F484379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 555 | 706 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10003923|JGI25153J46596_100039237 |
| Length | 221 |
| Sequence | MDTDQLIRSLAADNAHRAPRVGAMLTMALLVAAPLSILIFATFLGVRPDVMSAMHNPFFDMKFAVTLSLAIPAIIVSLHLSRPXALMRGWGWLLLLPVGLLAVAIGGEAMMAPAMPMTMRMMGKNSRVCLLAIPAMSLPLLAGALFGLRHGAPXHVSAGLAATLYASHCTDXSPLFVATWYTLATALVAAIGALVGSRVLRYXDVLRQIAVXLEIRAFIGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 30 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 31 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 32 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 33 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 34 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 35 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 36 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 37 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 38 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 39 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 40 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 41 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 42 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 43 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 44 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 45 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 46 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 47 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 48 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 49 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 50 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 51 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 52 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 53 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 54 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 55 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 56 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 57 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 58 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 59 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 60 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 61 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 62 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 63 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 64 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 65 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 66 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 67 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 68 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 69 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 70 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 71 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 72 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 73 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 74 | 2922368715 | |||
| 75 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 76 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 77 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 78 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 79 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 80 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 81 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 82 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 83 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 84 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 85 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 86 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 87 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 88 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 89 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 90 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 91 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 92 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 93 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 94 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 95 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 96 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 97 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 98 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 99 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 100 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 101 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 102 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 103 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 104 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 105 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 106 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 107 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 108 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 109 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 110 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 111 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 112 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 113 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 114 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 115 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 116 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 117 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 118 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 119 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 120 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 121 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 122 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 123 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 124 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 125 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 126 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 127 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 128 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 129 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 130 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 131 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 132 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 133 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 134 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 135 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 136 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 137 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 138 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 139 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 140 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 141 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 142 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 143 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 144 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 145 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 146 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 147 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 148 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 149 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 150 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 151 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 154 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 156 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 158 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 159 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 160 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 170 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 174 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 178 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 179 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 180 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 182 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 185 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 187 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 188 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 189 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 190 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 191 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 192 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 193 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 194 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 195 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 196 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 197 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 198 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 200 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 201 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 202 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 203 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 207 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 208 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 209 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 210 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 212 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 213 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 214 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 238 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 239 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 240 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 241 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 242 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 243 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 247 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 297 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 301 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 304 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 305 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 306 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 307 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 308 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 309 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 310 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 311 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 312 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 313 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 314 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 315 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 316 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 317 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 318 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 319 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 320 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 322 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 323 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 324 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 325 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 327 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 328 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 329 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 330 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 331 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 332 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 333 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 334 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 335 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 336 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 337 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 338 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 339 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 340 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 341 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 342 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 343 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 344 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 345 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 346 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 347 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 348 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 349 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 350 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 351 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 352 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 353 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 354 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 355 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 356 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 357 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 432 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 433 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 434 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 435 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 436 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 437 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 440 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 441 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 442 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 443 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 444 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 445 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 446 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 447 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 448 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 449 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 450 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 451 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 452 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 453 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 454 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 455 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 475 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 476 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 477 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 484 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 488 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 490 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 491 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 492 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 494 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 495 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 496 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 497 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 498 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 499 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 500 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 502 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 504 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 505 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 507 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 508 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 509 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 510 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 511 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 512 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 513 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 514 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 517 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 518 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 519 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 521 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 523 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 524 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 525 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 526 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 527 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 528 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 529 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 530 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 531 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 532 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 533 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 534 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 535 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 536 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 537 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 538 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 539 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 540 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 541 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 542 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 543 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 544 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 545 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 546 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 547 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 548 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 549 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 550 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 551 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 552 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 553 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 554 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 555 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.37 |
| Metatranscriptomes | 0.23 |
| Isolates | 19.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.23 |
| Nodule | 16.31 |
| Rhizoplane | 4.33 |
| Rhizosphere | 55.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C2514 | 2010549000 | Bacteria | 1433 |
| 2 | JGI25153J46596_10003303 | 3300003215 | Bacteria | 9062 |
| 3 | JGI25153J46596_10003923 | 3300003215 | Bacteria | 8157 |
| 4 | JGI25153J46596_10006581 | 3300003215 | Bacteria | 5856 |
| 5 | JGI25153J46596_10052382 | 3300003215 | Bacteria | 1162 |
| 6 | JGI25153J46596_10058684 | 3300003215 | Bacteria | 1057 |
| 7 | Ga0006777J48905_1010854 | 3300003308 | Bacteria | 1365 |
| 8 | rootH1_10049032 | 3300003323 | Bacteria | 3344 |
| 9 | JGI25160J50197_1000499 | 3300003354 | Bacteria | 23457 |
| 10 | JGI25160J50197_1001057 | 3300003354 | Bacteria | 14153 |
| 11 | JGI25160J50197_1013323 | 3300003354 | Bacteria | 2809 |
| 12 | Ga0007429J51699_1020681 | 3300003579 | Bacteria | 1064 |
| 13 | Ga0055531_10037619 | 3300003794 | Bacteria | 1468 |
| 14 | Ga0055543_1001388 | 3300004625 | Bacteria | 9680 |
| 15 | Ga0055543_1033406 | 3300004625 | Bacteria | 890 |
| 16 | Ga0065165_1001679 | 3300005262 | Bacteria | 22393 |
| 17 | Ga0065165_1002181 | 3300005262 | Bacteria | 17639 |
| 18 | Ga0065165_1004782 | 3300005262 | Bacteria | 8086 |
| 19 | Ga0065165_1020739 | 3300005262 | Bacteria | 2303 |
| 20 | Ga0070658_10014422 | 3300005327 | Bacteria | 6341 |
| 21 | Ga0070658_10204640 | 3300005327 | Bacteria | 1666 |
| 22 | Ga0070658_10430515 | 3300005327 | Bacteria | 1135 |
| 23 | Ga0070683_100012219 | 3300005329 | Bacteria | 7455 |
| 24 | Ga0070683_100121264 | 3300005329 | Bacteria | 2470 |
| 25 | Ga0070690_100025612 | 3300005330 | Bacteria | 3632 |
| 26 | Ga0070670_100083877 | 3300005331 | Bacteria | 2738 |
| 27 | Ga0068869_100266211 | 3300005334 | Bacteria | 1374 |
| 28 | Ga0070666_10120234 | 3300005335 | Bacteria | 1821 |
| 29 | Ga0070666_10135389 | 3300005335 | Bacteria | 1714 |
| 30 | Ga0070680_100052054 | 3300005336 | Bacteria | 3342 |
| 31 | Ga0070680_100053852 | 3300005336 | Bacteria | 3284 |
| 32 | Ga0070682_100185706 | 3300005337 | Bacteria | 1456 |
| 33 | Ga0068868_100405742 | 3300005338 | Bacteria | 1177 |
| 34 | Ga0070660_100038698 | 3300005339 | Bacteria | 3622 |
| 35 | Ga0070660_100364394 | 3300005339 | Bacteria | 1191 |
| 36 | Ga0070661_100135097 | 3300005344 | Bacteria | 1855 |
| 37 | Ga0070661_100620230 | 3300005344 | Bacteria | 876 |
| 38 | Ga0070692_10072645 | 3300005345 | Bacteria | 1836 |
| 39 | Ga0070668_100030576 | 3300005347 | Bacteria | 4094 |
| 40 | Ga0070668_100229052 | 3300005347 | Bacteria | 1535 |
| 41 | Ga0070669_100056356 | 3300005353 | Bacteria | 2881 |
| 42 | Ga0070671_100005407 | 3300005355 | Bacteria | 10186 |
| 43 | Ga0070671_100514230 | 3300005355 | Bacteria | 1031 |
| 44 | Ga0070667_100087671 | 3300005367 | Bacteria | 2671 |
| 45 | Ga0070667_100198335 | 3300005367 | Bacteria | 1780 |
| 46 | Ga0070667_100494030 | 3300005367 | Bacteria | 1121 |
| 47 | Ga0070709_10005587 | 3300005434 | Bacteria | 6809 |
| 48 | Ga0070709_10035327 | 3300005434 | Bacteria | 3037 |
| 49 | Ga0070709_10043739 | 3300005434 | Bacteria | 2771 |
| 50 | Ga0070714_100076342 | 3300005435 | Bacteria | 2909 |
| 51 | Ga0070714_100099186 | 3300005435 | Bacteria | 2563 |
| 52 | Ga0070714_100841110 | 3300005435 | Bacteria | 890 |
| 53 | Ga0070713_100005894 | 3300005436 | Bacteria | 8424 |
| 54 | Ga0070713_100171313 | 3300005436 | Bacteria | 1945 |
| 55 | Ga0070713_101307497 | 3300005436 | Bacteria | 703 |
| 56 | Ga0070710_10057100 | 3300005437 | Bacteria | 2211 |
| 57 | Ga0070701_10085110 | 3300005438 | Bacteria | 1721 |
| 58 | Ga0070711_100004477 | 3300005439 | Bacteria | 8255 |
| 59 | Ga0070700_100087976 | 3300005441 | Bacteria | 2021 |
| 60 | Ga0070700_100508332 | 3300005441 | Bacteria | 928 |
| 61 | Ga0070663_100711303 | 3300005455 | Bacteria | 855 |
| 62 | Ga0070678_100232464 | 3300005456 | Bacteria | 1538 |
| 63 | Ga0070662_100129504 | 3300005457 | Bacteria | 1944 |
| 64 | Ga0070681_10033224 | 3300005458 | Bacteria | 5179 |
| 65 | Ga0070681_10573160 | 3300005458 | Bacteria | 1042 |
| 66 | Ga0070681_10659162 | 3300005458 | Bacteria | 962 |
| 67 | Ga0070681_11002842 | 3300005458 | Bacteria | 755 |
| 68 | Ga0068867_100126985 | 3300005459 | Bacteria | 1977 |
| 69 | Ga0068867_100265251 | 3300005459 | Bacteria | 1402 |
| 70 | Ga0070679_100035252 | 3300005530 | Bacteria | 4964 |
| 71 | Ga0070679_100145568 | 3300005530 | Bacteria | 2347 |
| 72 | Ga0070684_100005320 | 3300005535 | Bacteria | 9856 |
| 73 | Ga0070684_100017131 | 3300005535 | Bacteria | 5939 |
| 74 | Ga0070686_100029356 | 3300005544 | Bacteria | 3345 |
| 75 | Ga0070693_100057000 | 3300005547 | Bacteria | 2257 |
| 76 | Ga0070665_100111156 | 3300005548 | Bacteria | 2743 |
| 77 | Ga0070665_100195513 | 3300005548 | Bacteria | 2023 |
| 78 | Ga0070665_100282608 | 3300005548 | Bacteria | 1661 |
| 79 | Ga0070665_100429724 | 3300005548 | Bacteria | 1330 |
| 80 | Ga0070665_100563301 | 3300005548 | Bacteria | 1152 |
| 81 | Ga0068855_100312338 | 3300005563 | Bacteria | 1739 |
| 82 | Ga0068855_100762712 | 3300005563 | Bacteria | 1031 |
| 83 | Ga0070664_100542670 | 3300005564 | Bacteria | 1075 |
| 84 | Ga0068857_100074563 | 3300005577 | Bacteria | 3024 |
| 85 | Ga0068854_100029620 | 3300005578 | Bacteria | 3791 |
| 86 | Ga0068854_100070125 | 3300005578 | Bacteria | 2561 |
| 87 | Ga0068854_100122597 | 3300005578 | Bacteria | 1975 |
| 88 | Ga0068856_100000061 | 3300005614 | Bacteria | 100823 |
| 89 | Ga0068856_100249706 | 3300005614 | Bacteria | 1789 |
| 90 | Ga0068852_100447299 | 3300005616 | Bacteria | 1278 |
| 91 | Ga0068852_100692450 | 3300005616 | Bacteria | 1029 |
| 92 | Ga0068859_100338953 | 3300005617 | Bacteria | 1598 |
| 93 | Ga0068864_100769369 | 3300005618 | Bacteria | 945 |
| 94 | Ga0068861_100562730 | 3300005719 | Bacteria | 1041 |
| 95 | Ga0068863_100262860 | 3300005841 | Bacteria | 1669 |
| 96 | Ga0068858_100061945 | 3300005842 | Bacteria | 3459 |
| 97 | Ga0068858_100505572 | 3300005842 | Bacteria | 1168 |
| 98 | Ga0068862_100030238 | 3300005844 | Bacteria | 4564 |
| 99 | Ga0081455_10006207 | 3300005937 | Bacteria | 12886 |
| 100 | Ga0081539_10118064 | 3300005985 | Bacteria | 1322 |
| 101 | Ga0070717_10149604 | 3300006028 | Bacteria | 2019 |
| 102 | Ga0070717_10337192 | 3300006028 | Bacteria | 1346 |
| 103 | Ga0075365_10117999 | 3300006038 | Bacteria | 1828 |
| 104 | Ga0075365_10153997 | 3300006038 | Bacteria | 1600 |
| 105 | Ga0075368_10002832 | 3300006042 | Bacteria | 5723 |
| 106 | Ga0075363_100021392 | 3300006048 | Bacteria | 3257 |
| 107 | Ga0075363_100044231 | 3300006048 | Bacteria | 2358 |
| 108 | Ga0075364_10026956 | 3300006051 | Bacteria | 3668 |
| 109 | Ga0075364_10198404 | 3300006051 | Bacteria | 1360 |
| 110 | Ga0070715_10129947 | 3300006163 | Bacteria | 1211 |
| 111 | Ga0070715_10158970 | 3300006163 | Bacteria | 1115 |
| 112 | Ga0070716_100109247 | 3300006173 | Bacteria | 1711 |
| 113 | Ga0070716_100691892 | 3300006173 | Bacteria | 778 |
| 114 | Ga0070712_100093359 | 3300006175 | Bacteria | 2209 |
| 115 | Ga0075367_10001143 | 3300006178 | Bacteria | 11052 |
| 116 | Ga0075367_10103413 | 3300006178 | Bacteria | 1743 |
| 117 | Ga0075366_10185826 | 3300006195 | Bacteria | 1263 |
| 118 | Ga0075370_10001011 | 3300006353 | Bacteria | 11646 |
| 119 | Ga0075370_10016339 | 3300006353 | Bacteria | 3992 |
| 120 | Ga0075370_10184080 | 3300006353 | Bacteria | 1230 |
| 121 | Ga0068865_100018327 | 3300006881 | Bacteria | 4515 |
| 122 | Ga0097620_100338916 | 3300006931 | Bacteria | 1598 |
| 123 | Ga0099825_1030152 | 3300006941 | Bacteria | 2431 |
| 124 | Ga0079104_1050574 | 3300006946 | Bacteria | 927 |
| 125 | Ga0099794_10062107 | 3300007265 | Bacteria | 1816 |
| 126 | Ga0105240_10016135 | 3300009093 | Bacteria | 10123 |
| 127 | Ga0105240_10073391 | 3300009093 | Bacteria | 4225 |
| 128 | Ga0105240_10404415 | 3300009093 | Bacteria | 1537 |
| 129 | Ga0111539_10235262 | 3300009094 | Bacteria | 2133 |
| 130 | Ga0105245_10033898 | 3300009098 | Bacteria | 4525 |
| 131 | Ga0105245_10351092 | 3300009098 | Bacteria | 1461 |
| 132 | Ga0105245_10625225 | 3300009098 | Bacteria | 1105 |
| 133 | Ga0105247_10019485 | 3300009101 | Bacteria | 4073 |
| 134 | Ga0105247_10048323 | 3300009101 | Bacteria | 2613 |
| 135 | Ga0114129_10028910 | 3300009147 | Bacteria | 7853 |
| 136 | Ga0105243_10026251 | 3300009148 | Bacteria | 4458 |
| 137 | Ga0105243_10088511 | 3300009148 | Bacteria | 2544 |
| 138 | Ga0105241_10047364 | 3300009174 | Bacteria | 3269 |
| 139 | Ga0105248_10339830 | 3300009177 | Bacteria | 1690 |
| 140 | Ga0105237_10015388 | 3300009545 | Bacteria | 7963 |
| 141 | Ga0105237_10039605 | 3300009545 | Bacteria | 4758 |
| 142 | Ga0105237_10085795 | 3300009545 | Bacteria | 3138 |
| 143 | Ga0105237_10973237 | 3300009545 | Bacteria | 855 |
| 144 | Ga0105238_10008473 | 3300009551 | Bacteria | 10294 |
| 145 | Ga0105249_10080028 | 3300009553 | Bacteria | 3035 |
| 146 | Ga0105249_10950212 | 3300009553 | Bacteria | 927 |
| 147 | Ga0105239_10060340 | 3300010375 | Bacteria | 4163 |
| 148 | Ga0105239_10117346 | 3300010375 | Bacteria | 2954 |
| 149 | Ga0105239_10178770 | 3300010375 | Bacteria | 2374 |
| 150 | Ga0105239_10189212 | 3300010375 | Bacteria | 2304 |
| 151 | Ga0105239_10866580 | 3300010375 | Bacteria | 1036 |
| 152 | Ga0105239_10869689 | 3300010375 | Bacteria | 1034 |
| 153 | Ga0105246_10467604 | 3300011119 | Bacteria | 1064 |
| 154 | Ga0105246_10590744 | 3300011119 | Bacteria | 958 |
| 155 | Ga0157371_10255897 | 3300013102 | Bacteria | 1261 |
| 156 | Ga0157370_10225861 | 3300013104 | Bacteria | 1733 |
| 157 | Ga0157369_10411964 | 3300013105 | Bacteria | 1401 |
| 158 | Ga0157374_10013080 | 3300013296 | Bacteria | 7239 |
| 159 | Ga0163162_10063695 | 3300013306 | Bacteria | 3731 |
| 160 | Ga0157372_10082842 | 3300013307 | Bacteria | 3632 |
| 161 | Ga0157375_10112897 | 3300013308 | Bacteria | 2818 |
| 162 | Ga0163163_10059718 | 3300014325 | Bacteria | 3773 |
| 163 | Ga0163163_10619338 | 3300014325 | Bacteria | 1146 |
| 164 | Ga0157379_10106063 | 3300014968 | Bacteria | 2522 |
| 165 | Ga0157376_10104262 | 3300014969 | Bacteria | 2485 |
| 166 | Ga0157376_10564534 | 3300014969 | Bacteria | 1128 |
| 167 | Ga0214544_1000368 | 3300021320 | Bacteria | 79177 |
| 168 | Ga0214542_1002192 | 3300021321 | Bacteria | 40482 |
| 169 | Ga0214545_1000203 | 3300021324 | Bacteria | 79176 |
| 170 | Ga0214543_1000322 | 3300021327 | Bacteria | 76376 |
| 171 | Ga0213872_10049093 | 3300021361 | Bacteria | 1917 |
| 172 | Ga0213874_10035272 | 3300021377 | Bacteria | 1469 |
| 173 | Ga0209563_101338 | 3300025230 | Bacteria | 6707 |
| 174 | Ga0209677_101571 | 3300025253 | Bacteria | 9700 |
| 175 | Ga0209673_1013588 | 3300025273 | Bacteria | 3203 |
| 176 | Ga0209564_1006232 | 3300025295 | Bacteria | 6507 |
| 177 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 178 | Ga0209758_1000365 | 3300025297 | Bacteria | 80645 |
| 179 | Ga0209758_1000530 | 3300025297 | Bacteria | 60826 |
| 180 | Ga0209758_1017170 | 3300025297 | Bacteria | 3621 |
| 181 | Ga0209758_1017378 | 3300025297 | Bacteria | 3587 |
| 182 | Ga0209758_1020271 | 3300025297 | Bacteria | 3155 |
| 183 | Ga0209758_1034766 | 3300025297 | Bacteria | 1998 |
| 184 | Ga0207426_1000429 | 3300025302 | Bacteria | 68612 |
| 185 | Ga0207426_1000620 | 3300025302 | Bacteria | 45305 |
| 186 | Ga0207426_1003972 | 3300025302 | Bacteria | 7544 |
| 187 | Ga0207426_1020710 | 3300025302 | Bacteria | 2283 |
| 188 | Ga0209257_1001196 | 3300025304 | Bacteria | 32644 |
| 189 | Ga0209257_1021309 | 3300025304 | Bacteria | 2358 |
| 190 | Ga0209257_1023725 | 3300025304 | Bacteria | 2147 |
| 191 | Ga0207692_10364644 | 3300025898 | Bacteria | 893 |
| 192 | Ga0207642_10012943 | 3300025899 | Bacteria | 3028 |
| 193 | Ga0207680_10536558 | 3300025903 | Bacteria | 835 |
| 194 | Ga0207647_10015401 | 3300025904 | Bacteria | 5243 |
| 195 | Ga0207685_10086553 | 3300025905 | Bacteria | 1309 |
| 196 | Ga0207685_10105399 | 3300025905 | Bacteria | 1213 |
| 197 | Ga0207699_10006782 | 3300025906 | Bacteria | 5568 |
| 198 | Ga0207699_10049144 | 3300025906 | Bacteria | 2482 |
| 199 | Ga0207645_10058724 | 3300025907 | Bacteria | 2456 |
| 200 | Ga0207705_10046241 | 3300025909 | Bacteria | 3127 |
| 201 | Ga0207705_10068073 | 3300025909 | Bacteria | 2577 |
| 202 | Ga0207707_10001362 | 3300025912 | Bacteria | 22693 |
| 203 | Ga0207707_10049987 | 3300025912 | Bacteria | 3643 |
| 204 | Ga0207707_10233802 | 3300025912 | Bacteria | 1599 |
| 205 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 206 | Ga0207695_10258535 | 3300025913 | Bacteria | 1639 |
| 207 | Ga0207671_10011774 | 3300025914 | Bacteria | 7083 |
| 208 | Ga0207671_10031938 | 3300025914 | Bacteria | 3921 |
| 209 | Ga0207671_10040633 | 3300025914 | Bacteria | 3442 |
| 210 | Ga0207671_10043493 | 3300025914 | Bacteria | 3321 |
| 211 | Ga0207693_10026503 | 3300025915 | Bacteria | 4588 |
| 212 | Ga0207660_10015194 | 3300025917 | Bacteria | 5080 |
| 213 | Ga0207660_10258126 | 3300025917 | Bacteria | 1377 |
| 214 | Ga0207657_10061869 | 3300025919 | Bacteria | 3207 |
| 215 | Ga0207657_10164356 | 3300025919 | Bacteria | 1801 |
| 216 | Ga0207657_10798305 | 3300025919 | Bacteria | 730 |
| 217 | Ga0207649_10519037 | 3300025920 | Bacteria | 908 |
| 218 | Ga0207652_10234377 | 3300025921 | Bacteria | 1654 |
| 219 | Ga0207694_10402564 | 3300025924 | Bacteria | 1138 |
| 220 | Ga0207694_10639544 | 3300025924 | Bacteria | 896 |
| 221 | Ga0207687_10096569 | 3300025927 | Bacteria | 2166 |
| 222 | Ga0207687_10115447 | 3300025927 | Bacteria | 2000 |
| 223 | Ga0207700_10072969 | 3300025928 | Bacteria | 2649 |
| 224 | Ga0207664_10058593 | 3300025929 | Bacteria | 3064 |
| 225 | Ga0207664_10203318 | 3300025929 | Bacteria | 1711 |
| 226 | Ga0207690_10181652 | 3300025932 | Bacteria | 1584 |
| 227 | Ga0207690_10631081 | 3300025932 | Bacteria | 877 |
| 228 | Ga0207690_10734547 | 3300025932 | Bacteria | 813 |
| 229 | Ga0207706_10353261 | 3300025933 | Bacteria | 1278 |
| 230 | Ga0207706_10443400 | 3300025933 | Bacteria | 1123 |
| 231 | Ga0207709_10785145 | 3300025935 | Bacteria | 768 |
| 232 | Ga0207669_10014469 | 3300025937 | Bacteria | 3954 |
| 233 | Ga0207704_10008022 | 3300025938 | Bacteria | 5022 |
| 234 | Ga0207691_10082354 | 3300025940 | Bacteria | 2891 |
| 235 | Ga0207689_10255575 | 3300025942 | Bacteria | 1449 |
| 236 | Ga0207661_10000647 | 3300025944 | Bacteria | 22491 |
| 237 | Ga0207661_10136863 | 3300025944 | Bacteria | 2104 |
| 238 | Ga0207679_10313492 | 3300025945 | Bacteria | 1356 |
| 239 | Ga0207712_10022330 | 3300025961 | Bacteria | 4165 |
| 240 | Ga0207668_10119454 | 3300025972 | Bacteria | 1993 |
| 241 | Ga0207640_10027127 | 3300025981 | Bacteria | 3487 |
| 242 | Ga0207640_10086930 | 3300025981 | Bacteria | 2154 |
| 243 | Ga0207640_10883235 | 3300025981 | Bacteria | 780 |
| 244 | Ga0207658_10032320 | 3300025986 | Bacteria | 3724 |
| 245 | Ga0207658_10273022 | 3300025986 | Bacteria | 1446 |
| 246 | Ga0207677_10063269 | 3300026023 | Bacteria | 2571 |
| 247 | Ga0207677_10409811 | 3300026023 | Bacteria | 1152 |
| 248 | Ga0207703_10276738 | 3300026035 | Bacteria | 1523 |
| 249 | Ga0207703_10305746 | 3300026035 | Bacteria | 1452 |
| 250 | Ga0207639_10261818 | 3300026041 | Bacteria | 1513 |
| 251 | Ga0207639_11004289 | 3300026041 | Bacteria | 781 |
| 252 | Ga0207678_10013371 | 3300026067 | Bacteria | 7202 |
| 253 | Ga0207678_10080801 | 3300026067 | Bacteria | 2783 |
| 254 | Ga0207678_10083464 | 3300026067 | Bacteria | 2733 |
| 255 | Ga0207678_10194046 | 3300026067 | Bacteria | 1736 |
| 256 | Ga0207702_10000674 | 3300026078 | Bacteria | 37110 |
| 257 | Ga0207702_10215304 | 3300026078 | Bacteria | 1788 |
| 258 | Ga0207702_10992317 | 3300026078 | Bacteria | 833 |
| 259 | Ga0207641_10076872 | 3300026088 | Bacteria | 2888 |
| 260 | Ga0207641_10801116 | 3300026088 | Bacteria | 932 |
| 261 | Ga0207641_11191159 | 3300026088 | Bacteria | 761 |
| 262 | Ga0207648_10047082 | 3300026089 | Bacteria | 3780 |
| 263 | Ga0207674_10063637 | 3300026116 | Bacteria | 3724 |
| 264 | Ga0207674_10546076 | 3300026116 | Bacteria | 1119 |
| 265 | Ga0207675_100048738 | 3300026118 | Bacteria | 3953 |
| 266 | Ga0207683_10094651 | 3300026121 | Bacteria | 2663 |
| 267 | Ga0207683_10235765 | 3300026121 | Bacteria | 1669 |
| 268 | Ga0207698_10003453 | 3300026142 | Bacteria | 9514 |
| 269 | Ga0207698_10623627 | 3300026142 | Bacteria | 1065 |
| 270 | Ga0207698_10885991 | 3300026142 | Bacteria | 899 |
| 271 | Ga0207698_10983397 | 3300026142 | Bacteria | 854 |
| 272 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 273 | Ga0209389_1000134 | 3300027296 | Bacteria | 65168 |
| 274 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 275 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 276 | Ga0209489_111101 | 3300027361 | Bacteria | 9483 |
| 277 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 278 | Ga0209588_1004014 | 3300027671 | Bacteria | 4119 |
| 279 | Ga0209813_10131903 | 3300027866 | Bacteria | 880 |
| 280 | Ga0207428_10183872 | 3300027907 | Bacteria | 1578 |
| 281 | Ga0268266_10538096 | 3300028379 | Bacteria | 1118 |
| 282 | Ga0268265_10090485 | 3300028380 | Bacteria | 2444 |
| 283 | Ga0265334_10174106 | 3300028573 | Bacteria | 753 |
| 284 | Ga0307517_10001507 | 3300028786 | Bacteria | 38891 |
| 285 | Ga0307515_10001890 | 3300028794 | Bacteria | 46604 |
| 286 | Ga0307515_10146506 | 3300028794 | Bacteria | 2497 |
| 287 | Ga0265330_10004294 | 3300031235 | Bacteria | 7255 |
| 288 | Ga0265330_10022396 | 3300031235 | Bacteria | 2875 |
| 289 | Ga0265330_10052689 | 3300031235 | Bacteria | 1782 |
| 290 | Ga0265328_10132228 | 3300031239 | Bacteria | 934 |
| 291 | Ga0265325_10012793 | 3300031241 | Bacteria | 4788 |
| 292 | Ga0265340_10001084 | 3300031247 | Bacteria | 15490 |
| 293 | Ga0265331_10033872 | 3300031250 | Bacteria | 2523 |
| 294 | Ga0265316_10073164 | 3300031344 | Bacteria | 2640 |
| 295 | Ga0265314_10046551 | 3300031711 | Bacteria | 3059 |
| 296 | Ga0265314_10066984 | 3300031711 | Bacteria | 2420 |
| 297 | Ga0265342_10026217 | 3300031712 | Bacteria | 3656 |
| 298 | Ga0265342_10052344 | 3300031712 | Bacteria | 2434 |
| 299 | Ga0265342_10057114 | 3300031712 | Bacteria | 2311 |
| 300 | Ga0265342_10076950 | 3300031712 | Bacteria | 1933 |
| 301 | Ga0307516_10173919 | 3300031730 | Bacteria | 1892 |
| 302 | Ga0307406_10330526 | 3300031901 | Bacteria | 1183 |
| 303 | Ga0307411_10662386 | 3300032005 | Bacteria | 905 |
| 304 | Ga0307507_10269626 | 3300033179 | Bacteria | 1077 |
| 305 | Ga0307510_10174924 | 3300033180 | Bacteria | 1719 |
| 306 | Ga0307510_10223192 | 3300033180 | Bacteria | 1393 |
| 307 | Ga0373926_0053807 | 3300035083 | Bacteria | 1457 |
| 308 | Ga0373934_0005198 | 3300035086 | Bacteria | 4815 |
| 309 | Ga0373934_0081513 | 3300035086 | Bacteria | 1300 |
| 310 | Ga0373936_0092746 | 3300035113 | Bacteria | 1267 |
| 311 | Ga0373945_0044654 | 3300035116 | Bacteria | 1612 |
| 312 | Ga0373953_0001814 | 3300035117 | Bacteria | 6309 |
| 313 | Ga0373953_0019930 | 3300035117 | Bacteria | 2501 |
| 314 | Ga0373954_0001141 | 3300035118 | Bacteria | 10672 |
| 315 | Ga0373954_0029735 | 3300035118 | Bacteria | 2518 |
| 316 | Ga0373954_0083523 | 3300035118 | Bacteria | 1528 |
| 317 | Ga0373956_0001770 | 3300035119 | Bacteria | 8897 |
| 318 | Ga0373956_0195527 | 3300035119 | Bacteria | 958 |
| 319 | Ga0373957_0007539 | 3300035120 | Bacteria | 3484 |
| 320 | Ga0373946_0005588 | 3300035171 | Bacteria | 4538 |
| 321 | Ga0373955_0004475 | 3300035172 | Bacteria | 6185 |
| 322 | Ga0373955_0212974 | 3300035172 | Bacteria | 1152 |
| 323 | Ga0373955_0226510 | 3300035172 | Bacteria | 1118 |
| 324 | Ga0373924_0021211 | 3300035410 | Bacteria | 2533 |
| 325 | Ga0373927_0014532 | 3300035695 | Bacteria | 5208 |
| 326 | Ga0373933_0001421 | 3300035724 | Bacteria | 14039 |
| 327 | Ga0373933_0065194 | 3300035724 | Bacteria | 2205 |
| 328 | Ga0373933_0404125 | 3300035724 | Bacteria | 891 |
| 329 | Ga0373947_0047982 | 3300035725 | Bacteria | 2561 |
| 330 | Ga0373937_0007299 | 3300036401 | Bacteria | 9566 |
| 331 | Ga0373937_0331486 | 3300036401 | Bacteria | 1440 |
| 332 | Ga0373937_0922757 | 3300036401 | Bacteria | 822 |
| 333 | Ga0373925_0122404 | 3300037068 | Bacteria | 2020 |
| 334 | Ga0373925_0141888 | 3300037068 | Bacteria | 1881 |
| 335 | Ga0395899_0041384 | 3300037312 | Bacteria | 3443 |
| 336 | Ga0395900_0186988 | 3300037418 | Bacteria | 2102 |
| 337 | Ga0395905_0102508 | 3300037471 | Bacteria | 2686 |
| 338 | Ga0395905_0145412 | 3300037471 | Bacteria | 2230 |
| 339 | Ga0436364_0561281 | 3300037853 | Bacteria | 1137 |
| 340 | Ga0436364_0717928 | 3300037853 | Bacteria | 4338 |
| 341 | Ga0436364_1277279 | 3300037853 | Bacteria | 828 |
| 342 | Ga0436364_1318234 | 3300037853 | Unclassified | 1978 |
| 343 | Ga0395901_0051992 | 3300038443 | Bacteria | 4259 |
| 344 | Ga0436365_0925272 | 3300039437 | Bacteria | 2488 |
| 345 | Ga0436365_1553711 | 3300039437 | Bacteria | 2029 |
| 346 | Ga0436365_1718107 | 3300039437 | Bacteria | 1102 |
| 347 | Ga0436361_0510643 | 3300039447 | Bacteria | 4751 |
| 348 | Ga0436363_0263740 | 3300039450 | Bacteria | 1576 |
| 349 | Ga0436363_1267944 | 3300039450 | Bacteria | 2006 |
| 350 | Ga0436363_1409159 | 3300039450 | Bacteria | 1727 |
| 351 | Ga0436363_1457984 | 3300039450 | Bacteria | 1314 |
| 352 | Ga0451793_0734750 | 3300041452 | Bacteria | 788 |
| 353 | Ga0451833_0114762 | 3300041491 | Bacteria | 678 |
| 354 | Ga0451837_1556812 | 3300041494 | Bacteria | 1081 |
| 355 | Ga0451841_1439108 | 3300041498 | Bacteria | 1019 |
| 356 | Ga0439432_077789 | 3300042006 | Bacteria | 1007 |
| 357 | Ga0466972_0000333 | 3300044658 | Bacteria | 26290 |
| 358 | Ga0466972_0001204 | 3300044658 | Bacteria | 12446 |
| 359 | Ga0466972_0045878 | 3300044658 | Bacteria | 2117 |
| 360 | Ga0466972_0068108 | 3300044658 | Bacteria | 1700 |
| 361 | Ga0466972_0136439 | 3300044658 | Bacteria | 1155 |
| 362 | Ga0466965_0004174 | 3300044683 | Bacteria | 6420 |
| 363 | Ga0466965_0100487 | 3300044683 | Bacteria | 1479 |
| 364 | Ga0466965_0113323 | 3300044683 | Bacteria | 1395 |
| 365 | Ga0466966_0001059 | 3300044684 | Bacteria | 17577 |
| 366 | Ga0466961_0000050 | 3300044693 | Bacteria | 71289 |
| 367 | Ga0466961_0150419 | 3300044693 | Bacteria | 1454 |
| 368 | Ga0466964_0129581 | 3300044706 | Bacteria | 1147 |
| 369 | Ga0466971_0112091 | 3300044719 | Bacteria | 1259 |
| 370 | Ga0466968_0039031 | 3300044735 | Bacteria | 1997 |
| 371 | Ga0466968_0306567 | 3300044735 | Bacteria | 765 |
| 372 | Ga0466970_0115905 | 3300044765 | Bacteria | 1465 |
| 373 | Ga0466960_0144541 | 3300044901 | Bacteria | 1266 |
| 374 | Ga0466960_0328481 | 3300044901 | Bacteria | 868 |
| 375 | Ga0466959_0021131 | 3300045049 | Bacteria | 4798 |
| 376 | Ga0466959_0051834 | 3300045049 | Bacteria | 3007 |
| 377 | Ga0466967_0061854 | 3300045976 | Bacteria | 3322 |
| 378 | Ga0466967_0251988 | 3300045976 | Bacteria | 1687 |
| 379 | Ga0466967_0327055 | 3300045976 | Bacteria | 1480 |
| 380 | Ga0495617_096947 | 3300046452 | Bacteria | 960 |
| 381 | Ga0495592_0002728 | 3300046454 | Bacteria | 12506 |
| 382 | Ga0495592_0047069 | 3300046454 | Bacteria | 3213 |
| 383 | Ga0495592_0260114 | 3300046454 | Bacteria | 1143 |
| 384 | Ga0495603_0032466 | 3300046455 | Bacteria | 3141 |
| 385 | Ga0495603_0057507 | 3300046455 | Bacteria | 2301 |
| 386 | Ga0495590_0090057 | 3300046457 | Bacteria | 1085 |
| 387 | Ga0495629_0001074 | 3300046459 | Bacteria | 21800 |
| 388 | Ga0495629_0005031 | 3300046459 | Bacteria | 9895 |
| 389 | Ga0495629_0026310 | 3300046459 | Bacteria | 4134 |
| 390 | Ga0495638_0004210 | 3300046460 | Bacteria | 10952 |
| 391 | Ga0495638_0051206 | 3300046460 | Bacteria | 2575 |
| 392 | Ga0495638_0127108 | 3300046460 | Bacteria | 1501 |
| 393 | Ga0495651_0009631 | 3300046462 | Bacteria | 7425 |
| 394 | Ga0495651_0023884 | 3300046462 | Bacteria | 4754 |
| 395 | Ga0495653_0000513 | 3300046463 | Bacteria | 29794 |
| 396 | Ga0495653_0033029 | 3300046463 | Bacteria | 4103 |
| 397 | Ga0495653_0113799 | 3300046463 | Unclassified | 1940 |
| 398 | Ga0495653_0206827 | 3300046463 | Bacteria | 1328 |
| 399 | Ga0495653_0510714 | 3300046463 | Bacteria | 748 |
| 400 | Ga0495582_0017699 | 3300046473 | Bacteria | 3897 |
| 401 | Ga0495582_0037422 | 3300046473 | Bacteria | 2669 |
| 402 | Ga0495662_0054440 | 3300046476 | Bacteria | 1933 |
| 403 | Ga0495664_0021307 | 3300046477 | Bacteria | 3744 |
| 404 | Ga0495664_0029770 | 3300046477 | Bacteria | 3195 |
| 405 | Ga0495664_0070298 | 3300046477 | Bacteria | 2090 |
| 406 | Ga0495664_0298499 | 3300046477 | Bacteria | 972 |
| 407 | Ga0495584_0037173 | 3300046491 | Bacteria | 2460 |
| 408 | Ga0495584_0220107 | 3300046491 | Bacteria | 965 |
| 409 | Ga0495585_0128800 | 3300046492 | Bacteria | 1333 |
| 410 | Ga0495594_0039656 | 3300046499 | Bacteria | 2576 |
| 411 | Ga0495594_0208631 | 3300046499 | Bacteria | 1114 |
| 412 | Ga0495607_0080723 | 3300046501 | Bacteria | 1788 |
| 413 | Ga0495606_0051812 | 3300046507 | Bacteria | 2674 |
| 414 | Ga0495606_0060685 | 3300046507 | Bacteria | 2421 |
| 415 | Ga0495606_0076418 | 3300046507 | Bacteria | 2093 |
| 416 | Ga0495606_0126528 | 3300046507 | Bacteria | 1523 |
| 417 | Ga0495608_0003659 | 3300046511 | Bacteria | 11051 |
| 418 | Ga0495608_0052451 | 3300046511 | Bacteria | 2700 |
| 419 | Ga0495608_0069403 | 3300046511 | Bacteria | 2302 |
| 420 | Ga0495618_0026681 | 3300046514 | Bacteria | 3594 |
| 421 | Ga0495618_0138442 | 3300046514 | Bacteria | 1557 |
| 422 | Ga0495618_0153232 | 3300046514 | Bacteria | 1472 |
| 423 | Ga0495618_0190725 | 3300046514 | Bacteria | 1300 |
| 424 | Ga0495620_0155146 | 3300046515 | Bacteria | 891 |
| 425 | Ga0495628_0019165 | 3300046516 | Bacteria | 5658 |
| 426 | Ga0495628_0051823 | 3300046516 | Bacteria | 3243 |
| 427 | Ga0495628_0238003 | 3300046516 | Bacteria | 1362 |
| 428 | Ga0495628_0349865 | 3300046516 | Bacteria | 1086 |
| 429 | Ga0495630_0061703 | 3300046517 | Bacteria | 2815 |
| 430 | Ga0495632_0115767 | 3300046519 | Bacteria | 1256 |
| 431 | Ga0495632_0141115 | 3300046519 | Bacteria | 1118 |
| 432 | Ga0495643_0003266 | 3300046522 | Bacteria | 11998 |
| 433 | Ga0495643_0096143 | 3300046522 | Bacteria | 1523 |
| 434 | Ga0495648_0025071 | 3300046524 | Bacteria | 4045 |
| 435 | Ga0495648_0038462 | 3300046524 | Bacteria | 3059 |
| 436 | Ga0495648_0054190 | 3300046524 | Bacteria | 2424 |
| 437 | Ga0495648_0093359 | 3300046524 | Bacteria | 1678 |
| 438 | Ga0495666_0225819 | 3300046526 | Bacteria | 857 |
| 439 | Ga0495652_0005984 | 3300046529 | Bacteria | 11374 |
| 440 | Ga0495652_0008160 | 3300046529 | Bacteria | 9575 |
| 441 | Ga0495652_0019338 | 3300046529 | Bacteria | 6067 |
| 442 | Ga0495652_0120287 | 3300046529 | Bacteria | 2096 |
| 443 | Ga0495652_0271441 | 3300046529 | Bacteria | 1246 |
| 444 | Ga0495652_0451840 | 3300046529 | Bacteria | 899 |
| 445 | Ga0495654_0164218 | 3300046530 | Bacteria | 973 |
| 446 | Ga0495654_0257755 | 3300046530 | Bacteria | 724 |
| 447 | Ga0495665_0061181 | 3300046531 | Bacteria | 1988 |
| 448 | Ga0495640_0006879 | 3300046533 | Bacteria | 8960 |
| 449 | Ga0495640_0014950 | 3300046533 | Bacteria | 5853 |
| 450 | Ga0495640_0031760 | 3300046533 | Bacteria | 3767 |
| 451 | Ga0495640_0100149 | 3300046533 | Bacteria | 1903 |
| 452 | Ga0495587_0001598 | 3300046536 | Bacteria | 15082 |
| 453 | Ga0495587_0013619 | 3300046536 | Bacteria | 5110 |
| 454 | Ga0495587_0095823 | 3300046536 | Bacteria | 1712 |
| 455 | Ga0495598_0060766 | 3300046537 | Bacteria | 1165 |
| 456 | Ga0495645_0002141 | 3300046543 | Bacteria | 13403 |
| 457 | Ga0495645_0010435 | 3300046543 | Bacteria | 6511 |
| 458 | Ga0495645_0027111 | 3300046543 | Bacteria | 4161 |
| 459 | Ga0495645_0081830 | 3300046543 | Bacteria | 2316 |
| 460 | Ga0495622_0004871 | 3300046557 | Bacteria | 6216 |
| 461 | Ga0495622_0005145 | 3300046557 | Bacteria | 6065 |
| 462 | Ga0495622_0008198 | 3300046557 | Bacteria | 4841 |
| 463 | Ga0495667_0001954 | 3300046559 | Bacteria | 13634 |
| 464 | Ga0495667_0003789 | 3300046559 | Bacteria | 10155 |
| 465 | Ga0495667_0065521 | 3300046559 | Bacteria | 2376 |
| 466 | Ga0495656_0014355 | 3300046615 | Bacteria | 2969 |
| 467 | Ga0495668_0039397 | 3300046616 | Bacteria | 2638 |
| 468 | Ga0495634_0005582 | 3300046642 | Bacteria | 9653 |
| 469 | Ga0495634_0027479 | 3300046642 | Bacteria | 3958 |
| 470 | Ga0495634_0037946 | 3300046642 | Bacteria | 3288 |
| 471 | Ga0495634_0176203 | 3300046642 | Bacteria | 1341 |
| 472 | Ga0495611_0073552 | 3300046648 | Bacteria | 1565 |
| 473 | Ga0495611_0115048 | 3300046648 | Bacteria | 1253 |
| 474 | Ga0495625_0031145 | 3300046660 | Bacteria | 3970 |
| 475 | Ga0495625_0093039 | 3300046660 | Bacteria | 2082 |
| 476 | Ga0495625_0117316 | 3300046660 | Bacteria | 1814 |
| 477 | Ga0495625_0307638 | 3300046660 | Bacteria | 1012 |
| 478 | Ga0495635_0000211 | 3300046663 | Bacteria | 36892 |
| 479 | Ga0495635_0009100 | 3300046663 | Bacteria | 6933 |
| 480 | Ga0495635_0065754 | 3300046663 | Bacteria | 2487 |
| 481 | Ga0495661_0051691 | 3300046665 | Bacteria | 2480 |
| 482 | Ga0495661_0103149 | 3300046665 | Bacteria | 1602 |
| 483 | Ga0495588_0004633 | 3300046674 | Bacteria | 6071 |
| 484 | Ga0495588_0062386 | 3300046674 | Bacteria | 1932 |
| 485 | Ga0495588_0504143 | 3300046674 | Bacteria | 634 |
| 486 | Ga0495657_0002321 | 3300046675 | Bacteria | 16025 |
| 487 | Ga0495657_0002878 | 3300046675 | Bacteria | 14291 |
| 488 | Ga0495657_0041738 | 3300046675 | Bacteria | 3137 |
| 489 | Ga0495657_0203959 | 3300046675 | Bacteria | 1204 |
| 490 | Ga0495599_0000957 | 3300046678 | Bacteria | 16146 |
| 491 | Ga0495599_0009965 | 3300046678 | Bacteria | 5817 |
| 492 | Ga0495623_0008391 | 3300046679 | Bacteria | 6718 |
| 493 | Ga0495623_0105087 | 3300046679 | Unclassified | 1716 |
| 494 | Ga0495623_0134398 | 3300046679 | Bacteria | 1477 |
| 495 | Ga0495646_0004069 | 3300046680 | Bacteria | 9174 |
| 496 | Ga0495646_0029662 | 3300046680 | Bacteria | 3419 |
| 497 | Ga0495647_0270857 | 3300046681 | Bacteria | 760 |
| 498 | Ga0495658_0272120 | 3300046683 | Bacteria | 1068 |
| 499 | Ga0495669_0001263 | 3300046684 | Bacteria | 10477 |
| 500 | Ga0495613_0037912 | 3300046689 | Bacteria | 3573 |
| 501 | Ga0495624_0024346 | 3300046690 | Bacteria | 3984 |
| 502 | Ga0495624_0032066 | 3300046690 | Bacteria | 3409 |
| 503 | Ga0495624_0442618 | 3300046690 | Bacteria | 779 |
| 504 | Ga0495670_0187578 | 3300046691 | Bacteria | 1093 |
| 505 | Ga0495671_0136054 | 3300046692 | Bacteria | 1198 |
| 506 | Ga0495671_0233492 | 3300046692 | Bacteria | 889 |
| 507 | Ga0495649_0088179 | 3300046694 | Bacteria | 1655 |
| 508 | Ga0495600_0018484 | 3300046809 | Bacteria | 4442 |
| 509 | Ga0495600_0196736 | 3300046809 | Bacteria | 1295 |
| 510 | Ga0495581_0047799 | 3300047315 | Bacteria | 2472 |
| 511 | Ga0495604_0007021 | 3300047317 | Bacteria | 8928 |
| 512 | Ga0495604_0010845 | 3300047317 | Bacteria | 7237 |
| 513 | Ga0495604_0060125 | 3300047317 | Bacteria | 2910 |
| 514 | Ga0495604_0217186 | 3300047317 | Bacteria | 1318 |
| 515 | Ga0495604_0424672 | 3300047317 | Bacteria | 872 |
| 516 | Ga0495674_0014461 | 3300047319 | Bacteria | 7387 |
| 517 | Ga0495674_0078849 | 3300047319 | Bacteria | 2829 |
| 518 | Ga0495672_0022620 | 3300047320 | Bacteria | 4083 |
| 519 | Ga0495672_0072588 | 3300047320 | Bacteria | 1943 |
| 520 | Ga0495676_0232485 | 3300047321 | Bacteria | 1266 |
| 521 | Ga0495680_0002152 | 3300047322 | Bacteria | 20441 |
| 522 | Ga0495680_0006158 | 3300047322 | Bacteria | 11190 |
| 523 | Ga0495683_0006277 | 3300047323 | Bacteria | 6505 |
| 524 | Ga0495683_0052360 | 3300047323 | Bacteria | 2038 |
| 525 | Ga0495687_006711 | 3300047443 | Bacteria | 6978 |
| 526 | Ga0495675_0001324 | 3300047444 | Bacteria | 15012 |
| 527 | Ga0495675_0013770 | 3300047444 | Bacteria | 5112 |
| 528 | Ga0495675_0140641 | 3300047444 | Bacteria | 1496 |
| 529 | Ga0495673_0025026 | 3300047469 | Bacteria | 2873 |
| 530 | Ga0495673_0040211 | 3300047469 | Bacteria | 2115 |
| 531 | Ga0495684_0009757 | 3300047471 | Bacteria | 7409 |
| 532 | Ga0495684_0015063 | 3300047471 | Bacteria | 5954 |
| 533 | Ga0495593_0002923 | 3300047673 | Bacteria | 10287 |
| 534 | Ga0495593_0045925 | 3300047673 | Bacteria | 2329 |
| 535 | Ga0495602_0008570 | 3300048088 | Bacteria | 10678 |
| 536 | Ga0495602_0021077 | 3300048088 | Bacteria | 6423 |
| 537 | Ga0495602_0030714 | 3300048088 | Bacteria | 5091 |
| 538 | Ga0495602_0361858 | 3300048088 | Bacteria | 1044 |
| 539 | Ga0495614_0207256 | 3300048089 | Bacteria | 888 |
| 540 | Ga0495614_0228878 | 3300048089 | Bacteria | 847 |
| 541 | Ga0495626_0085703 | 3300048091 | Bacteria | 1393 |
| 542 | Ga0496100_0046258 | 3300048903 | Bacteria | 2797 |
| 543 | Ga0496100_0115295 | 3300048903 | Bacteria | 1873 |
| 544 | Ga0496100_0410972 | 3300048903 | Bacteria | 1032 |
| 545 | Ga0496101_0064650 | 3300048904 | Bacteria | 2665 |
| 546 | Ga0496101_0346570 | 3300048904 | Bacteria | 1167 |
| 547 | Ga0496101_0449642 | 3300048904 | Bacteria | 1016 |
| 548 | Ga0496102_0013546 | 3300048905 | Bacteria | 7067 |
| 549 | Ga0496102_0074983 | 3300048905 | Bacteria | 3109 |
| 550 | Ga0496102_0134081 | 3300048905 | Bacteria | 2320 |
| 551 | Ga0496103_0001419 | 3300048906 | Bacteria | 16061 |
| 552 | Ga0496103_0313010 | 3300048906 | Bacteria | 1010 |
| 553 | Ga0496104_0000281 | 3300048907 | Bacteria | 45166 |
| 554 | Ga0496104_0017222 | 3300048907 | Bacteria | 6575 |
| 555 | Ga0496104_0076195 | 3300048907 | Bacteria | 3194 |
| 556 | Ga0496105_0001556 | 3300048908 | Bacteria | 16238 |
| 557 | Ga0496105_0043773 | 3300048908 | Bacteria | 3692 |
| 558 | Ga0496105_0750816 | 3300048908 | Bacteria | 745 |
| 559 | Ga0496106_0092949 | 3300048909 | Bacteria | 2331 |
| 560 | Ga0496107_0079034 | 3300048910 | Bacteria | 2398 |
| 561 | Ga0496107_0170664 | 3300048910 | Bacteria | 1614 |
| 562 | Ga0496107_0241254 | 3300048910 | Bacteria | 1345 |
| 563 | Ga0496108_0031684 | 3300048911 | Bacteria | 4388 |
| 564 | Ga0496108_0664591 | 3300048911 | Bacteria | 905 |
| 565 | Ga0496109_0042089 | 3300048912 | Bacteria | 4137 |
| 566 | Ga0496109_0467788 | 3300048912 | Bacteria | 1191 |
| 567 | Ga0496110_0017063 | 3300048913 | Bacteria | 6069 |
| 568 | Ga0496111_0012540 | 3300048914 | Bacteria | 5744 |
| 569 | Ga0496111_0446829 | 3300048914 | Bacteria | 954 |
| 570 | Ga0496112_0063890 | 3300048915 | Bacteria | 3631 |
| 571 | Ga0496112_0510412 | 3300048915 | Bacteria | 1137 |
| 572 | Ga0496112_0753467 | 3300048915 | Bacteria | 900 |
| 573 | Ga0496113_0019873 | 3300048916 | Bacteria | 4709 |
| 574 | Ga0496114_0246333 | 3300048917 | Bacteria | 1572 |
| 575 | Ga0496114_0543782 | 3300048917 | Bacteria | 1026 |
| 576 | Ga0496115_0062942 | 3300048918 | Bacteria | 2993 |
| 577 | Ga0496115_0076566 | 3300048918 | Bacteria | 2719 |
| 578 | Ga0496115_0863477 | 3300048918 | Bacteria | 700 |
| 579 | Ga0496116_0017881 | 3300048919 | Bacteria | 5486 |
| 580 | Ga0496117_0036555 | 3300048920 | Bacteria | 3673 |
| 581 | Ga0496117_0175564 | 3300048920 | Bacteria | 1238 |
| 582 | Ga0496118_0050512 | 3300048921 | Bacteria | 3190 |
| 583 | Ga0496118_0071041 | 3300048921 | Bacteria | 2509 |
| 584 | Ga0496118_0120363 | 3300048921 | Bacteria | 1713 |
| 585 | Ga0496119_0003040 | 3300048922 | Bacteria | 17756 |
| 586 | Ga0496119_0012475 | 3300048922 | Bacteria | 6896 |
| 587 | Ga0496119_0087263 | 3300048922 | Bacteria | 1781 |
| 588 | Ga0496120_0001511 | 3300048923 | Bacteria | 27505 |
| 589 | Ga0496120_0037387 | 3300048923 | Bacteria | 2881 |
| 590 | Ga0496121_0035087 | 3300048924 | Bacteria | 4500 |
| 591 | Ga0496121_0037152 | 3300048924 | Bacteria | 4329 |
| 592 | Ga0496121_0038503 | 3300048924 | Bacteria | 4232 |
| 593 | Ga0496121_0108305 | 3300048924 | Bacteria | 2125 |
| 594 | Ga0496121_0134436 | 3300048924 | Bacteria | 1844 |
| 595 | Ga0496122_0092534 | 3300048925 | Bacteria | 2055 |
| 596 | Ga0496124_0160271 | 3300048927 | Bacteria | 1754 |
| 597 | Ga0496124_0217659 | 3300048927 | Bacteria | 1439 |
| 598 | Ga0496124_0499655 | 3300048927 | Bacteria | 816 |
| 599 | Ga0496125_0005006 | 3300048928 | Bacteria | 14960 |
| 600 | Ga0496125_0032889 | 3300048928 | Bacteria | 4599 |
| 601 | Ga0496125_0064965 | 3300048928 | Bacteria | 2895 |
| 602 | Ga0496125_0085777 | 3300048928 | Bacteria | 2384 |
| 603 | Ga0496126_0021354 | 3300048929 | Bacteria | 6322 |
| 604 | Ga0496126_0047223 | 3300048929 | Bacteria | 3943 |
| 605 | Ga0496126_0086673 | 3300048929 | Bacteria | 2760 |
| 606 | Ga0496126_0114989 | 3300048929 | Bacteria | 2340 |
| 607 | Ga0496126_0259762 | 3300048929 | Bacteria | 1445 |
| 608 | Ga0496126_0362016 | 3300048929 | Bacteria | 1184 |
| 609 | Ga0496126_0390969 | 3300048929 | Bacteria | 1130 |
| 610 | Ga0495678_122823 | 3300049459 | Bacteria | 869 |
| 611 | Ga0495682_0013260 | 3300049460 | Bacteria | 3141 |
| 612 | Ga0501032_0020769 | 3300049569 | Bacteria | 4571 |
| 613 | Ga0501033_0227030 | 3300049570 | Bacteria | 1327 |
| 614 | Ga0501034_0021647 | 3300049571 | Bacteria | 6549 |
| 615 | Ga0501036_0017928 | 3300049572 | Bacteria | 5927 |
| 616 | Ga0501037_0138928 | 3300049573 | Bacteria | 1739 |
| 617 | Ga0501038_0103532 | 3300049574 | Bacteria | 2367 |
| 618 | Ga0501039_0769530 | 3300049575 | Bacteria | 751 |
| 619 | Ga0501043_0041816 | 3300049579 | Bacteria | 3600 |
| 620 | Ga0501046_0185966 | 3300049580 | Bacteria | 1551 |
| 621 | Ga0501047_0102897 | 3300049581 | Bacteria | 2735 |
| 622 | Ga0501047_0378134 | 3300049581 | Bacteria | 1251 |
| 623 | Ga0501070_0408029 | 3300049586 | Bacteria | 1098 |
| 624 | Ga0501073_0258633 | 3300049589 | Bacteria | 1201 |
| 625 | Ga0501083_0129674 | 3300049744 | Bacteria | 1653 |
| 626 | Ga0501035_0124945 | 3300049822 | Bacteria | 2246 |
| 627 | Ga0501044_0298142 | 3300049823 | Bacteria | 1541 |
| 628 | nmdc:mga00v17_400694_c1 | 3300050491 | Bacteria | 892 |
| 629 | nmdc:mga00v17_89033_c1 | 3300050491 | Bacteria | 1936 |
| 630 | nmdc:mga0yw44_101706_c1 | 3300050492 | Bacteria | 1831 |
| 631 | nmdc:mga0yw44_75092_c1 | 3300050492 | Bacteria | 2107 |
| 632 | nmdc:mga0k408_85095_c1 | 3300050493 | Bacteria | 1856 |
| 633 | nmdc:mga06z11_43720_c1 | 3300050494 | Bacteria | 2256 |
| 634 | nmdc:mga06z11_74165_c2 | 3300050494 | Bacteria | 1412 |
| 635 | nmdc:mga04h51_154717_c1 | 3300050495 | Bacteria | 879 |
| 636 | nmdc:mga07m45_16335_c2 | 3300050496 | Bacteria | 2353 |
| 637 | nmdc:mga07m45_26528_c1 | 3300050496 | Bacteria | 3185 |
| 638 | nmdc:mga05p37_45593_c1 | 3300050507 | Bacteria | 5391 |
| 639 | nmdc:mga0sz30_113942_c1 | 3300050516 | Bacteria | 1186 |
| 640 | nmdc:mga0sz30_45004_c1 | 3300050516 | Bacteria | 1861 |
| 641 | nmdc:mga0sz30_56005_c1 | 3300050516 | Bacteria | 1679 |
| 642 | Ga0495601_0020087 | 3300053077 | Bacteria | 4077 |
| 643 | Ga0495601_0217757 | 3300053077 | Bacteria | 1247 |
| 644 | Ga0495612_0002992 | 3300053078 | Bacteria | 7013 |
| 645 | Ga0495612_0153146 | 3300053078 | Bacteria | 1004 |
| 646 | Ga0500610_0230352 | 3300053079 | Bacteria | 870 |
| 647 | Ga0500635_0059747 | 3300053080 | Bacteria | 1327 |
| 648 | Ga0495655_0003802 | 3300053083 | Bacteria | 2526 |
| 649 | Ga0495595_0029835 | 3300053084 | Bacteria | 2443 |
| 650 | Ga0495595_0077938 | 3300053084 | Bacteria | 1575 |
| 651 | Ga0495619_0018508 | 3300053085 | Bacteria | 4418 |
| 652 | Ga0495619_0085957 | 3300053085 | Bacteria | 2125 |
| 653 | Ga0500643_000319 | 3300053087 | Bacteria | 38698 |
| 654 | Ga0500644_0010834 | 3300053088 | Bacteria | 2475 |
| 655 | Ga0500644_0045021 | 3300053088 | Bacteria | 1484 |
| 656 | Ga0500644_0156910 | 3300053088 | Bacteria | 917 |
| 657 | Ga0500646_0041681 | 3300053090 | Bacteria | 1294 |
| 658 | Ga0500647_0122682 | 3300053091 | Bacteria | 1229 |
| 659 | Ga0500583_0028724 | 3300053092 | Bacteria | 2416 |
| 660 | Ga0500566_0001751 | 3300053094 | Bacteria | 12748 |
| 661 | Ga0500566_0014704 | 3300053094 | Bacteria | 4597 |
| 662 | Ga0500641_0040581 | 3300053096 | Bacteria | 1880 |
| 663 | Ga0500650_0001020 | 3300053098 | Bacteria | 7972 |
| 664 | Ga0500554_090924 | 3300053102 | Bacteria | 1014 |
| 665 | Ga0500555_009494 | 3300053103 | Bacteria | 2783 |
| 666 | Ga0500555_104108 | 3300053103 | Bacteria | 719 |
| 667 | Ga0500556_0105739 | 3300053104 | Bacteria | 1088 |
| 668 | Ga0500557_000173 | 3300053105 | Bacteria | 13018 |
| 669 | Ga0500569_128001 | 3300053109 | Bacteria | 849 |
| 670 | Ga0500572_003830 | 3300053111 | Bacteria | 3418 |
| 671 | Ga0500608_019451 | 3300053122 | Bacteria | 3114 |
| 672 | Ga0500618_010338 | 3300053125 | Bacteria | 2507 |
| 673 | Ga0500618_076717 | 3300053125 | Bacteria | 749 |
| 674 | Ga0500642_0000057 | 3300053130 | Bacteria | 67011 |
| 675 | Ga0500642_0005979 | 3300053130 | Bacteria | 3971 |
| 676 | Ga0500652_030150 | 3300053131 | Bacteria | 2120 |
| 677 | Ga0500658_0031793 | 3300053134 | Bacteria | 2066 |
| 678 | Ga0500658_0122116 | 3300053134 | Bacteria | 1155 |
| 679 | Ga0500559_0000763 | 3300053136 | Bacteria | 21093 |
| 680 | Ga0500559_0011045 | 3300053136 | Bacteria | 3866 |
| 681 | Ga0500559_0098307 | 3300053136 | Bacteria | 1346 |
| 682 | Ga0500568_0006307 | 3300053139 | Bacteria | 5972 |
| 683 | Ga0500568_0028856 | 3300053139 | Bacteria | 2309 |
| 684 | Ga0500577_0000095 | 3300053142 | Bacteria | 21049 |
| 685 | Ga0500579_127838 | 3300053143 | Bacteria | 1202 |
| 686 | Ga0500586_000083 | 3300053145 | Bacteria | 16354 |
| 687 | Ga0500588_0117499 | 3300053146 | Bacteria | 934 |
| 688 | Ga0500590_015151 | 3300053148 | Bacteria | 3980 |
| 689 | Ga0500590_023107 | 3300053148 | Bacteria | 3231 |
| 690 | Ga0500604_0010681 | 3300053151 | Bacteria | 2459 |
| 691 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 692 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 693 | Ga0500616_0019195 | 3300053153 | Bacteria | 3854 |
| 694 | Ga0500619_001130 | 3300053154 | Bacteria | 4632 |
| 695 | Ga0500622_0009308 | 3300053156 | Bacteria | 5443 |
| 696 | Ga0500622_0011211 | 3300053156 | Bacteria | 4891 |
| 697 | Ga0500634_0072918 | 3300053161 | Bacteria | 1791 |
| 698 | Ga0500638_009092 | 3300053162 | Bacteria | 4276 |
| 699 | Ga0500636_0000102 | 3300053177 | Bacteria | 43520 |
| 700 | Ga0500636_0002288 | 3300053177 | Bacteria | 10633 |
| 701 | Ga0500637_0056671 | 3300053178 | Bacteria | 2239 |
| 702 | Ga0500645_063301 | 3300053730 | Bacteria | 1067 |
| 703 | Ga0500599_003327 | 3300053736 | Bacteria | 1957 |
| 704 | Ga0500601_010092 | 3300053737 | Bacteria | 1055 |
| 705 | Ga0500661_004840 | 3300055283 | Bacteria | 2518 |
| 706 | Ga0466962_0047405 | 3300061719 | Bacteria | 2053 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053088 | Ga0500644_0045021 | Ga0500644_0045021_949_1473 | 158 |
| 2 | 3300035119 | Ga0373956_0195527 | Ga0373956_0195527_109_672 | 164 |
| 3 | 3300037068 | Ga0373925_0141888 | Ga0373925_0141888_866_1429 | 164 |
| 4 | 3300046463 | Ga0495653_0113799 | Ga0495653_0113799_1247_1810 | 164 |
| 5 | 3300046511 | Ga0495608_0052451 | Ga0495608_0052451_255_818 | 164 |
| 6 | 3300046514 | Ga0495618_0138442 | Ga0495618_0138442_77_640 | 164 |
| 7 | 3300048088 | Ga0495602_0030714 | Ga0495602_0030714_1249_1812 | 164 |
| 8 | 3300037068 | Ga0373925_0122404 | Ga0373925_0122404_46_609 | 166 |
| 9 | 3300009147 | Ga0114129_10028910 | Ga0114129_1002891010 | 169 |
| 10 | 3300050507 | nmdc:mga05p37_45593_c1 | nmdc:mga05p37_45593_c1_290_928 | 169 |
| 11 | 3300046660 | Ga0495625_0031145 | Ga0495625_0031145_3388_3948 | 170 |
| 12 | 3300046674 | Ga0495588_0504143 | Ga0495588_0504143_43_603 | 170 |
| 13 | 3300049459 | Ga0495678_122823 | Ga0495678_122823_30_590 | 170 |
| 14 | 3300053103 | Ga0500555_104108 | Ga0500555_104108_129_689 | 170 |
| 15 | 3300053730 | Ga0500645_063301 | Ga0500645_063301_467_1027 | 170 |
| 16 | 3300005327 | Ga0070658_10014422 | Ga0070658_100144224 | 171 |
| 17 | 3300025909 | Ga0207705_10046241 | Ga0207705_100462413 | 171 |
| 18 | 3300005458 | Ga0070681_10659162 | Ga0070681_106591621 | 172 |
| 19 | 3300025912 | Ga0207707_10233802 | Ga0207707_102338022 | 172 |
| 20 | 3300025932 | Ga0207690_10734547 | Ga0207690_107345472 | 172 |
| 21 | 3300026041 | Ga0207639_11004289 | Ga0207639_110042891 | 172 |
| 22 | 3300005435 | Ga0070714_100099186 | Ga0070714_1000991864 | 173 |
| 23 | 3300025929 | Ga0207664_10058593 | Ga0207664_100585934 | 173 |
| 24 | 3300048906 | Ga0496103_0313010 | Ga0496103_0313010_35_673 | 173 |
| 25 | 3300048908 | Ga0496105_0750816 | Ga0496105_0750816_82_720 | 173 |
| 26 | 3300048910 | Ga0496107_0241254 | Ga0496107_0241254_58_696 | 173 |
| 27 | 3300048911 | Ga0496108_0664591 | Ga0496108_0664591_124_762 | 173 |
| 28 | 3300046683 | Ga0495658_0272120 | Ga0495658_0272120_102_737 | 176 |
| 29 | 3300048929 | Ga0496126_0390969 | Ga0496126_0390969_131_775 | 176 |
| 30 | 3300046473 | Ga0495582_0037422 | Ga0495582_0037422_1099_1737 | 180 |
| 31 | 3300047315 | Ga0495581_0047799 | Ga0495581_0047799_1807_2445 | 180 |
| 32 | 3300004625 | Ga0055543_1033406 | Ga0055543_10334061 | 181 |
| 33 | 3300049581 | Ga0501047_0378134 | Ga0501047_0378134_349_981 | 181 |
| 34 | 3300053125 | Ga0500618_076717 | Ga0500618_076717_40_684 | 181 |
| 35 | 3300053142 | Ga0500577_0000095 | Ga0500577_0000095_4463_5104 | 181 |
| 36 | 3300003354 | JGI25160J50197_1013323 | JGI25160J50197_10133232 | 182 |
| 37 | 3300005262 | Ga0065165_1001679 | Ga0065165_100167910 | 182 |
| 38 | 3300005336 | Ga0070680_100053852 | Ga0070680_1000538522 | 182 |
| 39 | 3300005337 | Ga0070682_100185706 | Ga0070682_1001857062 | 182 |
| 40 | 3300005434 | Ga0070709_10043739 | Ga0070709_100437392 | 182 |
| 41 | 3300005436 | Ga0070713_100171313 | Ga0070713_1001713132 | 182 |
| 42 | 3300005458 | Ga0070681_10033224 | Ga0070681_100332242 | 182 |
| 43 | 3300005530 | Ga0070679_100035252 | Ga0070679_1000352526 | 182 |
| 44 | 3300005563 | Ga0068855_100762712 | Ga0068855_1007627121 | 182 |
| 45 | 3300006028 | Ga0070717_10337192 | Ga0070717_103371921 | 182 |
| 46 | 3300006946 | Ga0079104_1050574 | Ga0079104_10505741 | 182 |
| 47 | 3300009093 | Ga0105240_10404415 | Ga0105240_104044151 | 182 |
| 48 | 3300013307 | Ga0157372_10082842 | Ga0157372_100828422 | 182 |
| 49 | 3300025302 | Ga0207426_1000620 | Ga0207426_10006207 | 182 |
| 50 | 3300025906 | Ga0207699_10006782 | Ga0207699_100067822 | 182 |
| 51 | 3300025912 | Ga0207707_10001362 | Ga0207707_1000136225 | 182 |
| 52 | 3300025917 | Ga0207660_10015194 | Ga0207660_100151945 | 182 |
| 53 | 3300025921 | Ga0207652_10234377 | Ga0207652_102343772 | 182 |
| 54 | 3300025928 | Ga0207700_10072969 | Ga0207700_100729692 | 182 |
| 55 | 3300035083 | Ga0373926_0053807 | Ga0373926_0053807_66_710 | 182 |
| 56 | 3300035113 | Ga0373936_0092746 | Ga0373936_0092746_271_915 | 182 |
| 57 | 3300035116 | Ga0373945_0044654 | Ga0373945_0044654_171_809 | 182 |
| 58 | 3300035118 | Ga0373954_0083523 | Ga0373954_0083523_253_897 | 182 |
| 59 | 3300035171 | Ga0373946_0005588 | Ga0373946_0005588_340_984 | 182 |
| 60 | 3300035410 | Ga0373924_0021211 | Ga0373924_0021211_772_1416 | 182 |
| 61 | 3300035695 | Ga0373927_0014532 | Ga0373927_0014532_3202_3846 | 182 |
| 62 | 3300035724 | Ga0373933_0065194 | Ga0373933_0065194_1093_1737 | 182 |
| 63 | 3300046454 | Ga0495592_0047069 | Ga0495592_0047069_2392_3036 | 182 |
| 64 | 3300046473 | Ga0495582_0017699 | Ga0495582_0017699_1315_1959 | 182 |
| 65 | 3300046477 | Ga0495664_0298499 | Ga0495664_0298499_172_810 | 182 |
| 66 | 3300046514 | Ga0495618_0026681 | Ga0495618_0026681_1290_1934 | 182 |
| 67 | 3300046517 | Ga0495630_0061703 | Ga0495630_0061703_1028_1672 | 182 |
| 68 | 3300046531 | Ga0495665_0061181 | Ga0495665_0061181_382_1026 | 182 |
| 69 | 3300046533 | Ga0495640_0006879 | Ga0495640_0006879_5651_6295 | 182 |
| 70 | 3300046642 | Ga0495634_0176203 | Ga0495634_0176203_332_970 | 182 |
| 71 | 3300046680 | Ga0495646_0029662 | Ga0495646_0029662_894_1538 | 182 |
| 72 | 3300046681 | Ga0495647_0270857 | Ga0495647_0270857_103_741 | 182 |
| 73 | 3300046690 | Ga0495624_0032066 | Ga0495624_0032066_930_1568 | 182 |
| 74 | 3300047317 | Ga0495604_0217186 | Ga0495604_0217186_54_698 | 182 |
| 75 | 3300047320 | Ga0495672_0072588 | Ga0495672_0072588_323_961 | 182 |
| 76 | 3300047471 | Ga0495684_0009757 | Ga0495684_0009757_5682_6326 | 182 |
| 77 | 3300048907 | Ga0496104_0000281 | Ga0496104_0000281_24687_25325 | 182 |
| 78 | 3300048917 | Ga0496114_0246333 | Ga0496114_0246333_334_972 | 182 |
| 79 | 3300048924 | Ga0496121_0038503 | Ga0496121_0038503_1801_2439 | 182 |
| 80 | 3300048929 | Ga0496126_0086673 | Ga0496126_0086673_731_1369 | 182 |
| 81 | 3300048929 | Ga0496126_0114989 | Ga0496126_0114989_116_754 | 182 |
| 82 | 3300053078 | Ga0495612_0153146 | Ga0495612_0153146_101_739 | 182 |
| 83 | 3300039437 | Ga0436365_1718107 | Ga0436365_1718107_399_1037 | 183 |
| 84 | 3300042006 | Ga0439432_077789 | Ga0439432_077789_334_972 | 183 |
| 85 | 3300048929 | Ga0496126_0021354 | Ga0496126_0021354_421_1059 | 183 |
| 86 | 3300003215 | JGI25153J46596_10006581 | JGI25153J46596_100065814 | 184 |
| 87 | 3300003794 | Ga0055531_10037619 | Ga0055531_100376192 | 184 |
| 88 | 3300005262 | Ga0065165_1004782 | Ga0065165_10047829 | 184 |
| 89 | 3300005456 | Ga0070678_100232464 | Ga0070678_1002324642 | 184 |
| 90 | 3300005548 | Ga0070665_100111156 | Ga0070665_1001111563 | 184 |
| 91 | 3300025295 | Ga0209564_1006232 | Ga0209564_10062324 | 184 |
| 92 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011226 | 184 |
| 93 | 3300025304 | Ga0209257_1001196 | Ga0209257_100119614 | 184 |
| 94 | 3300035086 | Ga0373934_0081513 | Ga0373934_0081513_78_716 | 184 |
| 95 | 3300035172 | Ga0373955_0212974 | Ga0373955_0212974_364_1002 | 184 |
| 96 | 3300036401 | Ga0373937_0331486 | Ga0373937_0331486_421_1059 | 184 |
| 97 | 3300039450 | Ga0436363_1267944 | Ga0436363_1267944_209_847 | 184 |
| 98 | 3300041494 | Ga0451837_1556812 | Ga0451837_1556812_410_1048 | 184 |
| 99 | 3300044658 | Ga0466972_0001204 | Ga0466972_0001204_11407_12045 | 184 |
| 100 | 3300046529 | Ga0495652_0120287 | Ga0495652_0120287_766_1404 | 184 |
| 101 | 3300046559 | Ga0495667_0065521 | Ga0495667_0065521_1381_2025 | 184 |
| 102 | 3300047320 | Ga0495672_0022620 | Ga0495672_0022620_455_1093 | 184 |
| 103 | 3300053077 | Ga0495601_0217757 | Ga0495601_0217757_329_967 | 184 |
| 104 | 3300053084 | Ga0495595_0029835 | Ga0495595_0029835_988_1626 | 184 |
| 105 | 3300053085 | Ga0495619_0085957 | Ga0495619_0085957_1432_2070 | 184 |
| 106 | 3300053104 | Ga0500556_0105739 | Ga0500556_0105739_222_860 | 184 |
| 107 | 3300053139 | Ga0500568_0006307 | Ga0500568_0006307_437_1075 | 184 |
| 108 | 3300005330 | Ga0070690_100025612 | Ga0070690_1000256122 | 185 |
| 109 | 3300005334 | Ga0068869_100266211 | Ga0068869_1002662112 | 185 |
| 110 | 3300005339 | Ga0070660_100038698 | Ga0070660_1000386985 | 185 |
| 111 | 3300005347 | Ga0070668_100229052 | Ga0070668_1002290522 | 185 |
| 112 | 3300005353 | Ga0070669_100056356 | Ga0070669_1000563562 | 185 |
| 113 | 3300005367 | Ga0070667_100087671 | Ga0070667_1000876711 | 185 |
| 114 | 3300005438 | Ga0070701_10085110 | Ga0070701_100851102 | 185 |
| 115 | 3300005441 | Ga0070700_100087976 | Ga0070700_1000879762 | 185 |
| 116 | 3300005455 | Ga0070663_100711303 | Ga0070663_1007113031 | 185 |
| 117 | 3300005459 | Ga0068867_100126985 | Ga0068867_1001269853 | 185 |
| 118 | 3300005544 | Ga0070686_100029356 | Ga0070686_1000293563 | 185 |
| 119 | 3300005548 | Ga0070665_100429724 | Ga0070665_1004297242 | 185 |
| 120 | 3300005578 | Ga0068854_100029620 | Ga0068854_1000296205 | 185 |
| 121 | 3300005578 | Ga0068854_100070125 | Ga0068854_1000701252 | 185 |
| 122 | 3300005844 | Ga0068862_100030238 | Ga0068862_1000302382 | 185 |
| 123 | 3300006881 | Ga0068865_100018327 | Ga0068865_1000183272 | 185 |
| 124 | 3300009094 | Ga0111539_10235262 | Ga0111539_102352622 | 185 |
| 125 | 3300009098 | Ga0105245_10033898 | Ga0105245_100338985 | 185 |
| 126 | 3300009098 | Ga0105245_10625225 | Ga0105245_106252252 | 185 |
| 127 | 3300009148 | Ga0105243_10026251 | Ga0105243_100262513 | 185 |
| 128 | 3300009177 | Ga0105248_10339830 | Ga0105248_103398302 | 185 |
| 129 | 3300009545 | Ga0105237_10973237 | Ga0105237_109732371 | 185 |
| 130 | 3300009553 | Ga0105249_10080028 | Ga0105249_100800284 | 185 |
| 131 | 3300010375 | Ga0105239_10117346 | Ga0105239_101173463 | 185 |
| 132 | 3300011119 | Ga0105246_10590744 | Ga0105246_105907441 | 185 |
| 133 | 3300013306 | Ga0163162_10063695 | Ga0163162_100636952 | 185 |
| 134 | 3300013308 | Ga0157375_10112897 | Ga0157375_101128971 | 185 |
| 135 | 3300014968 | Ga0157379_10106063 | Ga0157379_101060632 | 185 |
| 136 | 3300014969 | Ga0157376_10564534 | Ga0157376_105645342 | 185 |
| 137 | 3300025899 | Ga0207642_10012943 | Ga0207642_100129432 | 185 |
| 138 | 3300025907 | Ga0207645_10058724 | Ga0207645_100587242 | 185 |
| 139 | 3300025919 | Ga0207657_10164356 | Ga0207657_101643562 | 185 |
| 140 | 3300025927 | Ga0207687_10096569 | Ga0207687_100965692 | 185 |
| 141 | 3300025935 | Ga0207709_10785145 | Ga0207709_107851451 | 185 |
| 142 | 3300025937 | Ga0207669_10014469 | Ga0207669_100144693 | 185 |
| 143 | 3300025938 | Ga0207704_10008022 | Ga0207704_100080225 | 185 |
| 144 | 3300025940 | Ga0207691_10082354 | Ga0207691_100823544 | 185 |
| 145 | 3300025942 | Ga0207689_10255575 | Ga0207689_102555752 | 185 |
| 146 | 3300025961 | Ga0207712_10022330 | Ga0207712_100223305 | 185 |
| 147 | 3300025981 | Ga0207640_10027127 | Ga0207640_100271275 | 185 |
| 148 | 3300025981 | Ga0207640_10086930 | Ga0207640_100869302 | 185 |
| 149 | 3300025986 | Ga0207658_10032320 | Ga0207658_100323203 | 185 |
| 150 | 3300026067 | Ga0207678_10083464 | Ga0207678_100834642 | 185 |
| 151 | 3300026118 | Ga0207675_100048738 | Ga0207675_1000487382 | 185 |
| 152 | 3300026121 | Ga0207683_10094651 | Ga0207683_100946511 | 185 |
| 153 | 3300026142 | Ga0207698_10983397 | Ga0207698_109833972 | 185 |
| 154 | 3300027907 | Ga0207428_10183872 | Ga0207428_101838722 | 185 |
| 155 | 3300028380 | Ga0268265_10090485 | Ga0268265_100904852 | 185 |
| 156 | 3300031711 | Ga0265314_10066984 | Ga0265314_100669843 | 185 |
| 157 | 3300031712 | Ga0265342_10052344 | Ga0265342_100523442 | 185 |
| 158 | 3300033180 | Ga0307510_10223192 | Ga0307510_102231921 | 185 |
| 159 | 3300046459 | Ga0495629_0001074 | Ga0495629_0001074_16270_16908 | 185 |
| 160 | 3300046463 | Ga0495653_0510714 | Ga0495653_0510714_28_666 | 185 |
| 161 | 3300046491 | Ga0495584_0037173 | Ga0495584_0037173_1695_2333 | 185 |
| 162 | 3300046499 | Ga0495594_0039656 | Ga0495594_0039656_1404_2042 | 185 |
| 163 | 3300046514 | Ga0495618_0153232 | Ga0495618_0153232_351_989 | 185 |
| 164 | 3300046519 | Ga0495632_0115767 | Ga0495632_0115767_285_923 | 185 |
| 165 | 3300046529 | Ga0495652_0005984 | Ga0495652_0005984_9872_10510 | 185 |
| 166 | 3300046533 | Ga0495640_0014950 | Ga0495640_0014950_2670_3308 | 185 |
| 167 | 3300046537 | Ga0495598_0060766 | Ga0495598_0060766_47_685 | 185 |
| 168 | 3300046557 | Ga0495622_0004871 | Ga0495622_0004871_3472_4110 | 185 |
| 169 | 3300046615 | Ga0495656_0014355 | Ga0495656_0014355_1528_2166 | 185 |
| 170 | 3300046642 | Ga0495634_0037946 | Ga0495634_0037946_2133_2771 | 185 |
| 171 | 3300046648 | Ga0495611_0073552 | Ga0495611_0073552_420_1058 | 185 |
| 172 | 3300046663 | Ga0495635_0009100 | Ga0495635_0009100_3146_3784 | 185 |
| 173 | 3300046674 | Ga0495588_0062386 | Ga0495588_0062386_1119_1757 | 185 |
| 174 | 3300046675 | Ga0495657_0002878 | Ga0495657_0002878_11089_11727 | 185 |
| 175 | 3300046684 | Ga0495669_0001263 | Ga0495669_0001263_1199_1837 | 185 |
| 176 | 3300046689 | Ga0495613_0037912 | Ga0495613_0037912_1368_2006 | 185 |
| 177 | 3300046690 | Ga0495624_0024346 | Ga0495624_0024346_1862_2500 | 185 |
| 178 | 3300046691 | Ga0495670_0187578 | Ga0495670_0187578_87_725 | 185 |
| 179 | 3300046692 | Ga0495671_0233492 | Ga0495671_0233492_105_743 | 185 |
| 180 | 3300046809 | Ga0495600_0018484 | Ga0495600_0018484_1245_1883 | 185 |
| 181 | 3300047317 | Ga0495604_0060125 | Ga0495604_0060125_1451_2089 | 185 |
| 182 | 3300047317 | Ga0495604_0424672 | Ga0495604_0424672_205_849 | 185 |
| 183 | 3300047673 | Ga0495593_0045925 | Ga0495593_0045925_1419_2057 | 185 |
| 184 | 3300048089 | Ga0495614_0207256 | Ga0495614_0207256_111_749 | 185 |
| 185 | 3300048903 | Ga0496100_0410972 | Ga0496100_0410972_332_970 | 185 |
| 186 | 3300048905 | Ga0496102_0134081 | Ga0496102_0134081_132_770 | 185 |
| 187 | 3300048908 | Ga0496105_0001556 | Ga0496105_0001556_1378_2016 | 185 |
| 188 | 3300048918 | Ga0496115_0062942 | Ga0496115_0062942_411_1049 | 185 |
| 189 | 3300048920 | Ga0496117_0175564 | Ga0496117_0175564_138_776 | 185 |
| 190 | 3300048922 | Ga0496119_0003040 | Ga0496119_0003040_14242_14880 | 185 |
| 191 | 3300048923 | Ga0496120_0001511 | Ga0496120_0001511_15213_15851 | 185 |
| 192 | 3300048924 | Ga0496121_0035087 | Ga0496121_0035087_1728_2366 | 185 |
| 193 | 3300048925 | Ga0496122_0092534 | Ga0496122_0092534_930_1568 | 185 |
| 194 | 3300048927 | Ga0496124_0499655 | Ga0496124_0499655_142_780 | 185 |
| 195 | 3300048928 | Ga0496125_0032889 | Ga0496125_0032889_381_1019 | 185 |
| 196 | 3300053122 | Ga0500608_019451 | Ga0500608_019451_1487_2125 | 185 |
| 197 | 3300053136 | Ga0500559_0000763 | Ga0500559_0000763_6038_6676 | 185 |
| 198 | 3300053136 | Ga0500559_0098307 | Ga0500559_0098307_28_666 | 185 |
| 199 | 3300053736 | Ga0500599_003327 | Ga0500599_003327_845_1483 | 185 |
| 200 | 3300055283 | Ga0500661_004840 | Ga0500661_004840_429_1067 | 185 |
| 201 | 3300003215 | JGI25153J46596_10058684 | JGI25153J46596_100586842 | 186 |
| 202 | 3300005614 | Ga0068856_100000061 | Ga0068856_10000006174 | 186 |
| 203 | 3300005937 | Ga0081455_10006207 | Ga0081455_100062073 | 186 |
| 204 | 3300006163 | Ga0070715_10129947 | Ga0070715_101299472 | 186 |
| 205 | 3300006941 | Ga0099825_1030152 | Ga0099825_10301524 | 186 |
| 206 | 3300025297 | Ga0209758_1017170 | Ga0209758_10171702 | 186 |
| 207 | 3300025905 | Ga0207685_10105399 | Ga0207685_101053992 | 186 |
| 208 | 3300026078 | Ga0207702_10000674 | Ga0207702_1000067428 | 186 |
| 209 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001231 | 186 |
| 210 | 3300027361 | Ga0209489_111101 | Ga0209489_1111017 | 186 |
| 211 | 3300027363 | Ga0209700_100007 | Ga0209700_100007194 | 186 |
| 212 | 3300044684 | Ga0466966_0001059 | Ga0466966_0001059_9614_10252 | 186 |
| 213 | 3300044693 | Ga0466961_0000050 | Ga0466961_0000050_13561_14199 | 186 |
| 214 | 3300044693 | Ga0466961_0150419 | Ga0466961_0150419_675_1313 | 186 |
| 215 | 3300045049 | Ga0466959_0021131 | Ga0466959_0021131_3209_3847 | 186 |
| 216 | 3300045976 | Ga0466967_0061854 | Ga0466967_0061854_683_1321 | 186 |
| 217 | 3300004625 | Ga0055543_1001388 | Ga0055543_10013884 | 187 |
| 218 | 3300005262 | Ga0065165_1002181 | Ga0065165_100218115 | 187 |
| 219 | 3300021320 | Ga0214544_1000368 | Ga0214544_100036839 | 187 |
| 220 | 3300021321 | Ga0214542_1002192 | Ga0214542_100219229 | 187 |
| 221 | 3300021324 | Ga0214545_1000203 | Ga0214545_100020339 | 187 |
| 222 | 3300021327 | Ga0214543_1000322 | Ga0214543_100032239 | 187 |
| 223 | 3300021377 | Ga0213874_10035272 | Ga0213874_100352722 | 187 |
| 224 | 3300025297 | Ga0209758_1020271 | Ga0209758_10202713 | 187 |
| 225 | 3300025302 | Ga0207426_1020710 | Ga0207426_10207103 | 187 |
| 226 | 3300035118 | Ga0373954_0029735 | Ga0373954_0029735_1153_1785 | 187 |
| 227 | 3300035172 | Ga0373955_0226510 | Ga0373955_0226510_14_646 | 187 |
| 228 | 3300037471 | Ga0395905_0145412 | Ga0395905_0145412_940_1578 | 187 |
| 229 | 3300037853 | Ga0436364_1318234 | Ga0436364_1318234_1149_1787 | 187 |
| 230 | 3300039450 | Ga0436363_0263740 | Ga0436363_0263740_654_1292 | 187 |
| 231 | 3300039450 | Ga0436363_1457984 | Ga0436363_1457984_463_1119 | 187 |
| 232 | 3300044658 | Ga0466972_0000333 | Ga0466972_0000333_22201_22839 | 187 |
| 233 | 3300044658 | Ga0466972_0068108 | Ga0466972_0068108_501_1139 | 187 |
| 234 | 3300044683 | Ga0466965_0100487 | Ga0466965_0100487_431_1069 | 187 |
| 235 | 3300044735 | Ga0466968_0039031 | Ga0466968_0039031_1184_1822 | 187 |
| 236 | 3300044765 | Ga0466970_0115905 | Ga0466970_0115905_733_1371 | 187 |
| 237 | 3300046476 | Ga0495662_0054440 | Ga0495662_0054440_48_686 | 187 |
| 238 | 3300046516 | Ga0495628_0238003 | Ga0495628_0238003_552_1184 | 187 |
| 239 | 3300046516 | Ga0495628_0349865 | Ga0495628_0349865_242_874 | 187 |
| 240 | 3300046529 | Ga0495652_0271441 | Ga0495652_0271441_337_969 | 187 |
| 241 | 3300046536 | Ga0495587_0095823 | Ga0495587_0095823_666_1298 | 187 |
| 242 | 3300046543 | Ga0495645_0081830 | Ga0495645_0081830_65_697 | 187 |
| 243 | 3300046675 | Ga0495657_0203959 | Ga0495657_0203959_352_984 | 187 |
| 244 | 3300046679 | Ga0495623_0105087 | Ga0495623_0105087_78_710 | 187 |
| 245 | 3300047444 | Ga0495675_0140641 | Ga0495675_0140641_832_1464 | 187 |
| 246 | 3300048927 | Ga0496124_0217659 | Ga0496124_0217659_651_1289 | 187 |
| 247 | 3300053094 | Ga0500566_0014704 | Ga0500566_0014704_2819_3457 | 187 |
| 248 | 3300053111 | Ga0500572_003830 | Ga0500572_003830_604_1242 | 187 |
| 249 | 3300053130 | Ga0500642_0000057 | Ga0500642_0000057_10110_10748 | 187 |
| 250 | 3300053177 | Ga0500636_0000102 | Ga0500636_0000102_11714_12352 | 187 |
| 251 | 3300005355 | Ga0070671_100514230 | Ga0070671_1005142302 | 188 |
| 252 | 3300005434 | Ga0070709_10005587 | Ga0070709_100055872 | 188 |
| 253 | 3300005436 | Ga0070713_100005894 | Ga0070713_1000058946 | 188 |
| 254 | 3300005437 | Ga0070710_10057100 | Ga0070710_100571003 | 188 |
| 255 | 3300005439 | Ga0070711_100004477 | Ga0070711_1000044774 | 188 |
| 256 | 3300005548 | Ga0070665_100195513 | Ga0070665_1001955132 | 188 |
| 257 | 3300005618 | Ga0068864_100769369 | Ga0068864_1007693691 | 188 |
| 258 | 3300006048 | Ga0075363_100044231 | Ga0075363_1000442312 | 188 |
| 259 | 3300006163 | Ga0070715_10158970 | Ga0070715_101589701 | 188 |
| 260 | 3300006175 | Ga0070712_100093359 | Ga0070712_1000933592 | 188 |
| 261 | 3300025898 | Ga0207692_10364644 | Ga0207692_103646442 | 188 |
| 262 | 3300025905 | Ga0207685_10086553 | Ga0207685_100865532 | 188 |
| 263 | 3300025906 | Ga0207699_10049144 | Ga0207699_100491442 | 188 |
| 264 | 3300025915 | Ga0207693_10026503 | Ga0207693_100265033 | 188 |
| 265 | 3300026067 | Ga0207678_10194046 | Ga0207678_101940462 | 188 |
| 266 | 3300026088 | Ga0207641_10801116 | Ga0207641_108011161 | 188 |
| 267 | 3300028786 | Ga0307517_10001507 | Ga0307517_100015077 | 188 |
| 268 | 3300046463 | Ga0495653_0033029 | Ga0495653_0033029_3201_3845 | 188 |
| 269 | 3300046690 | Ga0495624_0442618 | Ga0495624_0442618_53_691 | 188 |
| 270 | 3300048915 | Ga0496112_0753467 | Ga0496112_0753467_59_697 | 188 |
| 271 | 3300048928 | Ga0496125_0005006 | Ga0496125_0005006_10883_11527 | 188 |
| 272 | 3300053079 | Ga0500610_0230352 | Ga0500610_0230352_138_776 | 188 |
| 273 | 3300003215 | JGI25153J46596_10003303 | JGI25153J46596_100033036 | 189 |
| 274 | 3300005441 | Ga0070700_100508332 | Ga0070700_1005083322 | 189 |
| 275 | 3300025297 | Ga0209758_1000365 | Ga0209758_100036574 | 189 |
| 276 | 3300031250 | Ga0265331_10033872 | Ga0265331_100338723 | 189 |
| 277 | 3300037853 | Ga0436364_0561281 | Ga0436364_0561281_43_681 | 189 |
| 278 | 3300039437 | Ga0436365_1553711 | Ga0436365_1553711_1334_1972 | 189 |
| 279 | 3300003215 | JGI25153J46596_10052382 | JGI25153J46596_100523822 | 190 |
| 280 | 3300025297 | Ga0209758_1017378 | Ga0209758_10173783 | 190 |
| 281 | 3300025981 | Ga0207640_10883235 | Ga0207640_108832351 | 190 |
| 282 | 3300031901 | Ga0307406_10330526 | Ga0307406_103305261 | 190 |
| 283 | iso_pu_bacteria | 2989771324 | 2989775569 | 190 |
| 284 | 3300005329 | Ga0070683_100012219 | Ga0070683_1000122198 | 191 |
| 285 | 3300005535 | Ga0070684_100005320 | Ga0070684_1000053209 | 191 |
| 286 | 3300010375 | Ga0105239_10189212 | Ga0105239_101892123 | 191 |
| 287 | 3300025912 | Ga0207707_10049987 | Ga0207707_100499874 | 191 |
| 288 | 3300025913 | Ga0207695_10258535 | Ga0207695_102585353 | 191 |
| 289 | 3300025944 | Ga0207661_10000647 | Ga0207661_1000064718 | 191 |
| 290 | 3300028573 | Ga0265334_10174106 | Ga0265334_101741062 | 191 |
| 291 | 3300031235 | Ga0265330_10052689 | Ga0265330_100526892 | 191 |
| 292 | 3300031712 | Ga0265342_10076950 | Ga0265342_100769502 | 191 |
| 293 | 3300035086 | Ga0373934_0005198 | Ga0373934_0005198_442_1080 | 191 |
| 294 | 3300035117 | Ga0373953_0001814 | Ga0373953_0001814_3005_3643 | 191 |
| 295 | 3300035118 | Ga0373954_0001141 | Ga0373954_0001141_2864_3502 | 191 |
| 296 | 3300035119 | Ga0373956_0001770 | Ga0373956_0001770_5665_6303 | 191 |
| 297 | 3300035120 | Ga0373957_0007539 | Ga0373957_0007539_1377_2015 | 191 |
| 298 | 3300035172 | Ga0373955_0004475 | Ga0373955_0004475_3093_3731 | 191 |
| 299 | 3300035724 | Ga0373933_0001421 | Ga0373933_0001421_575_1213 | 191 |
| 300 | 3300036401 | Ga0373937_0007299 | Ga0373937_0007299_2435_3073 | 191 |
| 301 | 3300046454 | Ga0495592_0002728 | Ga0495592_0002728_8071_8709 | 191 |
| 302 | 3300046459 | Ga0495629_0005031 | Ga0495629_0005031_2764_3402 | 191 |
| 303 | 3300046462 | Ga0495651_0009631 | Ga0495651_0009631_497_1135 | 191 |
| 304 | 3300046463 | Ga0495653_0000513 | Ga0495653_0000513_21361_21999 | 191 |
| 305 | 3300046499 | Ga0495594_0208631 | Ga0495594_0208631_247_885 | 191 |
| 306 | 3300046511 | Ga0495608_0003659 | Ga0495608_0003659_8101_8739 | 191 |
| 307 | 3300046516 | Ga0495628_0019165 | Ga0495628_0019165_3061_3699 | 191 |
| 308 | 3300046529 | Ga0495652_0019338 | Ga0495652_0019338_2676_3314 | 191 |
| 309 | 3300046533 | Ga0495640_0031760 | Ga0495640_0031760_913_1551 | 191 |
| 310 | 3300046536 | Ga0495587_0001598 | Ga0495587_0001598_2313_2951 | 191 |
| 311 | 3300046543 | Ga0495645_0010435 | Ga0495645_0010435_3549_4187 | 191 |
| 312 | 3300046559 | Ga0495667_0003789 | Ga0495667_0003789_6754_7392 | 191 |
| 313 | 3300046642 | Ga0495634_0005582 | Ga0495634_0005582_3290_3928 | 191 |
| 314 | 3300046663 | Ga0495635_0000211 | Ga0495635_0000211_8530_9168 | 191 |
| 315 | 3300046675 | Ga0495657_0002321 | Ga0495657_0002321_7027_7665 | 191 |
| 316 | 3300046678 | Ga0495599_0000957 | Ga0495599_0000957_6828_7466 | 191 |
| 317 | 3300046680 | Ga0495646_0004069 | Ga0495646_0004069_5323_5961 | 191 |
| 318 | 3300047317 | Ga0495604_0010845 | Ga0495604_0010845_4037_4675 | 191 |
| 319 | 3300047319 | Ga0495674_0014461 | Ga0495674_0014461_4438_5076 | 191 |
| 320 | 3300047322 | Ga0495680_0006158 | Ga0495680_0006158_6754_7392 | 191 |
| 321 | 3300047444 | Ga0495675_0001324 | Ga0495675_0001324_6402_7040 | 191 |
| 322 | 3300047471 | Ga0495684_0015063 | Ga0495684_0015063_2642_3280 | 191 |
| 323 | 3300047673 | Ga0495593_0002923 | Ga0495593_0002923_6497_7135 | 191 |
| 324 | 3300048088 | Ga0495602_0008570 | Ga0495602_0008570_2490_3128 | 191 |
| 325 | 3300053077 | Ga0495601_0020087 | Ga0495601_0020087_781_1419 | 191 |
| 326 | 3300053085 | Ga0495619_0018508 | Ga0495619_0018508_2313_2951 | 191 |
| 327 | iso_pu_bacteria | 2508501009 | 2508541867 | 192 |
| 328 | iso_pu_bacteria | 2508501042 | 2508692589 | 192 |
| 329 | iso_pu_bacteria | 2510065057 | 2510306137 | 192 |
| 330 | iso_pu_bacteria | 2511231028 | 2511397100 | 192 |
| 331 | iso_pu_bacteria | 2513237091 | 2513615026 | 192 |
| 332 | iso_pu_bacteria | 2513237092 | 2513622969 | 192 |
| 333 | iso_pu_bacteria | 2513237095 | 2513647429 | 192 |
| 334 | iso_pu_bacteria | 2513237102 | 2513699548 | 192 |
| 335 | iso_pu_bacteria | 2513237139 | 2513878435 | 192 |
| 336 | iso_pu_bacteria | 2513237161 | 2514009517 | 192 |
| 337 | iso_pu_bacteria | 2515154112 | 2515625999 | 192 |
| 338 | iso_pu_bacteria | 2517093001 | 2517104068 | 192 |
| 339 | iso_pu_bacteria | 2524023205 | 2524436372 | 192 |
| 340 | iso_pu_bacteria | 2528768022 | 2528849073 | 192 |
| 341 | iso_pu_bacteria | 2617270735 | 2617346714 | 192 |
| 342 | iso_pu_bacteria | 2744054633 | 2745080674 | 192 |
| 343 | iso_pu_bacteria | 2791355196 | 2793064438 | 192 |
| 344 | iso_pu_bacteria | 2802429603 | 2805919141 | 192 |
| 345 | iso_pu_bacteria | 2816332527 | 2818236466 | 192 |
| 346 | iso_pu_bacteria | 2824600985 | 2824607086 | 192 |
| 347 | iso_pu_bacteria | 2824609381 | 2824612968 | 192 |
| 348 | iso_pu_bacteria | 2824617872 | 2824621923 | 192 |
| 349 | iso_pu_bacteria | 2824626560 | 2824631609 | 192 |
| 350 | iso_pu_bacteria | 2824635225 | 2824641701 | 192 |
| 351 | iso_pu_bacteria | 2824644064 | 2824649357 | 192 |
| 352 | iso_pu_bacteria | 2824653114 | 2824659468 | 192 |
| 353 | iso_pu_bacteria | 2824661429 | 2824668510 | 192 |
| 354 | iso_pu_bacteria | 2824679649 | 2824682934 | 192 |
| 355 | iso_pu_bacteria | 2824704595 | 2824713660 | 192 |
| 356 | iso_pu_bacteria | 2824714736 | 2824719190 | 192 |
| 357 | iso_pu_bacteria | 2824723954 | 2824729601 | 192 |
| 358 | iso_pu_bacteria | 2824753945 | 2824758464 | 192 |
| 359 | iso_pu_bacteria | 2824763712 | 2824770048 | 192 |
| 360 | iso_pu_bacteria | 2824773399 | 2824775213 | 192 |
| 361 | iso_pu_bacteria | 2838122688 | 2838128885 | 192 |
| 362 | iso_pu_bacteria | 2841941048 | 2841944968 | 192 |
| 363 | iso_pu_bacteria | 2841949485 | 2841953392 | 192 |
| 364 | iso_pu_bacteria | 2841957949 | 2841959781 | 192 |
| 365 | iso_pu_bacteria | 2841966195 | 2841972137 | 192 |
| 366 | iso_pu_bacteria | 2841974524 | 2841978117 | 192 |
| 367 | iso_pu_bacteria | 2841983080 | 2841986260 | 192 |
| 368 | iso_pu_bacteria | 2842038055 | 2842040565 | 192 |
| 369 | iso_pu_bacteria | 2842045827 | 2842046489 | 192 |
| 370 | iso_pu_bacteria | 2847930680 | 2847937240 | 192 |
| 371 | iso_pu_bacteria | 2847939898 | 2847947654 | 192 |
| 372 | iso_pu_bacteria | 2849076700 | 2849078490 | 192 |
| 373 | iso_pu_bacteria | 2857509624 | 2857512850 | 192 |
| 374 | iso_pu_bacteria | 2874590934 | 2874598852 | 192 |
| 375 | iso_pu_bacteria | 2874612657 | 2874614662 | 192 |
| 376 | iso_pu_bacteria | 2874645413 | 2874652308 | 192 |
| 377 | iso_pu_bacteria | 2876761206 | 2876766181 | 192 |
| 378 | iso_pu_bacteria | 2876771140 | 2876778891 | 192 |
| 379 | iso_pu_bacteria | 2876818435 | 2876824214 | 192 |
| 380 | iso_pu_bacteria | 2879074833 | 2879082684 | 192 |
| 381 | iso_pu_bacteria | 2879099564 | 2879107047 | 192 |
| 382 | iso_pu_bacteria | 2879127579 | 2879132155 | 192 |
| 383 | iso_pu_bacteria | 2879142872 | 2879148318 | 192 |
| 384 | iso_pu_bacteria | 2881364244 | 2881371543 | 192 |
| 385 | iso_pu_bacteria | 2881665667 | 2881671839 | 192 |
| 386 | iso_pu_bacteria | 2885383462 | 2885388304 | 192 |
| 387 | iso_pu_bacteria | 2885409591 | 2885415600 | 192 |
| 388 | iso_pu_bacteria | 2888378607 | 2888385366 | 192 |
| 389 | iso_pu_bacteria | 2888388044 | 2888392882 | 192 |
| 390 | iso_pu_bacteria | 2888419890 | 2888425502 | 192 |
| 391 | iso_pu_bacteria | 2893066018 | 2893066082 | 192 |
| 392 | iso_pu_bacteria | 2904666416 | 2904674390 | 192 |
| 393 | iso_pu_bacteria | 2904711408 | 2904712069 | 192 |
| 394 | iso_pu_bacteria | 2906626472 | 2906627430 | 192 |
| 395 | iso_pu_bacteria | 2906643746 | 2906649365 | 192 |
| 396 | iso_pu_bacteria | 2908775508 | 2908781088 | 192 |
| 397 | iso_pu_bacteria | 2915993759 | 2915999789 | 192 |
| 398 | iso_pu_bacteria | 2921208531 | 2921211847 | 192 |
| 399 | iso_pu_bacteria | 2922368715 | 2922372500 | 192 |
| 400 | iso_pu_bacteria | 2922393267 | 2922397153 | 192 |
| 401 | iso_pu_bacteria | 2929615660 | 2929620936 | 192 |
| 402 | iso_pu_bacteria | 2929624759 | 2929626233 | 192 |
| 403 | iso_pu_bacteria | 2932784394 | 2932784888 | 192 |
| 404 | iso_pu_bacteria | 2932809354 | 2932809922 | 192 |
| 405 | iso_pu_bacteria | 2932818245 | 2932818335 | 192 |
| 406 | iso_pu_bacteria | 2932828146 | 2932828725 | 192 |
| 407 | iso_pu_bacteria | 2933577622 | 2933583194 | 192 |
| 408 | iso_pu_bacteria | 2935608549 | 2935609746 | 192 |
| 409 | iso_pu_bacteria | 2935616580 | 2935619855 | 192 |
| 410 | iso_pu_bacteria | 2935638405 | 2935638837 | 192 |
| 411 | iso_pu_bacteria | 2935648319 | 2935654209 | 192 |
| 412 | iso_pu_bacteria | 2935656913 | 2935663098 | 192 |
| 413 | iso_pu_bacteria | 2935665750 | 2935666313 | 192 |
| 414 | iso_pu_bacteria | 2935675223 | 2935676642 | 192 |
| 415 | iso_pu_bacteria | 2935684952 | 2935685025 | 192 |
| 416 | iso_pu_bacteria | 2935694250 | 2935694721 | 192 |
| 417 | iso_pu_bacteria | 2935703347 | 2935703842 | 192 |
| 418 | iso_pu_bacteria | 2935713505 | 2935713578 | 192 |
| 419 | iso_pu_bacteria | 2935722832 | 2935724198 | 192 |
| 420 | iso_pu_bacteria | 2935732158 | 2935733444 | 192 |
| 421 | iso_pu_bacteria | 2935741537 | 2935742823 | 192 |
| 422 | iso_pu_bacteria | 2935750917 | 2935750990 | 192 |
| 423 | iso_pu_bacteria | 2935760218 | 2935760481 | 192 |
| 424 | iso_pu_bacteria | 2935769743 | 2935772027 | 192 |
| 425 | iso_pu_bacteria | 2935777560 | 2935784202 | 192 |
| 426 | iso_pu_bacteria | 2935785616 | 2935787585 | 192 |
| 427 | iso_pu_bacteria | 2935793552 | 2935796217 | 192 |
| 428 | iso_pu_bacteria | 2935801545 | 2935801979 | 192 |
| 429 | iso_pu_bacteria | 2935810662 | 2935810748 | 192 |
| 430 | iso_pu_bacteria | 2935819856 | 2935822908 | 192 |
| 431 | iso_pu_bacteria | 2935827899 | 2935828331 | 192 |
| 432 | iso_pu_bacteria | 2935837841 | 2935839746 | 192 |
| 433 | iso_pu_bacteria | 2935847175 | 2935848490 | 192 |
| 434 | iso_pu_bacteria | 2935855204 | 2935857830 | 192 |
| 435 | iso_pu_bacteria | 2935864058 | 2935868828 | 192 |
| 436 | iso_pu_bacteria | 2935873716 | 2935874243 | 192 |
| 437 | iso_pu_bacteria | 2935908558 | 2935909706 | 192 |
| 438 | iso_pu_bacteria | 2935916978 | 2935917430 | 192 |
| 439 | iso_pu_bacteria | 2935926038 | 2935927187 | 192 |
| 440 | iso_pu_bacteria | 2935934488 | 2935936969 | 192 |
| 441 | iso_pu_bacteria | 2935942939 | 2935944728 | 192 |
| 442 | iso_pu_bacteria | 2935951376 | 2935953165 | 192 |
| 443 | iso_pu_bacteria | 2935959822 | 2935961330 | 192 |
| 444 | iso_pu_bacteria | 2935967501 | 2935970005 | 192 |
| 445 | iso_pu_bacteria | 2935975950 | 2935980291 | 192 |
| 446 | iso_pu_bacteria | 2935984226 | 2935986944 | 192 |
| 447 | iso_pu_bacteria | 2935992306 | 2935992832 | 192 |
| 448 | iso_pu_bacteria | 2936002035 | 2936002745 | 192 |
| 449 | iso_pu_bacteria | 2936011229 | 2936017254 | 192 |
| 450 | iso_pu_bacteria | 2936019824 | 2936025756 | 192 |
| 451 | iso_pu_bacteria | 2936028420 | 2936034589 | 192 |
| 452 | iso_pu_bacteria | 2936037263 | 2936037832 | 192 |
| 453 | iso_pu_bacteria | 2936046547 | 2936052646 | 192 |
| 454 | iso_pu_bacteria | 2936055302 | 2936062071 | 192 |
| 455 | iso_pu_bacteria | 2937091812 | 2937095149 | 192 |
| 456 | iso_pu_bacteria | 2940556831 | 2940558207 | 192 |
| 457 | iso_pu_bacteria | 2941538514 | 2941540913 | 192 |
| 458 | iso_pu_bacteria | 2960652885 | 2960656070 | 192 |
| 459 | iso_pu_bacteria | 2964656573 | 2964658090 | 192 |
| 460 | iso_pu_bacteria | 2970184632 | 2970187350 | 192 |
| 461 | iso_pu_bacteria | 3005483717 | 3005484879 | 192 |
| 462 | iso_pu_bacteria | 3005506211 | 3005508507 | 192 |
| 463 | iso_pu_bacteria | 3005587118 | 3005587157 | 192 |
| 464 | iso_pu_bacteria | 3005594810 | 3005600210 | 192 |
| 465 | iso_pu_bacteria | 3005710791 | 3005715725 | 192 |
| 466 | iso_pu_bacteria | 3005718088 | 3005723070 | 192 |
| 467 | iso_pu_bacteria | 8006926726 | 8006930877 | 192 |
| 468 | iso_pu_bacteria | 8016511872 | 8016520752 | 192 |
| 469 | iso_pu_bacteria | 8016522445 | 8016528784 | 192 |
| 470 | iso_pu_bacteria | 8016530956 | 8016533965 | 192 |
| 471 | iso_pu_bacteria | 8016539877 | 8016547193 | 192 |
| 472 | iso_pu_bacteria | 8016548790 | 8016554936 | 192 |
| 473 | iso_pu_bacteria | 8016557553 | 8016563303 | 192 |
| 474 | iso_pu_bacteria | 8016566248 | 8016572306 | 192 |
| 475 | iso_pu_bacteria | 8016575299 | 8016576489 | 192 |
| 476 | iso_pu_bacteria | 8016595262 | 8016601055 | 192 |
| 477 | iso_pu_bacteria | 8016603502 | 8016609398 | 192 |
| 478 | iso_pu_bacteria | 8016613128 | 8016615512 | 192 |
| 479 | iso_pu_bacteria | 8016630954 | 8016639272 | 192 |
| 480 | iso_pu_bacteria | 8017057580 | 8017064833 | 192 |
| 481 | iso_pu_bacteria | 8019530166 | 8019533738 | 192 |
| 482 | iso_pu_bacteria | 8019538911 | 8019545931 | 192 |
| 483 | iso_pu_bacteria | 8019547302 | 8019552795 | 192 |
| 484 | iso_pu_bacteria | 8019576017 | 8019584208 | 192 |
| 485 | iso_pu_bacteria | 8019586578 | 8019591969 | 192 |
| 486 | iso_pu_bacteria | 8019597564 | 8019599317 | 192 |
| 487 | iso_pu_bacteria | 8019608314 | 8019609040 | 192 |
| 488 | iso_pu_bacteria | 8019619141 | 8019619726 | 192 |
| 489 | iso_pu_bacteria | 8019629233 | 8019633388 | 192 |
| 490 | iso_pu_bacteria | 8019638758 | 8019646509 | 192 |
| 491 | iso_pu_bacteria | 8019648815 | 8019649257 | 192 |
| 492 | iso_pu_bacteria | 8019659431 | 8019661272 | 192 |
| 493 | iso_pu_bacteria | 8019668869 | 8019670812 | 192 |
| 494 | iso_pu_bacteria | 8019678201 | 8019685387 | 192 |
| 495 | iso_pu_bacteria | 8019687851 | 8019690978 | 192 |
| 496 | iso_pu_bacteria | 8055742211 | 8055745201 | 192 |
| 497 | 3300009551 | Ga0105238_10008473 | Ga0105238_100084735 | 193 |
| 498 | 3300013296 | Ga0157374_10013080 | Ga0157374_100130806 | 193 |
| 499 | 3300025914 | Ga0207671_10031938 | Ga0207671_100319382 | 193 |
| 500 | 3300025924 | Ga0207694_10402564 | Ga0207694_104025642 | 193 |
| 501 | 3300005335 | Ga0070666_10120234 | Ga0070666_101202341 | 195 |
| 502 | 3300005985 | Ga0081539_10118064 | Ga0081539_101180642 | 195 |
| 503 | 3300009093 | Ga0105240_10016135 | Ga0105240_100161352 | 195 |
| 504 | 3300009098 | Ga0105245_10351092 | Ga0105245_103510922 | 195 |
| 505 | 3300009101 | Ga0105247_10048323 | Ga0105247_100483232 | 195 |
| 506 | 3300009174 | Ga0105241_10047364 | Ga0105241_100473641 | 195 |
| 507 | 3300009545 | Ga0105237_10085795 | Ga0105237_100857953 | 195 |
| 508 | 3300010375 | Ga0105239_10178770 | Ga0105239_101787701 | 195 |
| 509 | 3300025903 | Ga0207680_10536558 | Ga0207680_105365581 | 195 |
| 510 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008708 | 195 |
| 511 | 3300025914 | Ga0207671_10011774 | Ga0207671_100117742 | 195 |
| 512 | 3300025927 | Ga0207687_10115447 | Ga0207687_101154472 | 195 |
| 513 | 3300026142 | Ga0207698_10003453 | Ga0207698_100034535 | 195 |
| 514 | 3300028794 | Ga0307515_10001890 | Ga0307515_100018904 | 195 |
| 515 | 3300031730 | Ga0307516_10173919 | Ga0307516_101739192 | 195 |
| 516 | 3300032005 | Ga0307411_10662386 | Ga0307411_106623861 | 195 |
| 517 | 3300033180 | Ga0307510_10174924 | Ga0307510_101749242 | 195 |
| 518 | 3300046457 | Ga0495590_0090057 | Ga0495590_0090057_336_974 | 195 |
| 519 | 3300046501 | Ga0495607_0080723 | Ga0495607_0080723_446_1084 | 195 |
| 520 | 3300046507 | Ga0495606_0051812 | Ga0495606_0051812_829_1467 | 195 |
| 521 | 3300046522 | Ga0495643_0096143 | Ga0495643_0096143_11_625 | 195 |
| 522 | 3300046524 | Ga0495648_0038462 | Ga0495648_0038462_1968_2606 | 195 |
| 523 | 3300046530 | Ga0495654_0257755 | Ga0495654_0257755_39_677 | 195 |
| 524 | 3300046660 | Ga0495625_0307638 | Ga0495625_0307638_230_868 | 195 |
| 525 | 3300046665 | Ga0495661_0103149 | Ga0495661_0103149_343_981 | 195 |
| 526 | 3300046694 | Ga0495649_0088179 | Ga0495649_0088179_994_1632 | 195 |
| 527 | 3300047323 | Ga0495683_0006277 | Ga0495683_0006277_4091_4729 | 195 |
| 528 | 3300047469 | Ga0495673_0040211 | Ga0495673_0040211_1078_1716 | 195 |
| 529 | 3300048904 | Ga0496101_0346570 | Ga0496101_0346570_101_742 | 195 |
| 530 | 3300048918 | Ga0496115_0863477 | Ga0496115_0863477_11_649 | 195 |
| 531 | 3300048921 | Ga0496118_0071041 | Ga0496118_0071041_306_944 | 195 |
| 532 | 3300049460 | Ga0495682_0013260 | Ga0495682_0013260_1779_2417 | 195 |
| 533 | 3300053083 | Ga0495655_0003802 | Ga0495655_0003802_553_1191 | 195 |
| 534 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_208662_209297 | 195 |
| 535 | 2010549000 | RicEn_C2514 | RicEn_46200 | 196 |
| 536 | 3300003215 | JGI25153J46596_10003923 | JGI25153J46596_100039237 | 196 |
| 537 | 3300003308 | Ga0006777J48905_1010854 | Ga0006777J48905_10108542 | 196 |
| 538 | 3300003323 | rootH1_10049032 | rootH1_100490324 | 196 |
| 539 | 3300003354 | JGI25160J50197_1000499 | JGI25160J50197_10004993 | 196 |
| 540 | 3300003354 | JGI25160J50197_1001057 | JGI25160J50197_10010579 | 196 |
| 541 | 3300003579 | Ga0007429J51699_1020681 | Ga0007429J51699_10206812 | 196 |
| 542 | 3300005262 | Ga0065165_1020739 | Ga0065165_10207392 | 196 |
| 543 | 3300005327 | Ga0070658_10204640 | Ga0070658_102046402 | 196 |
| 544 | 3300005327 | Ga0070658_10430515 | Ga0070658_104305152 | 196 |
| 545 | 3300005329 | Ga0070683_100121264 | Ga0070683_1001212642 | 196 |
| 546 | 3300005331 | Ga0070670_100083877 | Ga0070670_1000838771 | 196 |
| 547 | 3300005335 | Ga0070666_10135389 | Ga0070666_101353892 | 196 |
| 548 | 3300005336 | Ga0070680_100052054 | Ga0070680_1000520544 | 196 |
| 549 | 3300005338 | Ga0068868_100405742 | Ga0068868_1004057422 | 196 |
| 550 | 3300005339 | Ga0070660_100364394 | Ga0070660_1003643942 | 196 |
| 551 | 3300005344 | Ga0070661_100135097 | Ga0070661_1001350972 | 196 |
| 552 | 3300005344 | Ga0070661_100620230 | Ga0070661_1006202302 | 196 |
| 553 | 3300005345 | Ga0070692_10072645 | Ga0070692_100726452 | 196 |
| 554 | 3300005347 | Ga0070668_100030576 | Ga0070668_1000305763 | 196 |
| 555 | 3300005355 | Ga0070671_100005407 | Ga0070671_1000054079 | 196 |
| 556 | 3300005367 | Ga0070667_100198335 | Ga0070667_1001983352 | 196 |
| 557 | 3300005367 | Ga0070667_100494030 | Ga0070667_1004940302 | 196 |
| 558 | 3300005434 | Ga0070709_10035327 | Ga0070709_100353274 | 196 |
| 559 | 3300005435 | Ga0070714_100076342 | Ga0070714_1000763421 | 196 |
| 560 | 3300005435 | Ga0070714_100841110 | Ga0070714_1008411102 | 196 |
| 561 | 3300005436 | Ga0070713_101307497 | Ga0070713_1013074971 | 196 |
| 562 | 3300005457 | Ga0070662_100129504 | Ga0070662_1001295042 | 196 |
| 563 | 3300005458 | Ga0070681_10573160 | Ga0070681_105731602 | 196 |
| 564 | 3300005458 | Ga0070681_11002842 | Ga0070681_110028421 | 196 |
| 565 | 3300005459 | Ga0068867_100265251 | Ga0068867_1002652512 | 196 |
| 566 | 3300005530 | Ga0070679_100145568 | Ga0070679_1001455682 | 196 |
| 567 | 3300005535 | Ga0070684_100017131 | Ga0070684_1000171314 | 196 |
| 568 | 3300005547 | Ga0070693_100057000 | Ga0070693_1000570003 | 196 |
| 569 | 3300005548 | Ga0070665_100282608 | Ga0070665_1002826084 | 196 |
| 570 | 3300005548 | Ga0070665_100563301 | Ga0070665_1005633012 | 196 |
| 571 | 3300005563 | Ga0068855_100312338 | Ga0068855_1003123382 | 196 |
| 572 | 3300005564 | Ga0070664_100542670 | Ga0070664_1005426702 | 196 |
| 573 | 3300005577 | Ga0068857_100074563 | Ga0068857_1000745632 | 196 |
| 574 | 3300005578 | Ga0068854_100122597 | Ga0068854_1001225972 | 196 |
| 575 | 3300005614 | Ga0068856_100249706 | Ga0068856_1002497062 | 196 |
| 576 | 3300005616 | Ga0068852_100447299 | Ga0068852_1004472991 | 196 |
| 577 | 3300005616 | Ga0068852_100692450 | Ga0068852_1006924502 | 196 |
| 578 | 3300005617 | Ga0068859_100338953 | Ga0068859_1003389532 | 196 |
| 579 | 3300005719 | Ga0068861_100562730 | Ga0068861_1005627302 | 196 |
| 580 | 3300005841 | Ga0068863_100262860 | Ga0068863_1002628603 | 196 |
| 581 | 3300005842 | Ga0068858_100061945 | Ga0068858_1000619454 | 196 |
| 582 | 3300005842 | Ga0068858_100505572 | Ga0068858_1005055722 | 196 |
| 583 | 3300006028 | Ga0070717_10149604 | Ga0070717_101496043 | 196 |
| 584 | 3300006038 | Ga0075365_10117999 | Ga0075365_101179992 | 196 |
| 585 | 3300006038 | Ga0075365_10153997 | Ga0075365_101539972 | 196 |
| 586 | 3300006042 | Ga0075368_10002832 | Ga0075368_100028323 | 196 |
| 587 | 3300006048 | Ga0075363_100021392 | Ga0075363_1000213925 | 196 |
| 588 | 3300006051 | Ga0075364_10026956 | Ga0075364_100269565 | 196 |
| 589 | 3300006051 | Ga0075364_10198404 | Ga0075364_101984042 | 196 |
| 590 | 3300006173 | Ga0070716_100109247 | Ga0070716_1001092472 | 196 |
| 591 | 3300006173 | Ga0070716_100691892 | Ga0070716_1006918921 | 196 |
| 592 | 3300006178 | Ga0075367_10001143 | Ga0075367_100011438 | 196 |
| 593 | 3300006178 | Ga0075367_10103413 | Ga0075367_101034132 | 196 |
| 594 | 3300006195 | Ga0075366_10185826 | Ga0075366_101858262 | 196 |
| 595 | 3300006353 | Ga0075370_10001011 | Ga0075370_1000101110 | 196 |
| 596 | 3300006353 | Ga0075370_10016339 | Ga0075370_100163393 | 196 |
| 597 | 3300006353 | Ga0075370_10184080 | Ga0075370_101840802 | 196 |
| 598 | 3300006931 | Ga0097620_100338916 | Ga0097620_1003389162 | 196 |
| 599 | 3300007265 | Ga0099794_10062107 | Ga0099794_100621072 | 196 |
| 600 | 3300009093 | Ga0105240_10073391 | Ga0105240_100733912 | 196 |
| 601 | 3300009101 | Ga0105247_10019485 | Ga0105247_100194854 | 196 |
| 602 | 3300009148 | Ga0105243_10088511 | Ga0105243_100885112 | 196 |
| 603 | 3300009545 | Ga0105237_10015388 | Ga0105237_100153887 | 196 |
| 604 | 3300009545 | Ga0105237_10039605 | Ga0105237_100396054 | 196 |
| 605 | 3300009553 | Ga0105249_10950212 | Ga0105249_109502121 | 196 |
| 606 | 3300010375 | Ga0105239_10060340 | Ga0105239_100603403 | 196 |
| 607 | 3300010375 | Ga0105239_10866580 | Ga0105239_108665801 | 196 |
| 608 | 3300010375 | Ga0105239_10869689 | Ga0105239_108696892 | 196 |
| 609 | 3300011119 | Ga0105246_10467604 | Ga0105246_104676041 | 196 |
| 610 | 3300013102 | Ga0157371_10255897 | Ga0157371_102558972 | 196 |
| 611 | 3300013104 | Ga0157370_10225861 | Ga0157370_102258612 | 196 |
| 612 | 3300013105 | Ga0157369_10411964 | Ga0157369_104119642 | 196 |
| 613 | 3300014325 | Ga0163163_10059718 | Ga0163163_100597184 | 196 |
| 614 | 3300014325 | Ga0163163_10619338 | Ga0163163_106193382 | 196 |
| 615 | 3300014969 | Ga0157376_10104262 | Ga0157376_101042622 | 196 |
| 616 | 3300021361 | Ga0213872_10049093 | Ga0213872_100490933 | 196 |
| 617 | 3300025230 | Ga0209563_101338 | Ga0209563_1013386 | 196 |
| 618 | 3300025253 | Ga0209677_101571 | Ga0209677_1015714 | 196 |
| 619 | 3300025273 | Ga0209673_1013588 | Ga0209673_10135884 | 196 |
| 620 | 3300025297 | Ga0209758_1000530 | Ga0209758_100053037 | 196 |
| 621 | 3300025297 | Ga0209758_1034766 | Ga0209758_10347661 | 196 |
| 622 | 3300025302 | Ga0207426_1000429 | Ga0207426_100042928 | 196 |
| 623 | 3300025302 | Ga0207426_1003972 | Ga0207426_10039726 | 196 |
| 624 | 3300025304 | Ga0209257_1021309 | Ga0209257_10213094 | 196 |
| 625 | 3300025304 | Ga0209257_1023725 | Ga0209257_10237252 | 196 |
| 626 | 3300025904 | Ga0207647_10015401 | Ga0207647_100154013 | 196 |
| 627 | 3300025909 | Ga0207705_10068073 | Ga0207705_100680732 | 196 |
| 628 | 3300025914 | Ga0207671_10040633 | Ga0207671_100406333 | 196 |
| 629 | 3300025914 | Ga0207671_10043493 | Ga0207671_100434933 | 196 |
| 630 | 3300025917 | Ga0207660_10258126 | Ga0207660_102581262 | 196 |
| 631 | 3300025919 | Ga0207657_10061869 | Ga0207657_100618693 | 196 |
| 632 | 3300025919 | Ga0207657_10798305 | Ga0207657_107983051 | 196 |
| 633 | 3300025920 | Ga0207649_10519037 | Ga0207649_105190372 | 196 |
| 634 | 3300025924 | Ga0207694_10639544 | Ga0207694_106395442 | 196 |
| 635 | 3300025929 | Ga0207664_10203318 | Ga0207664_102033183 | 196 |
| 636 | 3300025932 | Ga0207690_10181652 | Ga0207690_101816522 | 196 |
| 637 | 3300025932 | Ga0207690_10631081 | Ga0207690_106310812 | 196 |
| 638 | 3300025933 | Ga0207706_10353261 | Ga0207706_103532611 | 196 |
| 639 | 3300025933 | Ga0207706_10443400 | Ga0207706_104434001 | 196 |
| 640 | 3300025944 | Ga0207661_10136863 | Ga0207661_101368632 | 196 |
| 641 | 3300025945 | Ga0207679_10313492 | Ga0207679_103134922 | 196 |
| 642 | 3300025972 | Ga0207668_10119454 | Ga0207668_101194541 | 196 |
| 643 | 3300025986 | Ga0207658_10273022 | Ga0207658_102730222 | 196 |
| 644 | 3300026023 | Ga0207677_10063269 | Ga0207677_100632692 | 196 |
| 645 | 3300026023 | Ga0207677_10409811 | Ga0207677_104098112 | 196 |
| 646 | 3300026035 | Ga0207703_10276738 | Ga0207703_102767382 | 196 |
| 647 | 3300026035 | Ga0207703_10305746 | Ga0207703_103057462 | 196 |
| 648 | 3300026041 | Ga0207639_10261818 | Ga0207639_102618182 | 196 |
| 649 | 3300026067 | Ga0207678_10013371 | Ga0207678_100133714 | 196 |
| 650 | 3300026067 | Ga0207678_10080801 | Ga0207678_100808012 | 196 |
| 651 | 3300026078 | Ga0207702_10215304 | Ga0207702_102153042 | 196 |
| 652 | 3300026078 | Ga0207702_10992317 | Ga0207702_109923172 | 196 |
| 653 | 3300026088 | Ga0207641_10076872 | Ga0207641_100768722 | 196 |
| 654 | 3300026088 | Ga0207641_11191159 | Ga0207641_111911592 | 196 |
| 655 | 3300026089 | Ga0207648_10047082 | Ga0207648_100470823 | 196 |
| 656 | 3300026116 | Ga0207674_10063637 | Ga0207674_100636376 | 196 |
| 657 | 3300026116 | Ga0207674_10546076 | Ga0207674_105460762 | 196 |
| 658 | 3300026121 | Ga0207683_10235765 | Ga0207683_102357652 | 196 |
| 659 | 3300026142 | Ga0207698_10623627 | Ga0207698_106236271 | 196 |
| 660 | 3300026142 | Ga0207698_10885991 | Ga0207698_108859912 | 196 |
| 661 | 3300027296 | Ga0209389_1000134 | Ga0209389_100013425 | 196 |
| 662 | 3300027357 | Ga0209589_1000033 | Ga0209589_100003387 | 196 |
| 663 | 3300027361 | Ga0209489_100040 | Ga0209489_10004063 | 196 |
| 664 | 3300027671 | Ga0209588_1004014 | Ga0209588_10040142 | 196 |
| 665 | 3300027866 | Ga0209813_10131903 | Ga0209813_101319032 | 196 |
| 666 | 3300028379 | Ga0268266_10538096 | Ga0268266_105380962 | 196 |
| 667 | 3300028794 | Ga0307515_10146506 | Ga0307515_101465063 | 196 |
| 668 | 3300031235 | Ga0265330_10004294 | Ga0265330_100042946 | 196 |
| 669 | 3300031235 | Ga0265330_10022396 | Ga0265330_100223964 | 196 |
| 670 | 3300031239 | Ga0265328_10132228 | Ga0265328_101322282 | 196 |
| 671 | 3300031241 | Ga0265325_10012793 | Ga0265325_100127935 | 196 |
| 672 | 3300031247 | Ga0265340_10001084 | Ga0265340_100010849 | 196 |
| 673 | 3300031344 | Ga0265316_10073164 | Ga0265316_100731644 | 196 |
| 674 | 3300031711 | Ga0265314_10046551 | Ga0265314_100465512 | 196 |
| 675 | 3300031712 | Ga0265342_10026217 | Ga0265342_100262174 | 196 |
| 676 | 3300031712 | Ga0265342_10057114 | Ga0265342_100571142 | 196 |
| 677 | 3300033179 | Ga0307507_10269626 | Ga0307507_102696261 | 196 |
| 678 | 3300035117 | Ga0373953_0019930 | Ga0373953_0019930_788_1432 | 196 |
| 679 | 3300035724 | Ga0373933_0404125 | Ga0373933_0404125_54_692 | 196 |
| 680 | 3300035725 | Ga0373947_0047982 | Ga0373947_0047982_951_1589 | 196 |
| 681 | 3300036401 | Ga0373937_0922757 | Ga0373937_0922757_76_714 | 196 |
| 682 | 3300037312 | Ga0395899_0041384 | Ga0395899_0041384_2086_2724 | 196 |
| 683 | 3300037418 | Ga0395900_0186988 | Ga0395900_0186988_617_1255 | 196 |
| 684 | 3300037471 | Ga0395905_0102508 | Ga0395905_0102508_848_1486 | 196 |
| 685 | 3300037853 | Ga0436364_0717928 | Ga0436364_0717928_392_1030 | 196 |
| 686 | 3300037853 | Ga0436364_1277279 | Ga0436364_1277279_63_701 | 196 |
| 687 | 3300038443 | Ga0395901_0051992 | Ga0395901_0051992_2252_2890 | 196 |
| 688 | 3300039437 | Ga0436365_0925272 | Ga0436365_0925272_95_733 | 196 |
| 689 | 3300039447 | Ga0436361_0510643 | Ga0436361_0510643_2260_2898 | 196 |
| 690 | 3300039450 | Ga0436363_1409159 | Ga0436363_1409159_666_1304 | 196 |
| 691 | 3300041452 | Ga0451793_0734750 | Ga0451793_0734750_61_699 | 196 |
| 692 | 3300041491 | Ga0451833_0114762 | Ga0451833_0114762_29_667 | 196 |
| 693 | 3300041498 | Ga0451841_1439108 | Ga0451841_1439108_59_697 | 196 |
| 694 | 3300044658 | Ga0466972_0045878 | Ga0466972_0045878_1099_1737 | 196 |
| 695 | 3300044658 | Ga0466972_0136439 | Ga0466972_0136439_167_805 | 196 |
| 696 | 3300044683 | Ga0466965_0004174 | Ga0466965_0004174_5738_6376 | 196 |
| 697 | 3300044683 | Ga0466965_0113323 | Ga0466965_0113323_433_1071 | 196 |
| 698 | 3300044706 | Ga0466964_0129581 | Ga0466964_0129581_321_959 | 196 |
| 699 | 3300044719 | Ga0466971_0112091 | Ga0466971_0112091_372_1010 | 196 |
| 700 | 3300044735 | Ga0466968_0306567 | Ga0466968_0306567_23_661 | 196 |
| 701 | 3300044901 | Ga0466960_0144541 | Ga0466960_0144541_590_1228 | 196 |
| 702 | 3300044901 | Ga0466960_0328481 | Ga0466960_0328481_16_654 | 196 |
| 703 | 3300045049 | Ga0466959_0051834 | Ga0466959_0051834_2210_2848 | 196 |
| 704 | 3300045976 | Ga0466967_0251988 | Ga0466967_0251988_35_673 | 196 |
| 705 | 3300045976 | Ga0466967_0327055 | Ga0466967_0327055_782_1420 | 196 |
| 706 | 3300046452 | Ga0495617_096947 | Ga0495617_096947_36_674 | 196 |
| 707 | 3300046454 | Ga0495592_0260114 | Ga0495592_0260114_28_666 | 196 |
| 708 | 3300046455 | Ga0495603_0032466 | Ga0495603_0032466_111_749 | 196 |
| 709 | 3300046455 | Ga0495603_0057507 | Ga0495603_0057507_1108_1746 | 196 |
| 710 | 3300046459 | Ga0495629_0026310 | Ga0495629_0026310_2513_3151 | 196 |
| 711 | 3300046460 | Ga0495638_0004210 | Ga0495638_0004210_8660_9298 | 196 |
| 712 | 3300046460 | Ga0495638_0051206 | Ga0495638_0051206_636_1274 | 196 |
| 713 | 3300046460 | Ga0495638_0127108 | Ga0495638_0127108_681_1319 | 196 |
| 714 | 3300046462 | Ga0495651_0023884 | Ga0495651_0023884_2560_3198 | 196 |
| 715 | 3300046463 | Ga0495653_0206827 | Ga0495653_0206827_152_790 | 196 |
| 716 | 3300046477 | Ga0495664_0021307 | Ga0495664_0021307_2023_2661 | 196 |
| 717 | 3300046477 | Ga0495664_0029770 | Ga0495664_0029770_576_1214 | 196 |
| 718 | 3300046477 | Ga0495664_0070298 | Ga0495664_0070298_1336_1974 | 196 |
| 719 | 3300046491 | Ga0495584_0220107 | Ga0495584_0220107_174_812 | 196 |
| 720 | 3300046492 | Ga0495585_0128800 | Ga0495585_0128800_309_947 | 196 |
| 721 | 3300046507 | Ga0495606_0060685 | Ga0495606_0060685_107_745 | 196 |
| 722 | 3300046507 | Ga0495606_0076418 | Ga0495606_0076418_903_1541 | 196 |
| 723 | 3300046507 | Ga0495606_0126528 | Ga0495606_0126528_438_1076 | 196 |
| 724 | 3300046511 | Ga0495608_0069403 | Ga0495608_0069403_1487_2125 | 196 |
| 725 | 3300046514 | Ga0495618_0190725 | Ga0495618_0190725_22_660 | 196 |
| 726 | 3300046515 | Ga0495620_0155146 | Ga0495620_0155146_107_745 | 196 |
| 727 | 3300046516 | Ga0495628_0051823 | Ga0495628_0051823_2477_3115 | 196 |
| 728 | 3300046519 | Ga0495632_0141115 | Ga0495632_0141115_411_1049 | 196 |
| 729 | 3300046522 | Ga0495643_0003266 | Ga0495643_0003266_4256_4894 | 196 |
| 730 | 3300046524 | Ga0495648_0025071 | Ga0495648_0025071_2609_3247 | 196 |
| 731 | 3300046524 | Ga0495648_0054190 | Ga0495648_0054190_1520_2158 | 196 |
| 732 | 3300046524 | Ga0495648_0093359 | Ga0495648_0093359_631_1269 | 196 |
| 733 | 3300046526 | Ga0495666_0225819 | Ga0495666_0225819_186_824 | 196 |
| 734 | 3300046529 | Ga0495652_0008160 | Ga0495652_0008160_4710_5348 | 196 |
| 735 | 3300046529 | Ga0495652_0451840 | Ga0495652_0451840_151_789 | 196 |
| 736 | 3300046530 | Ga0495654_0164218 | Ga0495654_0164218_32_670 | 196 |
| 737 | 3300046533 | Ga0495640_0100149 | Ga0495640_0100149_279_917 | 196 |
| 738 | 3300046536 | Ga0495587_0013619 | Ga0495587_0013619_599_1237 | 196 |
| 739 | 3300046543 | Ga0495645_0002141 | Ga0495645_0002141_6588_7226 | 196 |
| 740 | 3300046543 | Ga0495645_0027111 | Ga0495645_0027111_2038_2676 | 196 |
| 741 | 3300046557 | Ga0495622_0005145 | Ga0495622_0005145_1490_2128 | 196 |
| 742 | 3300046557 | Ga0495622_0008198 | Ga0495622_0008198_3192_3830 | 196 |
| 743 | 3300046559 | Ga0495667_0001954 | Ga0495667_0001954_2608_3246 | 196 |
| 744 | 3300046616 | Ga0495668_0039397 | Ga0495668_0039397_1475_2113 | 196 |
| 745 | 3300046642 | Ga0495634_0027479 | Ga0495634_0027479_1892_2530 | 196 |
| 746 | 3300046648 | Ga0495611_0115048 | Ga0495611_0115048_456_1094 | 196 |
| 747 | 3300046660 | Ga0495625_0093039 | Ga0495625_0093039_475_1113 | 196 |
| 748 | 3300046660 | Ga0495625_0117316 | Ga0495625_0117316_73_711 | 196 |
| 749 | 3300046663 | Ga0495635_0065754 | Ga0495635_0065754_1466_2104 | 196 |
| 750 | 3300046665 | Ga0495661_0051691 | Ga0495661_0051691_1548_2186 | 196 |
| 751 | 3300046674 | Ga0495588_0004633 | Ga0495588_0004633_3403_4041 | 196 |
| 752 | 3300046675 | Ga0495657_0041738 | Ga0495657_0041738_1867_2505 | 196 |
| 753 | 3300046678 | Ga0495599_0009965 | Ga0495599_0009965_1729_2367 | 196 |
| 754 | 3300046679 | Ga0495623_0008391 | Ga0495623_0008391_5849_6487 | 196 |
| 755 | 3300046679 | Ga0495623_0134398 | Ga0495623_0134398_745_1383 | 196 |
| 756 | 3300046692 | Ga0495671_0136054 | Ga0495671_0136054_505_1143 | 196 |
| 757 | 3300046809 | Ga0495600_0196736 | Ga0495600_0196736_483_1121 | 196 |
| 758 | 3300047317 | Ga0495604_0007021 | Ga0495604_0007021_279_917 | 196 |
| 759 | 3300047319 | Ga0495674_0078849 | Ga0495674_0078849_1051_1689 | 196 |
| 760 | 3300047321 | Ga0495676_0232485 | Ga0495676_0232485_574_1212 | 196 |
| 761 | 3300047322 | Ga0495680_0002152 | Ga0495680_0002152_18148_18786 | 196 |
| 762 | 3300047323 | Ga0495683_0052360 | Ga0495683_0052360_315_953 | 196 |
| 763 | 3300047443 | Ga0495687_006711 | Ga0495687_006711_6019_6657 | 196 |
| 764 | 3300047444 | Ga0495675_0013770 | Ga0495675_0013770_142_780 | 196 |
| 765 | 3300047469 | Ga0495673_0025026 | Ga0495673_0025026_1435_2073 | 196 |
| 766 | 3300048088 | Ga0495602_0021077 | Ga0495602_0021077_4450_5088 | 196 |
| 767 | 3300048088 | Ga0495602_0361858 | Ga0495602_0361858_292_930 | 196 |
| 768 | 3300048089 | Ga0495614_0228878 | Ga0495614_0228878_88_726 | 196 |
| 769 | 3300048091 | Ga0495626_0085703 | Ga0495626_0085703_725_1363 | 196 |
| 770 | 3300048903 | Ga0496100_0046258 | Ga0496100_0046258_1390_2028 | 196 |
| 771 | 3300048903 | Ga0496100_0115295 | Ga0496100_0115295_54_692 | 196 |
| 772 | 3300048904 | Ga0496101_0064650 | Ga0496101_0064650_547_1185 | 196 |
| 773 | 3300048904 | Ga0496101_0449642 | Ga0496101_0449642_39_677 | 196 |
| 774 | 3300048905 | Ga0496102_0013546 | Ga0496102_0013546_4911_5549 | 196 |
| 775 | 3300048905 | Ga0496102_0074983 | Ga0496102_0074983_875_1513 | 196 |
| 776 | 3300048906 | Ga0496103_0001419 | Ga0496103_0001419_10113_10751 | 196 |
| 777 | 3300048907 | Ga0496104_0017222 | Ga0496104_0017222_3331_3969 | 196 |
| 778 | 3300048907 | Ga0496104_0076195 | Ga0496104_0076195_279_917 | 196 |
| 779 | 3300048908 | Ga0496105_0043773 | Ga0496105_0043773_612_1250 | 196 |
| 780 | 3300048909 | Ga0496106_0092949 | Ga0496106_0092949_956_1594 | 196 |
| 781 | 3300048910 | Ga0496107_0079034 | Ga0496107_0079034_1468_2106 | 196 |
| 782 | 3300048910 | Ga0496107_0170664 | Ga0496107_0170664_905_1543 | 196 |
| 783 | 3300048911 | Ga0496108_0031684 | Ga0496108_0031684_1611_2249 | 196 |
| 784 | 3300048912 | Ga0496109_0042089 | Ga0496109_0042089_1813_2451 | 196 |
| 785 | 3300048912 | Ga0496109_0467788 | Ga0496109_0467788_273_911 | 196 |
| 786 | 3300048913 | Ga0496110_0017063 | Ga0496110_0017063_2033_2671 | 196 |
| 787 | 3300048914 | Ga0496111_0012540 | Ga0496111_0012540_2786_3424 | 196 |
| 788 | 3300048914 | Ga0496111_0446829 | Ga0496111_0446829_62_700 | 196 |
| 789 | 3300048915 | Ga0496112_0063890 | Ga0496112_0063890_1522_2160 | 196 |
| 790 | 3300048915 | Ga0496112_0510412 | Ga0496112_0510412_438_1076 | 196 |
| 791 | 3300048916 | Ga0496113_0019873 | Ga0496113_0019873_1608_2246 | 196 |
| 792 | 3300048917 | Ga0496114_0543782 | Ga0496114_0543782_306_944 | 196 |
| 793 | 3300048918 | Ga0496115_0076566 | Ga0496115_0076566_1464_2102 | 196 |
| 794 | 3300048919 | Ga0496116_0017881 | Ga0496116_0017881_1005_1643 | 196 |
| 795 | 3300048920 | Ga0496117_0036555 | Ga0496117_0036555_1475_2113 | 196 |
| 796 | 3300048921 | Ga0496118_0050512 | Ga0496118_0050512_1115_1753 | 196 |
| 797 | 3300048921 | Ga0496118_0120363 | Ga0496118_0120363_704_1342 | 196 |
| 798 | 3300048922 | Ga0496119_0012475 | Ga0496119_0012475_5623_6261 | 196 |
| 799 | 3300048922 | Ga0496119_0087263 | Ga0496119_0087263_354_992 | 196 |
| 800 | 3300048923 | Ga0496120_0037387 | Ga0496120_0037387_441_1079 | 196 |
| 801 | 3300048924 | Ga0496121_0037152 | Ga0496121_0037152_781_1419 | 196 |
| 802 | 3300048924 | Ga0496121_0108305 | Ga0496121_0108305_940_1578 | 196 |
| 803 | 3300048924 | Ga0496121_0134436 | Ga0496121_0134436_1055_1693 | 196 |
| 804 | 3300048927 | Ga0496124_0160271 | Ga0496124_0160271_146_784 | 196 |
| 805 | 3300048928 | Ga0496125_0064965 | Ga0496125_0064965_1232_1870 | 196 |
| 806 | 3300048928 | Ga0496125_0085777 | Ga0496125_0085777_294_932 | 196 |
| 807 | 3300048929 | Ga0496126_0047223 | Ga0496126_0047223_1854_2492 | 196 |
| 808 | 3300048929 | Ga0496126_0259762 | Ga0496126_0259762_702_1340 | 196 |
| 809 | 3300048929 | Ga0496126_0362016 | Ga0496126_0362016_60_698 | 196 |
| 810 | 3300049569 | Ga0501032_0020769 | Ga0501032_0020769_2667_3305 | 196 |
| 811 | 3300049570 | Ga0501033_0227030 | Ga0501033_0227030_281_919 | 196 |
| 812 | 3300049571 | Ga0501034_0021647 | Ga0501034_0021647_4210_4848 | 196 |
| 813 | 3300049572 | Ga0501036_0017928 | Ga0501036_0017928_3716_4354 | 196 |
| 814 | 3300049573 | Ga0501037_0138928 | Ga0501037_0138928_438_1076 | 196 |
| 815 | 3300049574 | Ga0501038_0103532 | Ga0501038_0103532_1345_1983 | 196 |
| 816 | 3300049575 | Ga0501039_0769530 | Ga0501039_0769530_25_663 | 196 |
| 817 | 3300049579 | Ga0501043_0041816 | Ga0501043_0041816_2634_3272 | 196 |
| 818 | 3300049580 | Ga0501046_0185966 | Ga0501046_0185966_723_1361 | 196 |
| 819 | 3300049581 | Ga0501047_0102897 | Ga0501047_0102897_1750_2388 | 196 |
| 820 | 3300049586 | Ga0501070_0408029 | Ga0501070_0408029_131_769 | 196 |
| 821 | 3300049589 | Ga0501073_0258633 | Ga0501073_0258633_197_835 | 196 |
| 822 | 3300049744 | Ga0501083_0129674 | Ga0501083_0129674_427_1065 | 196 |
| 823 | 3300049822 | Ga0501035_0124945 | Ga0501035_0124945_368_1006 | 196 |
| 824 | 3300049823 | Ga0501044_0298142 | Ga0501044_0298142_429_1067 | 196 |
| 825 | 3300050491 | nmdc:mga00v17_400694_c1 | nmdc:mga00v17_400694_c1_76_714 | 196 |
| 826 | 3300050491 | nmdc:mga00v17_89033_c1 | nmdc:mga00v17_89033_c1_199_837 | 196 |
| 827 | 3300050492 | nmdc:mga0yw44_101706_c1 | nmdc:mga0yw44_101706_c1_199_837 | 196 |
| 828 | 3300050492 | nmdc:mga0yw44_75092_c1 | nmdc:mga0yw44_75092_c1_334_972 | 196 |
| 829 | 3300050493 | nmdc:mga0k408_85095_c1 | nmdc:mga0k408_85095_c1_1143_1781 | 196 |
| 830 | 3300050494 | nmdc:mga06z11_43720_c1 | nmdc:mga06z11_43720_c1_1577_2215 | 196 |
| 831 | 3300050494 | nmdc:mga06z11_74165_c2 | nmdc:mga06z11_74165_c2_593_1231 | 196 |
| 832 | 3300050495 | nmdc:mga04h51_154717_c1 | nmdc:mga04h51_154717_c1_77_715 | 196 |
| 833 | 3300050496 | nmdc:mga07m45_16335_c2 | nmdc:mga07m45_16335_c2_351_989 | 196 |
| 834 | 3300050496 | nmdc:mga07m45_26528_c1 | nmdc:mga07m45_26528_c1_1747_2385 | 196 |
| 835 | 3300050516 | nmdc:mga0sz30_113942_c1 | nmdc:mga0sz30_113942_c1_42_680 | 196 |
| 836 | 3300050516 | nmdc:mga0sz30_45004_c1 | nmdc:mga0sz30_45004_c1_429_1067 | 196 |
| 837 | 3300050516 | nmdc:mga0sz30_56005_c1 | nmdc:mga0sz30_56005_c1_1012_1650 | 196 |
| 838 | 3300053078 | Ga0495612_0002992 | Ga0495612_0002992_3584_4222 | 196 |
| 839 | 3300053080 | Ga0500635_0059747 | Ga0500635_0059747_212_850 | 196 |
| 840 | 3300053084 | Ga0495595_0077938 | Ga0495595_0077938_47_685 | 196 |
| 841 | 3300053087 | Ga0500643_000319 | Ga0500643_000319_8177_8815 | 196 |
| 842 | 3300053088 | Ga0500644_0010834 | Ga0500644_0010834_600_1238 | 196 |
| 843 | 3300053088 | Ga0500644_0156910 | Ga0500644_0156910_140_778 | 196 |
| 844 | 3300053090 | Ga0500646_0041681 | Ga0500646_0041681_579_1217 | 196 |
| 845 | 3300053091 | Ga0500647_0122682 | Ga0500647_0122682_201_839 | 196 |
| 846 | 3300053092 | Ga0500583_0028724 | Ga0500583_0028724_452_1090 | 196 |
| 847 | 3300053094 | Ga0500566_0001751 | Ga0500566_0001751_4678_5316 | 196 |
| 848 | 3300053096 | Ga0500641_0040581 | Ga0500641_0040581_140_778 | 196 |
| 849 | 3300053098 | Ga0500650_0001020 | Ga0500650_0001020_5150_5788 | 196 |
| 850 | 3300053102 | Ga0500554_090924 | Ga0500554_090924_340_978 | 196 |
| 851 | 3300053103 | Ga0500555_009494 | Ga0500555_009494_1974_2612 | 196 |
| 852 | 3300053105 | Ga0500557_000173 | Ga0500557_000173_10189_10827 | 196 |
| 853 | 3300053109 | Ga0500569_128001 | Ga0500569_128001_165_803 | 196 |
| 854 | 3300053125 | Ga0500618_010338 | Ga0500618_010338_40_678 | 196 |
| 855 | 3300053130 | Ga0500642_0005979 | Ga0500642_0005979_97_735 | 196 |
| 856 | 3300053131 | Ga0500652_030150 | Ga0500652_030150_195_833 | 196 |
| 857 | 3300053134 | Ga0500658_0031793 | Ga0500658_0031793_1171_1809 | 196 |
| 858 | 3300053134 | Ga0500658_0122116 | Ga0500658_0122116_149_787 | 196 |
| 859 | 3300053136 | Ga0500559_0011045 | Ga0500559_0011045_726_1364 | 196 |
| 860 | 3300053139 | Ga0500568_0028856 | Ga0500568_0028856_462_1100 | 196 |
| 861 | 3300053143 | Ga0500579_127838 | Ga0500579_127838_146_784 | 196 |
| 862 | 3300053145 | Ga0500586_000083 | Ga0500586_000083_5750_6388 | 196 |
| 863 | 3300053146 | Ga0500588_0117499 | Ga0500588_0117499_137_775 | 196 |
| 864 | 3300053148 | Ga0500590_015151 | Ga0500590_015151_480_1118 | 196 |
| 865 | 3300053148 | Ga0500590_023107 | Ga0500590_023107_98_736 | 196 |
| 866 | 3300053151 | Ga0500604_0010681 | Ga0500604_0010681_1227_1865 | 196 |
| 867 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_34962_35600 | 196 |
| 868 | 3300053153 | Ga0500616_0019195 | Ga0500616_0019195_746_1384 | 196 |
| 869 | 3300053154 | Ga0500619_001130 | Ga0500619_001130_1572_2210 | 196 |
| 870 | 3300053156 | Ga0500622_0009308 | Ga0500622_0009308_4129_4767 | 196 |
| 871 | 3300053156 | Ga0500622_0011211 | Ga0500622_0011211_3388_4026 | 196 |
| 872 | 3300053161 | Ga0500634_0072918 | Ga0500634_0072918_36_674 | 196 |
| 873 | 3300053162 | Ga0500638_009092 | Ga0500638_009092_1499_2137 | 196 |
| 874 | 3300053177 | Ga0500636_0002288 | Ga0500636_0002288_6899_7537 | 196 |
| 875 | 3300053178 | Ga0500637_0056671 | Ga0500637_0056671_396_1034 | 196 |
| 876 | 3300053737 | Ga0500601_010092 | Ga0500601_010092_249_887 | 196 |
| 877 | 3300061719 | Ga0466962_0047405 | Ga0466962_0047405_866_1504 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar