207698_10003453 Ga0207698_100034535 195
514 3300028794 Ga0307515_10001890 Ga0307515_100018904 195
515 3300031730 Ga0307516_10173919 Ga0307516_101739192 195
516 3300032005 Ga0307411_10662386 Ga0307411_106623861 195
517 3300033180 Ga0307510_10174924 Ga0307510_101749242 195
518 3300046457 Ga0495590_0090057 Ga0495590_0090057_336_974 195
519 3300046501 Ga0495607_0080723 Ga0495607_0080723_446_1084 195
520 3300046507 Ga0495606_0051812 Ga0495606_0051812_829_1467 195
521 3300046522 Ga0495643_0096143 Ga0495643_0096143_11_625 195
522 3300046524 Ga0495648_0038462 Ga0495648_0038462_1968_2606 195
523 3300046530 Ga0495654_0257755 Ga0495654_0257755_39_677 195
524 3300046660 Ga0495625_0307638 Ga0495625_0307638_230_868 195
525 3300046665 Ga0495661_0103149 Ga0495661_0103149_343_981 195
526 3300046694 Ga0495649_0088179 Ga0495649_0088179_994_1632 195
527 3300047323 Ga0495683_0006277 Ga0495683_0006277_4091_4729 195
528 3300047469 Ga0495673_0040211 Ga0495673_0040211_1078_1716 195
529 3300048904 Ga0496101_0346570 Ga0496101_0346570_101_742 195
530 3300048918 Ga0496115_0863477 Ga0496115_0863477_11_649 195
531 3300048921 Ga0496118_0071041 Ga0496118_0071041_306_944 195
532 3300049460 Ga0495682_0013260 Ga0495682_0013260_1779_2417 195
533 3300053083 Ga0495655_0003802 Ga0495655_0003802_553_1191 195
534 3300053153 Ga0500616_0000034 Ga0500616_0000034_208662_209297 195
535 2010549000 RicEn_C2514 RicEn_46200 196
536 3300003215 JGI25153J46596_10003923 JGI25153J46596_100039237 196
537 3300003308 Ga0006777J48905_1010854 Ga0006777J48905_10108542 196
538 3300003323 rootH1_10049032 rootH1_100490324 196
539 3300003354 JGI25160J50197_1000499 JGI25160J50197_10004993 196
540 3300003354 JGI25160J50197_1001057 JGI25160J50197_10010579 196
541 3300003579 Ga0007429J51699_1020681 Ga0007429J51699_10206812 196
542 3300005262 Ga0065165_1020739 Ga0065165_10207392 196
543 3300005327 Ga0070658_10204640 Ga0070658_102046402 196
544 3300005327 Ga0070658_10430515 Ga0070658_104305152 196
545 3300005329 Ga0070683_100121264 Ga0070683_1001212642 196
546 3300005331 Ga0070670_100083877 Ga0070670_1000838771 196
547 3300005335 Ga0070666_10135389 Ga0070666_101353892 196
548 3300005336 Ga0070680_100052054 Ga0070680_1000520544 196
549 3300005338 Ga0068868_100405742 Ga0068868_1004057422 196
550 3300005339 Ga0070660_100364394 Ga0070660_1003643942 196
551 3300005344 Ga0070661_100135097 Ga0070661_1001350972 196
552 3300005344 Ga0070661_100620230 Ga0070661_1006202302 196
553 3300005345 Ga0070692_10072645 Ga0070692_100726452 196
554 3300005347 Ga0070668_100030576 Ga0070668_1000305763 196
555 3300005355 Ga0070671_100005407 Ga0070671_1000054079 196
556 3300005367 Ga0070667_100198335 Ga0070667_1001983352 196
557 3300005367 Ga0070667_100494030 Ga0070667_1004940302 196
558 3300005434 Ga0070709_10035327 Ga0070709_100353274 196
559 3300005435 Ga0070714_100076342 Ga0070714_1000763421 196
560 3300005435 Ga0070714_100841110 Ga0070714_1008411102 196
561 3300005436 Ga0070713_101307497 Ga0070713_1013074971 196
562 3300005457 Ga0070662_100129504 Ga0070662_1001295042 196
563 3300005458 Ga0070681_10573160 Ga0070681_105731602 196
564 3300005458 Ga0070681_11002842 Ga0070681_110028421 196
565 3300005459 Ga0068867_100265251 Ga0068867_1002652512 196
566 3300005530 Ga0070679_100145568 Ga0070679_1001455682 196
567 3300005535 Ga0070684_100017131 Ga0070684_1000171314 196
568 3300005547 Ga0070693_100057000 Ga0070693_1000570003 196
569 3300005548 Ga0070665_100282608 Ga0070665_1002826084 196
570 3300005548 Ga0070665_100563301 Ga0070665_1005633012 196
571 3300005563 Ga0068855_100312338 Ga0068855_1003123382 196
572 3300005564 Ga0070664_100542670 Ga0070664_1005426702 196
573 3300005577 Ga0068857_100074563 Ga0068857_1000745632 196
574 3300005578 Ga0068854_100122597 Ga0068854_1001225972 196
575 3300005614 Ga0068856_100249706 Ga0068856_1002497062 196
576 3300005616 Ga0068852_100447299 Ga0068852_1004472991 196
577 3300005616 Ga0068852_100692450 Ga0068852_1006924502 196
578 3300005617 Ga0068859_100338953 Ga0068859_1003389532 196
579 3300005719 Ga0068861_100562730 Ga0068861_1005627302 196
580 3300005841 Ga0068863_100262860 Ga0068863_1002628603 196
581 3300005842 Ga0068858_100061945 Ga0068858_1000619454 196
582 3300005842 Ga0068858_100505572 Ga0068858_1005055722 196
583 3300006028 Ga0070717_10149604 Ga0070717_101496043 196
584 3300006038 Ga0075365_10117999 Ga0075365_101179992 196
585 3300006038 Ga0075365_10153997 Ga0075365_101539972 196
586 3300006042 Ga0075368_10002832 Ga0075368_100028323 196
587 3300006048 Ga0075363_100021392 Ga0075363_1000213925 196
588 3300006051 Ga0075364_10026956 Ga0075364_100269565 196
589 3300006051 Ga0075364_10198404 Ga0075364_101984042 196
590 3300006173 Ga0070716_100109247 Ga0070716_1001092472 196
591 3300006173 Ga0070716_100691892 Ga0070716_1006918921 196
592 3300006178 Ga0075367_10001143 Ga0075367_100011438 196
593 3300006178 Ga0075367_10103413 Ga0075367_101034132 196
594 3300006195 Ga0075366_10185826 Ga0075366_101858262 196
595 3300006353 Ga0075370_10001011 Ga0075370_1000101110 196
596 3300006353 Ga0075370_10016339 Ga0075370_100163393 196
597 3300006353 Ga0075370_10184080 Ga0075370_101840802 196
598 3300006931 Ga0097620_100338916 Ga0097620_1003389162 196
599 3300007265 Ga0099794_10062107 Ga0099794_100621072 196
600 3300009093 Ga0105240_10073391 Ga0105240_100733912 196
601 3300009101 Ga0105247_10019485 Ga0105247_100194854 196
602 3300009148 Ga0105243_10088511 Ga0105243_100885112 196
603 3300009545 Ga0105237_10015388 Ga0105237_100153887 196
604 3300009545 Ga0105237_10039605 Ga0105237_100396054 196
605 3300009553 Ga0105249_10950212 Ga0105249_109502121 196
606 3300010375 Ga0105239_10060340 Ga0105239_100603403 196
607 3300010375 Ga0105239_10866580 Ga0105239_108665801 196
608 3300010375 Ga0105239_10869689 Ga0105239_108696892 196
609 3300011119 Ga0105246_10467604 Ga0105246_104676041 196
610 3300013102 Ga0157371_10255897 Ga0157371_102558972 196
611 3300013104 Ga0157370_10225861 Ga0157370_102258612 196
612 3300013105 Ga0157369_10411964 Ga0157369_104119642 196
613 3300014325 Ga0163163_10059718 Ga0163163_100597184 196
614 3300014325 Ga0163163_10619338 Ga0163163_106193382 196
615 3300014969 Ga0157376_10104262 Ga0157376_101042622 196
616 3300021361 Ga0213872_10049093 Ga0213872_100490933 196
617 3300025230 Ga0209563_101338 Ga0209563_1013386 196
618 3300025253 Ga0209677_101571 Ga0209677_1015714 196
619 3300025273 Ga0209673_1013588 Ga0209673_10135884 196
620 3300025297 Ga0209758_1000530 Ga0209758_100053037 196
621 3300025297 Ga0209758_1034766 Ga0209758_10347661 196
622 3300025302 Ga0207426_1000429 Ga0207426_100042928 196
623 3300025302 Ga0207426_1003972 Ga0207426_10039726 196
624 3300025304 Ga0209257_1021309 Ga0209257_10213094 196
625 3300025304 Ga0209257_1023725 Ga0209257_10237252 196
626 3300025904 Ga0207647_10015401 Ga0207647_100154013 196
627 3300025909 Ga0207705_10068073 Ga0207705_100680732 196
628 3300025914 Ga0207671_10040633 Ga0207671_100406333 196
629 3300025914 Ga0207671_10043493 Ga0207671_100434933 196
630 3300025917 Ga0207660_10258126 Ga0207660_102581262 196
631 3300025919 Ga0207657_10061869 Ga0207657_100618693 196
632 3300025919 Ga0207657_10798305 Ga0207657_107983051 196
633 3300025920 Ga0207649_10519037 Ga0207649_105190372 196
634 3300025924 Ga0207694_10639544 Ga0207694_106395442 196
635 3300025929 Ga0207664_10203318 Ga0207664_102033183 196
636 3300025932 Ga0207690_10181652 Ga0207690_101816522 196
637 3300025932 Ga0207690_10631081 Ga0207690_106310812 196
638 3300025933 Ga0207706_10353261 Ga0207706_103532611 196
639 3300025933 Ga0207706_10443400 Ga0207706_104434001 196
640 3300025944 Ga0207661_10136863 Ga0207661_101368632 196
641 3300025945 Ga0207679_10313492 Ga0207679_103134922 196
642 3300025972 Ga0207668_10119454 Ga0207668_101194541 196
643 3300025986 Ga0207658_10273022 Ga0207658_102730222 196
644 3300026023 Ga0207677_10063269 Ga0207677_100632692 196
645 3300026023 Ga0207677_10409811 Ga0207677_104098112 196
646 3300026035 Ga0207703_10276738 Ga0207703_102767382 196
647 3300026035 Ga0207703_10305746 Ga0207703_103057462 196
648 3300026041 Ga0207639_10261818 Ga0207639_102618182 196
649 3300026067 Ga0207678_10013371 Ga0207678_100133714 196
650 3300026067 Ga0207678_10080801 Ga0207678_100808012 196
651 3300026078 Ga0207702_10215304 Ga0207702_102153042 196
652 3300026078 Ga0207702_10992317 Ga0207702_109923172 196
653 3300026088 Ga0207641_10076872 Ga0207641_100768722 196
654 3300026088 Ga0207641_11191159 Ga0207641_111911592 196
655 3300026089 Ga0207648_10047082 Ga0207648_100470823 196
656 3300026116 Ga0207674_10063637 Ga0207674_100636376 196
657 3300026116 Ga0207674_10546076 Ga0207674_105460762 196
658 3300026121 Ga0207683_10235765 Ga0207683_102357652 196
659 3300026142 Ga0207698_10623627 Ga0207698_106236271 196
660 3300026142 Ga0207698_10885991 Ga0207698_108859912 196
661 3300027296 Ga0209389_1000134 Ga0209389_100013425 196
662 3300027357 Ga0209589_1000033 Ga0209589_100003387 196
663 3300027361 Ga0209489_100040 Ga0209489_10004063 196
664 3300027671 Ga0209588_1004014 Ga0209588_10040142 196
665 3300027866 Ga0209813_10131903 Ga0209813_101319032 196
666 3300028379 Ga0268266_10538096 Ga0268266_105380962 196
667 3300028794 Ga0307515_10146506 Ga0307515_101465063 196
668 3300031235 Ga0265330_10004294 Ga0265330_100042946 196
669 3300031235 Ga0265330_10022396 Ga0265330_100223964 196
670 3300031239 Ga0265328_10132228 Ga0265328_101322282 196
671 3300031241 Ga0265325_10012793 Ga0265325_100127935 196
672 3300031247 Ga0265340_10001084 Ga0265340_100010849 196
673 3300031344 Ga0265316_10073164 Ga0265316_100731644 196
674 3300031711 Ga0265314_10046551 Ga0265314_100465512 196
675 3300031712 Ga0265342_10026217 Ga0265342_100262174 196
676 3300031712 Ga0265342_10057114 Ga0265342_100571142 196
677 3300033179 Ga0307507_10269626 Ga0307507_102696261 196
678 3300035117 Ga0373953_0019930 Ga0373953_0019930_788_1432 196
679 3300035724 Ga0373933_0404125 Ga0373933_0404125_54_692 196
680 3300035725 Ga0373947_0047982 Ga0373947_0047982_951_1589 196
681 3300036401 Ga0373937_0922757 Ga0373937_0922757_76_714 196
682 3300037312 Ga0395899_0041384 Ga0395899_0041384_2086_2724 196
683 3300037418 Ga0395900_0186988 Ga0395900_0186988_617_1255 196
684 3300037471 Ga0395905_0102508 Ga0395905_0102508_848_1486 196
685 3300037853 Ga0436364_0717928 Ga0436364_0717928_392_1030 196
686 3300037853 Ga0436364_1277279 Ga0436364_1277279_63_701 196
687 3300038443 Ga0395901_0051992 Ga0395901_0051992_2252_2890 196
688 3300039437 Ga0436365_0925272 Ga0436365_0925272_95_733 196
689 3300039447 Ga0436361_0510643 Ga0436361_0510643_2260_2898 196
690 3300039450 Ga0436363_1409159 Ga0436363_1409159_666_1304 196
691 3300041452 Ga0451793_0734750 Ga0451793_0734750_61_699 196
692 3300041491 Ga0451833_0114762 Ga0451833_0114762_29_667 196
693 3300041498 Ga0451841_1439108 Ga0451841_1439108_59_697 196
694 3300044658 Ga0466972_0045878 Ga0466972_0045878_1099_1737 196
695 3300044658 Ga0466972_0136439 Ga0466972_0136439_167_805 196
696 3300044683 Ga0466965_0004174 Ga0466965_0004174_5738_6376 196
697 3300044683 Ga0466965_0113323 Ga0466965_0113323_433_1071 196
698 3300044706 Ga0466964_0129581 Ga0466964_0129581_321_959 196
699 3300044719 Ga0466971_0112091 Ga0466971_0112091_372_1010 196
700 3300044735 Ga0466968_0306567 Ga0466968_0306567_23_661 196
701 3300044901 Ga0466960_0144541 Ga0466960_0144541_590_1228 196
702 3300044901 Ga0466960_0328481 Ga0466960_0328481_16_654 196
703 3300045049 Ga0466959_0051834 Ga0466959_0051834_2210_2848 196
704 3300045976 Ga0466967_0251988 Ga0466967_0251988_35_673 196
705 3300045976 Ga0466967_0327055 Ga0466967_0327055_782_1420 196
706 3300046452 Ga0495617_096947 Ga0495617_096947_36_674 196
707 3300046454 Ga0495592_0260114 Ga0495592_0260114_28_666 196
708 3300046455 Ga0495603_0032466 Ga0495603_0032466_111_749 196
709 3300046455 Ga0495603_0057507 Ga0495603_0057507_1108_1746 196
710 3300046459 Ga0495629_0026310 Ga0495629_0026310_2513_3151 196
711 3300046460 Ga0495638_0004210 Ga0495638_0004210_8660_9298 196
712 3300046460 Ga0495638_0051206 Ga0495638_0051206_636_1274 196
713 3300046460 Ga0495638_0127108 Ga0495638_0127108_681_1319 196
714 3300046462 Ga0495651_0023884 Ga0495651_0023884_2560_3198 196
715 3300046463 Ga0495653_0206827 Ga0495653_0206827_152_790 196
716 3300046477 Ga0495664_0021307 Ga0495664_0021307_2023_2661 196
717 3300046477 Ga0495664_0029770 Ga0495664_0029770_576_1214 196
718 3300046477 Ga0495664_0070298 Ga0495664_0070298_1336_1974 196
719 3300046491 Ga0495584_0220107 Ga0495584_0220107_174_812 196
720 3300046492 Ga0495585_0128800 Ga0495585_0128800_309_947 196
721 3300046507 Ga0495606_0060685 Ga0495606_0060685_107_745 196
722 3300046507 Ga0495606_0076418 Ga0495606_0076418_903_1541 196
723 3300046507 Ga0495606_0126528 Ga0495606_0126528_438_1076 196
724 3300046511 Ga0495608_0069403 Ga0495608_0069403_1487_2125 196
725 3300046514 Ga0495618_0190725 Ga0495618_0190725_22_660 196
726 3300046515 Ga0495620_0155146 Ga0495620_0155146_107_745 196
727 3300046516 Ga0495628_0051823 Ga0495628_0051823_2477_3115 196
728 3300046519 Ga0495632_0141115 Ga0495632_0141115_411_1049 196
729 3300046522 Ga0495643_0003266 Ga0495643_0003266_4256_4894 196
730 3300046524 Ga0495648_0025071 Ga0495648_0025071_2609_3247 196
731 3300046524 Ga0495648_0054190 Ga0495648_0054190_1520_2158 196
732 3300046524 Ga0495648_0093359 Ga0495648_0093359_631_1269 196
733 3300046526 Ga0495666_0225819 Ga0495666_0225819_186_824 196
734 3300046529 Ga0495652_0008160 Ga0495652_0008160_4710_5348 196
735 3300046529 Ga0495652_0451840 Ga0495652_0451840_151_789 196
736 3300046530 Ga0495654_0164218 Ga0495654_0164218_32_670 196
737 3300046533 Ga0495640_0100149 Ga0495640_0100149_279_917 196
738 3300046536 Ga0495587_0013619 Ga0495587_0013619_599_1237 196
739 3300046543 Ga0495645_0002141 Ga0495645_0002141_6588_7226 196
740 3300046543 Ga0495645_0027111 Ga0495645_0027111_2038_2676 196
741 3300046557 Ga0495622_0005145 Ga0495622_0005145_1490_2128 196
742 3300046557 Ga0495622_0008198 Ga0495622_0008198_3192_3830 196
743 3300046559 Ga0495667_0001954 Ga0495667_0001954_2608_3246 196
744 3300046616 Ga0495668_0039397 Ga0495668_0039397_1475_2113 196
745 3300046642 Ga0495634_0027479 Ga0495634_0027479_1892_2530 196
746 3300046648 Ga0495611_0115048 Ga0495611_0115048_456_1094 196
747 3300046660 Ga0495625_0093039 Ga0495625_0093039_475_1113 196
748 3300046660 Ga0495625_0117316 Ga0495625_0117316_73_711 196
749 3300046663 Ga0495635_0065754 Ga0495635_0065754_1466_2104 196
750 3300046665 Ga0495661_0051691 Ga0495661_0051691_1548_2186 196
751 3300046674 Ga0495588_0004633 Ga0495588_0004633_3403_4041 196
752 3300046675 Ga0495657_0041738 Ga0495657_0041738_1867_2505 196
753 3300046678 Ga0495599_0009965 Ga0495599_0009965_1729_2367 196
754 3300046679 Ga0495623_0008391 Ga0495623_0008391_5849_6487 196
755 3300046679 Ga0495623_0134398 Ga0495623_0134398_745_1383 196
756 3300046692 Ga0495671_0136054 Ga0495671_0136054_505_1143 196
757 3300046809 Ga0495600_0196736 Ga0495600_0196736_483_1121 196
758 3300047317 Ga0495604_0007021 Ga0495604_0007021_279_917 196
759 3300047319 Ga0495674_0078849 Ga0495674_0078849_1051_1689 196
760 3300047321 Ga0495676_0232485 Ga0495676_0232485_574_1212 196
761 3300047322 Ga0495680_0002152 Ga0495680_0002152_18148_18786 196
762 3300047323 Ga0495683_0052360 Ga0495683_0052360_315_953 196
763 3300047443 Ga0495687_006711 Ga0495687_006711_6019_6657 196
764 3300047444 Ga0495675_0013770 Ga0495675_0013770_142_780 196
765 3300047469 Ga0495673_0025026 Ga0495673_0025026_1435_2073 196
766 3300048088 Ga0495602_0021077 Ga0495602_0021077_4450_5088 196
767 3300048088 Ga0495602_0361858 Ga0495602_0361858_292_930 196
768 3300048089 Ga0495614_0228878 Ga0495614_0228878_88_726 196
769 3300048091 Ga0495626_0085703 Ga0495626_0085703_725_1363 196
770 3300048903 Ga0496100_0046258 Ga0496100_0046258_1390_2028 196
771 3300048903 Ga0496100_0115295 Ga0496100_0115295_54_692 196
772 3300048904 Ga0496101_0064650 Ga0496101_0064650_547_1185 196
773 3300048904 Ga0496101_0449642 Ga0496101_0449642_39_677 196
774 3300048905 Ga0496102_0013546 Ga0496102_0013546_4911_5549 196
775 3300048905 Ga0496102_0074983 Ga0496102_0074983_875_1513 196
776 3300048906 Ga0496103_0001419 Ga0496103_0001419_10113_10751 196
777 3300048907 Ga0496104_0017222 Ga0496104_0017222_3331_3969 196
778 3300048907 Ga0496104_0076195 Ga0496104_0076195_279_917 196
779 3300048908 Ga0496105_0043773 Ga0496105_0043773_612_1250 196
780 3300048909 Ga0496106_0092949 Ga0496106_0092949_956_1594 196
781 3300048910 Ga0496107_0079034 Ga0496107_0079034_1468_2106 196
782 3300048910 Ga0496107_0170664 Ga0496107_0170664_905_1543 196
783 3300048911 Ga0496108_0031684 Ga0496108_0031684_1611_2249 196
784 3300048912 Ga0496109_0042089 Ga0496109_0042089_1813_2451 196
785 3300048912 Ga0496109_0467788 Ga0496109_0467788_273_911 196
786 3300048913 Ga0496110_0017063 Ga0496110_0017063_2033_2671 196
787 3300048914 Ga0496111_0012540 Ga0496111_0012540_2786_3424 196
788 3300048914 Ga0496111_0446829 Ga0496111_0446829_62_700 196
789 3300048915 Ga0496112_0063890 Ga0496112_0063890_1522_2160 196
790 3300048915 Ga0496112_0510412 Ga0496112_0510412_438_1076 196
791 3300048916 Ga0496113_0019873 Ga0496113_0019873_1608_2246 196
792 3300048917 Ga0496114_0543782 Ga0496114_0543782_306_944 196
793 3300048918 Ga0496115_0076566 Ga0496115_0076566_1464_2102 196
794 3300048919 Ga0496116_0017881 Ga0496116_0017881_1005_1643 196
795 3300048920 Ga0496117_0036555 Ga0496117_0036555_1475_2113 196
796 3300048921 Ga0496118_0050512 Ga0496118_0050512_1115_1753 196
797 3300048921 Ga0496118_0120363 Ga0496118_0120363_704_1342 196
798 3300048922 Ga0496119_0012475 Ga0496119_0012475_5623_6261 196
799 3300048922 Ga0496119_0087263 Ga0496119_0087263_354_992 196
800 3300048923 Ga0496120_0037387 Ga0496120_0037387_441_1079 196
801 3300048924 Ga0496121_0037152 Ga0496121_0037152_781_1419 196
802 3300048924 Ga0496121_0108305 Ga0496121_0108305_940_1578 196
803 3300048924 Ga0496121_0134436 Ga0496121_0134436_1055_1693 196
804 3300048927 Ga0496124_0160271 Ga0496124_0160271_146_784 196
805 3300048928 Ga0496125_0064965 Ga0496125_0064965_1232_1870 196
806 3300048928 Ga0496125_0085777 Ga0496125_0085777_294_932 196
807 3300048929 Ga0496126_0047223 Ga0496126_0047223_1854_2492 196
808 3300048929 Ga0496126_0259762 Ga0496126_0259762_702_1340 196
809 3300048929 Ga0496126_0362016 Ga0496126_0362016_60_698 196
810 3300049569 Ga0501032_0020769 Ga0501032_0020769_2667_3305 196
811 3300049570 Ga0501033_0227030 Ga0501033_0227030_281_919 196
812 3300049571 Ga0501034_0021647 Ga0501034_0021647_4210_4848 196
813 3300049572 Ga0501036_0017928 Ga0501036_0017928_3716_4354 196
814 3300049573 Ga0501037_0138928 Ga0501037_0138928_438_1076 196
815 3300049574 Ga0501038_0103532 Ga0501038_0103532_1345_1983 196
816 3300049575 Ga0501039_0769530 Ga0501039_0769530_25_663 196
817 3300049579 Ga0501043_0041816 Ga0501043_0041816_2634_3272 196
818 3300049580 Ga0501046_0185966 Ga0501046_0185966_723_1361 196
819 3300049581 Ga0501047_0102897 Ga0501047_0102897_1750_2388 196
820 3300049586 Ga0501070_0408029 Ga0501070_0408029_131_769 196
821 3300049589 Ga0501073_0258633 Ga0501073_0258633_197_835 196
822 3300049744 Ga0501083_0129674 Ga0501083_0129674_427_1065 196
823 3300049822 Ga0501035_0124945 Ga0501035_0124945_368_1006 196
824 3300049823 Ga0501044_0298142 Ga0501044_0298142_429_1067 196
825 3300050491 nmdc:mga00v17_400694_c1 nmdc:mga00v17_400694_c1_76_714 196
826 3300050491 nmdc:mga00v17_89033_c1 nmdc:mga00v17_89033_c1_199_837 196
827 3300050492 nmdc:mga0yw44_101706_c1 nmdc:mga0yw44_101706_c1_199_837 196
828 3300050492 nmdc:mga0yw44_75092_c1 nmdc:mga0yw44_75092_c1_334_972 196
829 3300050493 nmdc:mga0k408_85095_c1 nmdc:mga0k408_85095_c1_1143_1781 196
830 3300050494 nmdc:mga06z11_43720_c1 nmdc:mga06z11_43720_c1_1577_2215 196
831 3300050494 nmdc:mga06z11_74165_c2 nmdc:mga06z11_74165_c2_593_1231 196
832 3300050495 nmdc:mga04h51_154717_c1 nmdc:mga04h51_154717_c1_77_715 196
833 3300050496 nmdc:mga07m45_16335_c2 nmdc:mga07m45_16335_c2_351_989 196
834 3300050496 nmdc:mga07m45_26528_c1 nmdc:mga07m45_26528_c1_1747_2385 196
835 3300050516 nmdc:mga0sz30_113942_c1 nmdc:mga0sz30_113942_c1_42_680 196
836 3300050516 nmdc:mga0sz30_45004_c1 nmdc:mga0sz30_45004_c1_429_1067 196
837 3300050516 nmdc:mga0sz30_56005_c1 nmdc:mga0sz30_56005_c1_1012_1650 196
838 3300053078 Ga0495612_0002992 Ga0495612_0002992_3584_4222 196
839 3300053080 Ga0500635_0059747 Ga0500635_0059747_212_850 196
840 3300053084 Ga0495595_0077938 Ga0495595_0077938_47_685 196
841 3300053087 Ga0500643_000319 Ga0500643_000319_8177_8815 196
842 3300053088 Ga0500644_0010834 Ga0500644_0010834_600_1238 196
843 3300053088 Ga0500644_0156910 Ga0500644_0156910_140_778 196
844 3300053090 Ga0500646_0041681 Ga0500646_0041681_579_1217 196
845 3300053091 Ga0500647_0122682 Ga0500647_0122682_201_839 196
846 3300053092 Ga0500583_0028724 Ga0500583_0028724_452_1090 196
847 3300053094 Ga0500566_0001751 Ga0500566_0001751_4678_5316 196
848 3300053096 Ga0500641_0040581 Ga0500641_0040581_140_778 196
849 3300053098 Ga0500650_0001020 Ga0500650_0001020_5150_5788 196
850 3300053102 Ga0500554_090924 Ga0500554_090924_340_978 196
851 3300053103 Ga0500555_009494 Ga0500555_009494_1974_2612 196
852 3300053105 Ga0500557_000173 Ga0500557_000173_10189_10827 196
853 3300053109 Ga0500569_128001 Ga0500569_128001_165_803 196
854 3300053125 Ga0500618_010338 Ga0500618_010338_40_678 196
855 3300053130 Ga0500642_0005979 Ga0500642_0005979_97_735 196
856 3300053131 Ga0500652_030150 Ga0500652_030150_195_833 196
857 3300053134 Ga0500658_0031793 Ga0500658_0031793_1171_1809 196
858 3300053134 Ga0500658_0122116 Ga0500658_0122116_149_787 196
859 3300053136 Ga0500559_0011045 Ga0500559_0011045_726_1364 196
860 3300053139 Ga0500568_0028856 Ga0500568_0028856_462_1100 196
861 3300053143 Ga0500579_127838 Ga0500579_127838_146_784 196
862 3300053145 Ga0500586_000083 Ga0500586_000083_5750_6388 196
863 3300053146 Ga0500588_0117499 Ga0500588_0117499_137_775 196
864 3300053148 Ga0500590_015151 Ga0500590_015151_480_1118 196
865 3300053148 Ga0500590_023107 Ga0500590_023107_98_736 196
866 3300053151 Ga0500604_0010681 Ga0500604_0010681_1227_1865 196
867 3300053153 Ga0500616_0000031 Ga0500616_0000031_34962_35600 196
868 3300053153 Ga0500616_0019195 Ga0500616_0019195_746_1384 196
869 3300053154 Ga0500619_001130 Ga0500619_001130_1572_2210 196
870 3300053156 Ga0500622_0009308 Ga0500622_0009308_4129_4767 196
871 3300053156 Ga0500622_0011211 Ga0500622_0011211_3388_4026 196
872 3300053161 Ga0500634_0072918 Ga0500634_0072918_36_674 196
873 3300053162 Ga0500638_009092 Ga0500638_009092_1499_2137 196
874 3300053177 Ga0500636_0002288 Ga0500636_0002288_6899_7537 196
875 3300053178 Ga0500637_0056671 Ga0500637_0056671_396_1034 196
876 3300053737 Ga0500601_010092 Ga0500601_010092_249_887 196
877 3300061719 Ga0466962_0047405 Ga0466962_0047405_866_1504 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06532

NrsF

Negative regulator of sigma F

10

202

0.95

Feature Viewer

pLDDT pTM Quality
69.84 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map