F484366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 331 | 876 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300048909|Ga0496106_0152726|Ga0496106_0152726_944_1795 |
| Length | 283 |
| Sequence | VVHRARRDEAGAGKGDLEMKTVIRWIGVVLLVAASGAFAAEAGLRLDPAPGRRLDHESLQRGARDFVNYCLTCHSAQYMRYNRLTDLGLNEQQIRDNLMFATDKIGSTMTVAMTKADATAWFGAPPPDLSVEARVRGADWLYSYLNAFYRDEKAPSGWNNLVFPNVAMPHVLWAVQGVNKLVETEYEDREKAEAAWIAAKGLAKLERAADGKYVVKTLAQQTPGSLSPVEYKALVADLVNYLGYMAEPARNQRINAGIAVLIFLGVLFAFAYALKRDYWRDVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 232 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 235 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 240 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 241 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 242 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 245 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 250 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.34 |
| Rhizosphere | 95.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2542722 | 2162886007 | Bacteria | 3487 |
| 2 | JGI24743J22301_10000670 | 3300001991 | Bacteria | 4204 |
| 3 | Ga0065704_10003802 | 3300005289 | Bacteria | 3792 |
| 4 | Ga0065712_10002008 | 3300005290 | Bacteria | 5397 |
| 5 | Ga0065715_10001695 | 3300005293 | Bacteria | 5749 |
| 6 | Ga0065715_10016770 | 3300005293 | Bacteria | 1961 |
| 7 | Ga0065715_10233042 | 3300005293 | Bacteria | 1224 |
| 8 | Ga0065715_10446636 | 3300005293 | Bacteria | 830 |
| 9 | Ga0065707_10142604 | 3300005295 | Bacteria | 1753 |
| 10 | Ga0070658_10110098 | 3300005327 | Bacteria | 2281 |
| 11 | Ga0070658_10219464 | 3300005327 | Bacteria | 1607 |
| 12 | Ga0070676_10000209 | 3300005328 | Bacteria | 24884 |
| 13 | Ga0070676_10000253 | 3300005328 | Bacteria | 23246 |
| 14 | Ga0070676_10054820 | 3300005328 | Bacteria | 2351 |
| 15 | Ga0070676_10086327 | 3300005328 | Bacteria | 1914 |
| 16 | Ga0070676_10137278 | 3300005328 | Bacteria | 1553 |
| 17 | Ga0070676_10501395 | 3300005328 | Bacteria | 862 |
| 18 | Ga0070683_100028011 | 3300005329 | Bacteria | 5087 |
| 19 | Ga0070683_100157463 | 3300005329 | Bacteria | 2154 |
| 20 | Ga0070683_100229543 | 3300005329 | Bacteria | 1765 |
| 21 | Ga0070690_100003569 | 3300005330 | Bacteria | 8537 |
| 22 | Ga0070690_100019760 | 3300005330 | Bacteria | 4096 |
| 23 | Ga0070690_100175169 | 3300005330 | Bacteria | 1479 |
| 24 | Ga0070670_100026783 | 3300005331 | Bacteria | 4959 |
| 25 | Ga0070670_100040265 | 3300005331 | Bacteria | 4019 |
| 26 | Ga0070670_100049505 | 3300005331 | Bacteria | 3613 |
| 27 | Ga0070670_100053429 | 3300005331 | Bacteria | 3469 |
| 28 | Ga0070670_100058515 | 3300005331 | Bacteria | 3308 |
| 29 | Ga0070670_100111365 | 3300005331 | Bacteria | 2359 |
| 30 | Ga0070670_100445016 | 3300005331 | Bacteria | 1148 |
| 31 | Ga0070670_100493933 | 3300005331 | Bacteria | 1088 |
| 32 | Ga0070677_10000328 | 3300005333 | Bacteria | 16612 |
| 33 | Ga0070677_10035804 | 3300005333 | Bacteria | 1927 |
| 34 | Ga0068869_100000066 | 3300005334 | Bacteria | 47457 |
| 35 | Ga0068869_100015982 | 3300005334 | Bacteria | 5051 |
| 36 | Ga0068869_100041944 | 3300005334 | Bacteria | 3278 |
| 37 | Ga0068869_100071189 | 3300005334 | Bacteria | 2574 |
| 38 | Ga0068869_100125751 | 3300005334 | Bacteria | 1966 |
| 39 | Ga0068869_100440178 | 3300005334 | Bacteria | 1079 |
| 40 | Ga0070666_10005215 | 3300005335 | Bacteria | 7957 |
| 41 | Ga0070666_10011040 | 3300005335 | Bacteria | 5661 |
| 42 | Ga0070666_10016139 | 3300005335 | Bacteria | 4772 |
| 43 | Ga0070666_10028634 | 3300005335 | Bacteria | 3656 |
| 44 | Ga0070666_10091534 | 3300005335 | Bacteria | 2089 |
| 45 | Ga0070680_100006224 | 3300005336 | Bacteria | 9055 |
| 46 | Ga0070680_100025860 | 3300005336 | Bacteria | 4694 |
| 47 | Ga0068868_100009045 | 3300005338 | Bacteria | 7150 |
| 48 | Ga0068868_100024910 | 3300005338 | Bacteria | 4544 |
| 49 | Ga0068868_100026954 | 3300005338 | Bacteria | 4381 |
| 50 | Ga0068868_100048068 | 3300005338 | Bacteria | 3346 |
| 51 | Ga0068868_100086487 | 3300005338 | Bacteria | 2520 |
| 52 | Ga0068868_100091901 | 3300005338 | Bacteria | 2445 |
| 53 | Ga0068868_100121103 | 3300005338 | Bacteria | 2134 |
| 54 | Ga0070660_100010354 | 3300005339 | Bacteria | 6588 |
| 55 | Ga0070660_100152343 | 3300005339 | Bacteria | 1859 |
| 56 | Ga0070689_100003075 | 3300005340 | Bacteria | 10993 |
| 57 | Ga0070689_100046367 | 3300005340 | Bacteria | 3349 |
| 58 | Ga0070689_100144075 | 3300005340 | Bacteria | 1918 |
| 59 | Ga0070691_10079199 | 3300005341 | Bacteria | 1606 |
| 60 | Ga0070687_100017773 | 3300005343 | Bacteria | 3278 |
| 61 | Ga0070687_100022003 | 3300005343 | Bacteria | 3007 |
| 62 | Ga0070661_100003414 | 3300005344 | Bacteria | 10969 |
| 63 | Ga0070661_100004272 | 3300005344 | Bacteria | 9853 |
| 64 | Ga0070661_100031240 | 3300005344 | Bacteria | 3849 |
| 65 | Ga0070661_100099154 | 3300005344 | Bacteria | 2164 |
| 66 | Ga0070661_100151788 | 3300005344 | Bacteria | 1751 |
| 67 | Ga0070692_10051933 | 3300005345 | Bacteria | 2134 |
| 68 | Ga0070692_10188557 | 3300005345 | Bacteria | 1200 |
| 69 | Ga0070668_100000817 | 3300005347 | Bacteria | 21469 |
| 70 | Ga0070668_100002086 | 3300005347 | Bacteria | 14617 |
| 71 | Ga0070668_100005793 | 3300005347 | Bacteria | 9164 |
| 72 | Ga0070668_100008912 | 3300005347 | Bacteria | 7449 |
| 73 | Ga0070668_100043437 | 3300005347 | Bacteria | 3447 |
| 74 | Ga0070668_100047104 | 3300005347 | Bacteria | 3313 |
| 75 | Ga0070668_100060269 | 3300005347 | Bacteria | 2938 |
| 76 | Ga0070668_100504260 | 3300005347 | Bacteria | 1048 |
| 77 | Ga0070669_100012967 | 3300005353 | Bacteria | 5921 |
| 78 | Ga0070669_100017596 | 3300005353 | Bacteria | 5098 |
| 79 | Ga0070669_100145976 | 3300005353 | Bacteria | 1828 |
| 80 | Ga0070669_100173853 | 3300005353 | Bacteria | 1681 |
| 81 | Ga0070669_100216942 | 3300005353 | Bacteria | 1511 |
| 82 | Ga0070669_100278533 | 3300005353 | Bacteria | 1339 |
| 83 | Ga0070675_100000831 | 3300005354 | Bacteria | 21825 |
| 84 | Ga0070675_100033312 | 3300005354 | Bacteria | 4176 |
| 85 | Ga0070675_100081135 | 3300005354 | Bacteria | 2705 |
| 86 | Ga0070675_100114564 | 3300005354 | Bacteria | 2284 |
| 87 | Ga0070675_100120696 | 3300005354 | Bacteria | 2227 |
| 88 | Ga0070675_100171980 | 3300005354 | Bacteria | 1868 |
| 89 | Ga0070671_100005474 | 3300005355 | Bacteria | 10130 |
| 90 | Ga0070671_100013306 | 3300005355 | Bacteria | 6633 |
| 91 | Ga0070671_100028879 | 3300005355 | Bacteria | 4570 |
| 92 | Ga0070671_100053436 | 3300005355 | Bacteria | 3358 |
| 93 | Ga0070671_100059696 | 3300005355 | Bacteria | 3174 |
| 94 | Ga0070671_100233563 | 3300005355 | Bacteria | 1561 |
| 95 | Ga0070671_100315787 | 3300005355 | Bacteria | 1331 |
| 96 | Ga0070671_100354965 | 3300005355 | Bacteria | 1252 |
| 97 | Ga0070674_100012630 | 3300005356 | Bacteria | 5191 |
| 98 | Ga0070674_100016927 | 3300005356 | Bacteria | 4575 |
| 99 | Ga0070674_100117767 | 3300005356 | Bacteria | 1962 |
| 100 | Ga0070674_100246006 | 3300005356 | Bacteria | 1403 |
| 101 | Ga0070674_100271509 | 3300005356 | Bacteria | 1340 |
| 102 | Ga0070673_100000413 | 3300005364 | Bacteria | 22545 |
| 103 | Ga0070673_100010128 | 3300005364 | Bacteria | 6365 |
| 104 | Ga0070673_100012723 | 3300005364 | Bacteria | 5788 |
| 105 | Ga0070673_100055309 | 3300005364 | Bacteria | 3126 |
| 106 | Ga0070673_100206106 | 3300005364 | Bacteria | 1696 |
| 107 | Ga0070673_100303291 | 3300005364 | Bacteria | 1407 |
| 108 | Ga0070673_100416057 | 3300005364 | Bacteria | 1204 |
| 109 | Ga0070673_100536363 | 3300005364 | Unclassified | 1062 |
| 110 | Ga0070688_100001381 | 3300005365 | Bacteria | 12063 |
| 111 | Ga0070688_100161482 | 3300005365 | Bacteria | 1540 |
| 112 | Ga0070688_100170794 | 3300005365 | Bacteria | 1500 |
| 113 | Ga0070659_100001024 | 3300005366 | Bacteria | 20502 |
| 114 | Ga0070659_100019972 | 3300005366 | Bacteria | 5086 |
| 115 | Ga0070667_100002478 | 3300005367 | Bacteria | 16112 |
| 116 | Ga0070667_100007387 | 3300005367 | Bacteria | 9126 |
| 117 | Ga0070667_100045307 | 3300005367 | Bacteria | 3697 |
| 118 | Ga0070667_100077085 | 3300005367 | Bacteria | 2846 |
| 119 | Ga0070667_100105466 | 3300005367 | Bacteria | 2439 |
| 120 | Ga0070667_100378482 | 3300005367 | Bacteria | 1285 |
| 121 | Ga0070667_100389000 | 3300005367 | Bacteria | 1268 |
| 122 | Ga0070709_10048079 | 3300005434 | Bacteria | 2660 |
| 123 | Ga0070714_100007228 | 3300005435 | Bacteria | 8623 |
| 124 | Ga0070714_100070272 | 3300005435 | Bacteria | 3026 |
| 125 | Ga0070713_100006522 | 3300005436 | Bacteria | 8102 |
| 126 | Ga0070713_100018888 | 3300005436 | Bacteria | 5248 |
| 127 | Ga0070710_10047733 | 3300005437 | Bacteria | 2389 |
| 128 | Ga0070711_100042907 | 3300005439 | Bacteria | 3060 |
| 129 | Ga0070711_100165423 | 3300005439 | Bacteria | 1681 |
| 130 | Ga0070705_100099259 | 3300005440 | Bacteria | 1834 |
| 131 | Ga0070700_100012772 | 3300005441 | Bacteria | 4701 |
| 132 | Ga0070700_100012956 | 3300005441 | Bacteria | 4674 |
| 133 | Ga0070694_100043441 | 3300005444 | Bacteria | 3005 |
| 134 | Ga0070694_100149410 | 3300005444 | Bacteria | 1705 |
| 135 | Ga0070708_100000226 | 3300005445 | Bacteria | 42003 |
| 136 | Ga0070708_100102612 | 3300005445 | Bacteria | 2621 |
| 137 | Ga0070663_100007890 | 3300005455 | Bacteria | 6514 |
| 138 | Ga0070663_100036009 | 3300005455 | Bacteria | 3437 |
| 139 | Ga0070663_100136139 | 3300005455 | Bacteria | 1870 |
| 140 | Ga0070663_100157130 | 3300005455 | Bacteria | 1748 |
| 141 | Ga0070663_100222956 | 3300005455 | Bacteria | 1481 |
| 142 | Ga0070663_100265503 | 3300005455 | Bacteria | 1363 |
| 143 | Ga0070678_100002430 | 3300005456 | Bacteria | 10211 |
| 144 | Ga0070678_100002693 | 3300005456 | Bacteria | 9797 |
| 145 | Ga0070678_100003724 | 3300005456 | Bacteria | 8534 |
| 146 | Ga0070678_100008098 | 3300005456 | Bacteria | 6276 |
| 147 | Ga0070678_100817332 | 3300005456 | Bacteria | 847 |
| 148 | Ga0070662_100000907 | 3300005457 | Bacteria | 18094 |
| 149 | Ga0070662_100031395 | 3300005457 | Bacteria | 3728 |
| 150 | Ga0070662_100037518 | 3300005457 | Bacteria | 3436 |
| 151 | Ga0070662_100132420 | 3300005457 | Bacteria | 1924 |
| 152 | Ga0070662_100159063 | 3300005457 | Bacteria | 1766 |
| 153 | Ga0070662_100286871 | 3300005457 | Bacteria | 1333 |
| 154 | Ga0070681_10050336 | 3300005458 | Bacteria | 4157 |
| 155 | Ga0070681_10088009 | 3300005458 | Bacteria | 3058 |
| 156 | Ga0070681_10146322 | 3300005458 | Bacteria | 2292 |
| 157 | Ga0068867_100001614 | 3300005459 | Bacteria | 15670 |
| 158 | Ga0068867_100003602 | 3300005459 | Bacteria | 10898 |
| 159 | Ga0068867_100010593 | 3300005459 | Bacteria | 6506 |
| 160 | Ga0068867_100015427 | 3300005459 | Bacteria | 5419 |
| 161 | Ga0068867_100374808 | 3300005459 | Bacteria | 1194 |
| 162 | Ga0070685_10004436 | 3300005466 | Bacteria | 7093 |
| 163 | Ga0070685_10007773 | 3300005466 | Bacteria | 5488 |
| 164 | Ga0070706_100021806 | 3300005467 | Bacteria | 5898 |
| 165 | Ga0070707_100248985 | 3300005468 | Bacteria | 1729 |
| 166 | Ga0070679_100025281 | 3300005530 | Bacteria | 5825 |
| 167 | Ga0070679_100258544 | 3300005530 | Bacteria | 1696 |
| 168 | Ga0070684_100002779 | 3300005535 | Bacteria | 12960 |
| 169 | Ga0070684_100048448 | 3300005535 | Bacteria | 3686 |
| 170 | Ga0070684_100059586 | 3300005535 | Bacteria | 3338 |
| 171 | Ga0070684_100152946 | 3300005535 | Bacteria | 2091 |
| 172 | Ga0070697_100010920 | 3300005536 | Bacteria | 7093 |
| 173 | Ga0070697_100017968 | 3300005536 | Bacteria | 5572 |
| 174 | Ga0068853_100016993 | 3300005539 | Bacteria | 5998 |
| 175 | Ga0068853_100033484 | 3300005539 | Bacteria | 4360 |
| 176 | Ga0068853_100037114 | 3300005539 | Bacteria | 4145 |
| 177 | Ga0068853_100352951 | 3300005539 | Bacteria | 1368 |
| 178 | Ga0068853_100407324 | 3300005539 | Bacteria | 1274 |
| 179 | Ga0070672_100001217 | 3300005543 | Bacteria | 15789 |
| 180 | Ga0070672_100002335 | 3300005543 | Bacteria | 11999 |
| 181 | Ga0070672_100015341 | 3300005543 | Bacteria | 5453 |
| 182 | Ga0070672_100142996 | 3300005543 | Bacteria | 1975 |
| 183 | Ga0070672_100522252 | 3300005543 | Unclassified | 1029 |
| 184 | Ga0070686_100051635 | 3300005544 | Bacteria | 2618 |
| 185 | Ga0070686_100069118 | 3300005544 | Bacteria | 2306 |
| 186 | Ga0070695_100013581 | 3300005545 | Bacteria | 4895 |
| 187 | Ga0070695_100281063 | 3300005545 | Bacteria | 1223 |
| 188 | Ga0070695_100307653 | 3300005545 | Bacteria | 1174 |
| 189 | Ga0070696_100010800 | 3300005546 | Bacteria | 6118 |
| 190 | Ga0070696_100078471 | 3300005546 | Bacteria | 2335 |
| 191 | Ga0070696_100257180 | 3300005546 | Bacteria | 1323 |
| 192 | Ga0070693_100004709 | 3300005547 | Bacteria | 6486 |
| 193 | Ga0070693_100009846 | 3300005547 | Bacteria | 4767 |
| 194 | Ga0070665_100001378 | 3300005548 | Bacteria | 28614 |
| 195 | Ga0070665_100008510 | 3300005548 | Bacteria | 10377 |
| 196 | Ga0070665_100017516 | 3300005548 | Bacteria | 7194 |
| 197 | Ga0070704_100128475 | 3300005549 | Bacteria | 1960 |
| 198 | Ga0070704_100139697 | 3300005549 | Bacteria | 1889 |
| 199 | Ga0068855_100000852 | 3300005563 | Bacteria | 37837 |
| 200 | Ga0068855_100001414 | 3300005563 | Bacteria | 29795 |
| 201 | Ga0068855_100002157 | 3300005563 | Bacteria | 24326 |
| 202 | Ga0070664_100001435 | 3300005564 | Bacteria | 19005 |
| 203 | Ga0070664_100007701 | 3300005564 | Bacteria | 8698 |
| 204 | Ga0070664_100038600 | 3300005564 | Bacteria | 4020 |
| 205 | Ga0070664_100061713 | 3300005564 | Bacteria | 3195 |
| 206 | Ga0068857_100000326 | 3300005577 | Bacteria | 32742 |
| 207 | Ga0068857_100003154 | 3300005577 | Bacteria | 13663 |
| 208 | Ga0068857_100020455 | 3300005577 | Bacteria | 5821 |
| 209 | Ga0068857_100265166 | 3300005577 | Bacteria | 1577 |
| 210 | Ga0068854_100001495 | 3300005578 | Bacteria | 14165 |
| 211 | Ga0068854_100013835 | 3300005578 | Bacteria | 5306 |
| 212 | Ga0068854_100016025 | 3300005578 | Bacteria | 4985 |
| 213 | Ga0068854_100018625 | 3300005578 | Bacteria | 4665 |
| 214 | Ga0068854_100255146 | 3300005578 | Bacteria | 1402 |
| 215 | Ga0068856_100000664 | 3300005614 | Bacteria | 37278 |
| 216 | Ga0068856_100009494 | 3300005614 | Bacteria | 9446 |
| 217 | Ga0068856_100039254 | 3300005614 | Bacteria | 4648 |
| 218 | Ga0068856_100067794 | 3300005614 | Bacteria | 3526 |
| 219 | Ga0068856_100392434 | 3300005614 | Bacteria | 1407 |
| 220 | Ga0070702_100017084 | 3300005615 | Bacteria | 3735 |
| 221 | Ga0070702_100373043 | 3300005615 | Bacteria | 1012 |
| 222 | Ga0068852_100002200 | 3300005616 | Bacteria | 13385 |
| 223 | Ga0068852_100013233 | 3300005616 | Bacteria | 6307 |
| 224 | Ga0068852_100029101 | 3300005616 | Bacteria | 4532 |
| 225 | Ga0068852_100183219 | 3300005616 | Bacteria | 1970 |
| 226 | Ga0068852_100200000 | 3300005616 | Bacteria | 1891 |
| 227 | Ga0068852_100280594 | 3300005616 | Bacteria | 1606 |
| 228 | Ga0068852_100344394 | 3300005616 | Bacteria | 1454 |
| 229 | Ga0068859_100000398 | 3300005617 | Bacteria | 43145 |
| 230 | Ga0068859_100001650 | 3300005617 | Bacteria | 22761 |
| 231 | Ga0068859_100011314 | 3300005617 | Bacteria | 8979 |
| 232 | Ga0068859_100026072 | 3300005617 | Bacteria | 5864 |
| 233 | Ga0068864_100002525 | 3300005618 | Bacteria | 15118 |
| 234 | Ga0068864_100007124 | 3300005618 | Bacteria | 9185 |
| 235 | Ga0068864_100013967 | 3300005618 | Bacteria | 6658 |
| 236 | Ga0068864_100082545 | 3300005618 | Bacteria | 2820 |
| 237 | Ga0068866_10002008 | 3300005718 | Bacteria | 8468 |
| 238 | Ga0068861_100008052 | 3300005719 | Bacteria | 7250 |
| 239 | Ga0068861_100024048 | 3300005719 | Bacteria | 4401 |
| 240 | Ga0068861_100036158 | 3300005719 | Bacteria | 3664 |
| 241 | Ga0068861_100042928 | 3300005719 | Bacteria | 3391 |
| 242 | Ga0068861_100146840 | 3300005719 | Bacteria | 1931 |
| 243 | Ga0068861_100269395 | 3300005719 | Bacteria | 1462 |
| 244 | Ga0068861_100317382 | 3300005719 | Bacteria | 1356 |
| 245 | Ga0068861_100517404 | 3300005719 | Bacteria | 1082 |
| 246 | Ga0068851_10000383 | 3300005834 | Bacteria | 20034 |
| 247 | Ga0068851_10039830 | 3300005834 | Bacteria | 2361 |
| 248 | Ga0068851_10062316 | 3300005834 | Bacteria | 1913 |
| 249 | Ga0068851_10099266 | 3300005834 | Bacteria | 1543 |
| 250 | Ga0068870_10006811 | 3300005840 | Bacteria | 5065 |
| 251 | Ga0068870_10010159 | 3300005840 | Bacteria | 4310 |
| 252 | Ga0068870_10021475 | 3300005840 | Bacteria | 3158 |
| 253 | Ga0068870_10061781 | 3300005840 | Bacteria | 2015 |
| 254 | Ga0068870_10064707 | 3300005840 | Bacteria | 1976 |
| 255 | Ga0068863_100000366 | 3300005841 | Bacteria | 45953 |
| 256 | Ga0068863_100001407 | 3300005841 | Bacteria | 23854 |
| 257 | Ga0068863_100013405 | 3300005841 | Bacteria | 7904 |
| 258 | Ga0068863_100054046 | 3300005841 | Bacteria | 3806 |
| 259 | Ga0068863_100218344 | 3300005841 | Bacteria | 1836 |
| 260 | Ga0068863_100534934 | 3300005841 | Bacteria | 1156 |
| 261 | Ga0068863_100550993 | 3300005841 | Bacteria | 1139 |
| 262 | Ga0068858_100000615 | 3300005842 | Bacteria | 37292 |
| 263 | Ga0068858_100000781 | 3300005842 | Bacteria | 33250 |
| 264 | Ga0068858_100036643 | 3300005842 | Bacteria | 4548 |
| 265 | Ga0068858_100122012 | 3300005842 | Bacteria | 2438 |
| 266 | Ga0068858_100141655 | 3300005842 | Bacteria | 2257 |
| 267 | Ga0068858_100334884 | 3300005842 | Bacteria | 1448 |
| 268 | Ga0068858_100345992 | 3300005842 | Bacteria | 1423 |
| 269 | Ga0068860_100031322 | 3300005843 | Bacteria | 5112 |
| 270 | Ga0068860_100035908 | 3300005843 | Bacteria | 4752 |
| 271 | Ga0068860_100074296 | 3300005843 | Bacteria | 3232 |
| 272 | Ga0068860_100087976 | 3300005843 | Bacteria | 2957 |
| 273 | Ga0068860_100224056 | 3300005843 | Bacteria | 1826 |
| 274 | Ga0068862_100008666 | 3300005844 | Bacteria | 8412 |
| 275 | Ga0068862_100013912 | 3300005844 | Bacteria | 6670 |
| 276 | Ga0068862_100065631 | 3300005844 | Bacteria | 3127 |
| 277 | Ga0068862_100112173 | 3300005844 | Bacteria | 2394 |
| 278 | Ga0068862_100150051 | 3300005844 | Bacteria | 2074 |
| 279 | Ga0068862_100193012 | 3300005844 | Bacteria | 1833 |
| 280 | Ga0070717_10230702 | 3300006028 | Bacteria | 1630 |
| 281 | Ga0070715_10015069 | 3300006163 | Bacteria | 2877 |
| 282 | Ga0070716_100029452 | 3300006173 | Bacteria | 2969 |
| 283 | Ga0070712_100009734 | 3300006175 | Bacteria | 6059 |
| 284 | Ga0070712_100134119 | 3300006175 | Bacteria | 1880 |
| 285 | Ga0097621_100003826 | 3300006237 | Bacteria | 10426 |
| 286 | Ga0097621_100005074 | 3300006237 | Bacteria | 9252 |
| 287 | Ga0097621_100019709 | 3300006237 | Bacteria | 5185 |
| 288 | Ga0097621_100049676 | 3300006237 | Bacteria | 3408 |
| 289 | Ga0097621_100174127 | 3300006237 | Bacteria | 1857 |
| 290 | Ga0097621_100232233 | 3300006237 | Bacteria | 1611 |
| 291 | Ga0068871_100020561 | 3300006358 | Bacteria | 5059 |
| 292 | Ga0068871_100022284 | 3300006358 | Bacteria | 4883 |
| 293 | Ga0068871_100035062 | 3300006358 | Bacteria | 3985 |
| 294 | Ga0068871_100588179 | 3300006358 | Bacteria | 1011 |
| 295 | Ga0075428_100009793 | 3300006844 | Bacteria | 10650 |
| 296 | Ga0075430_100394080 | 3300006846 | Bacteria | 1143 |
| 297 | Ga0075431_100017650 | 3300006847 | Bacteria | 7256 |
| 298 | Ga0075434_100279564 | 3300006871 | Bacteria | 1689 |
| 299 | Ga0068865_100014955 | 3300006881 | Bacteria | 4942 |
| 300 | Ga0068865_100068642 | 3300006881 | Bacteria | 2506 |
| 301 | Ga0068865_100126138 | 3300006881 | Bacteria | 1911 |
| 302 | Ga0068865_100154050 | 3300006881 | Bacteria | 1746 |
| 303 | Ga0097620_100000398 | 3300006931 | Bacteria | 43145 |
| 304 | Ga0097620_100001650 | 3300006931 | Bacteria | 22761 |
| 305 | Ga0097620_100011314 | 3300006931 | Bacteria | 8979 |
| 306 | Ga0097620_100026072 | 3300006931 | Bacteria | 5864 |
| 307 | Ga0075435_100362083 | 3300007076 | Bacteria | 1244 |
| 308 | Ga0075435_100505501 | 3300007076 | Bacteria | 1045 |
| 309 | Ga0105251_10164455 | 3300009011 | Bacteria | 1000 |
| 310 | Ga0105240_10015929 | 3300009093 | Bacteria | 10197 |
| 311 | Ga0105240_10056346 | 3300009093 | Bacteria | 4919 |
| 312 | Ga0111539_10012267 | 3300009094 | Bacteria | 10744 |
| 313 | Ga0111539_10041702 | 3300009094 | Bacteria | 5516 |
| 314 | Ga0111539_10798034 | 3300009094 | Bacteria | 1099 |
| 315 | Ga0105245_10033582 | 3300009098 | Bacteria | 4548 |
| 316 | Ga0105245_10096955 | 3300009098 | Bacteria | 2722 |
| 317 | Ga0105247_10012621 | 3300009101 | Bacteria | 5073 |
| 318 | Ga0105247_10065316 | 3300009101 | Bacteria | 2263 |
| 319 | Ga0114129_10493286 | 3300009147 | Bacteria | 1601 |
| 320 | Ga0114129_10659995 | 3300009147 | Bacteria | 1349 |
| 321 | Ga0105241_10011819 | 3300009174 | Bacteria | 6412 |
| 322 | Ga0105241_10089380 | 3300009174 | Bacteria | 2427 |
| 323 | Ga0105241_10358364 | 3300009174 | Bacteria | 1268 |
| 324 | Ga0105241_10715616 | 3300009174 | Bacteria | 915 |
| 325 | Ga0105242_10013861 | 3300009176 | Bacteria | 6237 |
| 326 | Ga0105242_10126433 | 3300009176 | Bacteria | 2201 |
| 327 | Ga0105242_10768953 | 3300009176 | Bacteria | 950 |
| 328 | Ga0105248_10003381 | 3300009177 | Bacteria | 17733 |
| 329 | Ga0105248_10024842 | 3300009177 | Bacteria | 6661 |
| 330 | Ga0105248_10057815 | 3300009177 | Bacteria | 4354 |
| 331 | Ga0105248_10159694 | 3300009177 | Bacteria | 2543 |
| 332 | Ga0105248_10221761 | 3300009177 | Bacteria | 2128 |
| 333 | Ga0105237_10250278 | 3300009545 | Bacteria | 1774 |
| 334 | Ga0105237_10256046 | 3300009545 | Bacteria | 1752 |
| 335 | Ga0105237_10362532 | 3300009545 | Bacteria | 1454 |
| 336 | Ga0105238_10000556 | 3300009551 | Bacteria | 39015 |
| 337 | Ga0105238_10058562 | 3300009551 | Bacteria | 3860 |
| 338 | Ga0105249_10075642 | 3300009553 | Bacteria | 3119 |
| 339 | Ga0105249_10236167 | 3300009553 | Bacteria | 1805 |
| 340 | Ga0105239_11186336 | 3300010375 | Bacteria | 880 |
| 341 | Ga0157313_1004244 | 3300012503 | Bacteria | 974 |
| 342 | Ga0157373_10005158 | 3300013100 | Bacteria | 9815 |
| 343 | Ga0157373_10054390 | 3300013100 | Bacteria | 2844 |
| 344 | Ga0157371_10001509 | 3300013102 | Bacteria | 24045 |
| 345 | Ga0157371_10091083 | 3300013102 | Bacteria | 2160 |
| 346 | Ga0157371_10156499 | 3300013102 | Bacteria | 1626 |
| 347 | Ga0157371_10453133 | 3300013102 | Bacteria | 943 |
| 348 | Ga0157370_10060029 | 3300013104 | Bacteria | 3612 |
| 349 | Ga0157370_10105890 | 3300013104 | Bacteria | 2632 |
| 350 | Ga0157370_10214273 | 3300013104 | Bacteria | 1784 |
| 351 | Ga0157370_10235754 | 3300013104 | Bacteria | 1693 |
| 352 | Ga0157369_10036084 | 3300013105 | Bacteria | 5419 |
| 353 | Ga0157369_10068515 | 3300013105 | Bacteria | 3812 |
| 354 | Ga0157369_10110699 | 3300013105 | Bacteria | 2919 |
| 355 | Ga0157374_10000460 | 3300013296 | Bacteria | 37061 |
| 356 | Ga0157374_10000652 | 3300013296 | Bacteria | 30624 |
| 357 | Ga0157374_10007334 | 3300013296 | Bacteria | 9404 |
| 358 | Ga0157374_10044664 | 3300013296 | Bacteria | 4095 |
| 359 | Ga0157374_10051984 | 3300013296 | Bacteria | 3814 |
| 360 | Ga0157374_10151285 | 3300013296 | Bacteria | 2256 |
| 361 | Ga0157378_10017983 | 3300013297 | Bacteria | 6205 |
| 362 | Ga0157378_10075050 | 3300013297 | Bacteria | 3043 |
| 363 | Ga0157378_10280144 | 3300013297 | Bacteria | 1607 |
| 364 | Ga0157378_10293937 | 3300013297 | Bacteria | 1570 |
| 365 | Ga0157378_10302991 | 3300013297 | Bacteria | 1547 |
| 366 | Ga0163162_10015881 | 3300013306 | Bacteria | 7358 |
| 367 | Ga0163162_10057423 | 3300013306 | Bacteria | 3920 |
| 368 | Ga0163162_10066621 | 3300013306 | Bacteria | 3650 |
| 369 | Ga0163162_10240711 | 3300013306 | Bacteria | 1940 |
| 370 | Ga0157372_10015144 | 3300013307 | Bacteria | 8253 |
| 371 | Ga0157372_10028920 | 3300013307 | Bacteria | 6047 |
| 372 | Ga0157372_10059945 | 3300013307 | Bacteria | 4258 |
| 373 | Ga0157372_10186556 | 3300013307 | Bacteria | 2402 |
| 374 | Ga0157375_10000922 | 3300013308 | Bacteria | 25513 |
| 375 | Ga0157375_10008960 | 3300013308 | Bacteria | 8756 |
| 376 | Ga0157375_10024378 | 3300013308 | Bacteria | 5598 |
| 377 | Ga0157375_10127459 | 3300013308 | Bacteria | 2662 |
| 378 | Ga0157375_10307387 | 3300013308 | Bacteria | 1750 |
| 379 | Ga0157375_10808022 | 3300013308 | Bacteria | 1086 |
| 380 | Ga0157375_10808616 | 3300013308 | Bacteria | 1086 |
| 381 | Ga0163163_10012877 | 3300014325 | Bacteria | 7637 |
| 382 | Ga0163163_10102090 | 3300014325 | Bacteria | 2891 |
| 383 | Ga0157380_10182686 | 3300014326 | Bacteria | 1844 |
| 384 | Ga0157380_10185317 | 3300014326 | Bacteria | 1833 |
| 385 | Ga0157380_10335601 | 3300014326 | Bacteria | 1408 |
| 386 | Ga0157380_10356854 | 3300014326 | Unclassified | 1370 |
| 387 | Ga0182008_10157950 | 3300014497 | Bacteria | 1140 |
| 388 | Ga0157377_10089189 | 3300014745 | Bacteria | 1817 |
| 389 | Ga0157379_10001318 | 3300014968 | Bacteria | 20255 |
| 390 | Ga0157379_10003843 | 3300014968 | Bacteria | 12803 |
| 391 | Ga0157379_10003993 | 3300014968 | Bacteria | 12576 |
| 392 | Ga0157379_10036140 | 3300014968 | Bacteria | 4405 |
| 393 | Ga0157376_10030581 | 3300014969 | Bacteria | 4301 |
| 394 | Ga0157376_10044611 | 3300014969 | Bacteria | 3645 |
| 395 | Ga0157376_10057257 | 3300014969 | Bacteria | 3259 |
| 396 | Ga0157376_10163303 | 3300014969 | Bacteria | 2021 |
| 397 | Ga0157376_10175518 | 3300014969 | Bacteria | 1954 |
| 398 | Ga0157376_10193816 | 3300014969 | Bacteria | 1865 |
| 399 | Ga0157376_10288006 | 3300014969 | Bacteria | 1550 |
| 400 | Ga0163161_10012517 | 3300017792 | Bacteria | 5890 |
| 401 | Ga0207697_10010060 | 3300025315 | Bacteria | 4062 |
| 402 | Ga0207697_10034268 | 3300025315 | Bacteria | 2078 |
| 403 | Ga0207656_10128849 | 3300025321 | Bacteria | 1184 |
| 404 | Ga0207682_10001544 | 3300025893 | Bacteria | 10577 |
| 405 | Ga0207682_10002336 | 3300025893 | Bacteria | 8551 |
| 406 | Ga0207682_10039663 | 3300025893 | Bacteria | 1916 |
| 407 | Ga0207682_10090778 | 3300025893 | Bacteria | 1324 |
| 408 | Ga0207692_10076306 | 3300025898 | Bacteria | 1780 |
| 409 | Ga0207642_10002936 | 3300025899 | Bacteria | 5336 |
| 410 | Ga0207642_10009668 | 3300025899 | Bacteria | 3365 |
| 411 | Ga0207642_10029981 | 3300025899 | Bacteria | 2260 |
| 412 | Ga0207710_10049544 | 3300025900 | Bacteria | 1882 |
| 413 | Ga0207688_10018407 | 3300025901 | Bacteria | 3801 |
| 414 | Ga0207688_10081412 | 3300025901 | Bacteria | 1849 |
| 415 | Ga0207680_10001232 | 3300025903 | Bacteria | 12087 |
| 416 | Ga0207680_10005392 | 3300025903 | Bacteria | 6110 |
| 417 | Ga0207680_10008165 | 3300025903 | Bacteria | 5129 |
| 418 | Ga0207680_10053415 | 3300025903 | Bacteria | 2425 |
| 419 | Ga0207680_10162479 | 3300025903 | Bacteria | 1499 |
| 420 | Ga0207699_10086441 | 3300025906 | Bacteria | 1958 |
| 421 | Ga0207645_10000197 | 3300025907 | Bacteria | 49246 |
| 422 | Ga0207645_10000209 | 3300025907 | Bacteria | 48175 |
| 423 | Ga0207645_10000283 | 3300025907 | Bacteria | 42259 |
| 424 | Ga0207645_10006292 | 3300025907 | Bacteria | 8534 |
| 425 | Ga0207645_10051958 | 3300025907 | Bacteria | 2619 |
| 426 | Ga0207645_10157111 | 3300025907 | Bacteria | 1486 |
| 427 | Ga0207645_10256083 | 3300025907 | Bacteria | 1159 |
| 428 | Ga0207645_10258553 | 3300025907 | Bacteria | 1153 |
| 429 | Ga0207643_10003271 | 3300025908 | Bacteria | 8750 |
| 430 | Ga0207643_10033446 | 3300025908 | Bacteria | 2877 |
| 431 | Ga0207643_10072236 | 3300025908 | Bacteria | 1987 |
| 432 | Ga0207643_10117100 | 3300025908 | Bacteria | 1575 |
| 433 | Ga0207705_10060403 | 3300025909 | Bacteria | 2738 |
| 434 | Ga0207684_10036155 | 3300025910 | Bacteria | 4192 |
| 435 | Ga0207654_10023310 | 3300025911 | Bacteria | 3314 |
| 436 | Ga0207707_10116986 | 3300025912 | Bacteria | 2330 |
| 437 | Ga0207707_10221171 | 3300025912 | Bacteria | 1648 |
| 438 | Ga0207695_10083819 | 3300025913 | Bacteria | 3220 |
| 439 | Ga0207671_10117016 | 3300025914 | Bacteria | 2034 |
| 440 | Ga0207671_10206525 | 3300025914 | Bacteria | 1535 |
| 441 | Ga0207693_10000364 | 3300025915 | Bacteria | 41420 |
| 442 | Ga0207693_10161475 | 3300025915 | Bacteria | 1763 |
| 443 | Ga0207663_10033753 | 3300025916 | Bacteria | 3052 |
| 444 | Ga0207663_10073440 | 3300025916 | Bacteria | 2214 |
| 445 | Ga0207660_10027395 | 3300025917 | Bacteria | 3888 |
| 446 | Ga0207660_10075921 | 3300025917 | Bacteria | 2456 |
| 447 | Ga0207660_10132305 | 3300025917 | Bacteria | 1900 |
| 448 | Ga0207660_10163495 | 3300025917 | Bacteria | 1719 |
| 449 | Ga0207662_10005532 | 3300025918 | Bacteria | 6748 |
| 450 | Ga0207662_10022887 | 3300025918 | Bacteria | 3586 |
| 451 | Ga0207657_10000469 | 3300025919 | Bacteria | 42688 |
| 452 | Ga0207657_10021361 | 3300025919 | Bacteria | 6094 |
| 453 | Ga0207657_10041205 | 3300025919 | Bacteria | 4085 |
| 454 | Ga0207657_10460832 | 3300025919 | Bacteria | 997 |
| 455 | Ga0207649_10003824 | 3300025920 | Bacteria | 8209 |
| 456 | Ga0207649_10029099 | 3300025920 | Bacteria | 3260 |
| 457 | Ga0207649_10055632 | 3300025920 | Bacteria | 2467 |
| 458 | Ga0207652_10388398 | 3300025921 | Bacteria | 1260 |
| 459 | Ga0207646_10311560 | 3300025922 | Bacteria | 1422 |
| 460 | Ga0207681_10009719 | 3300025923 | Bacteria | 5887 |
| 461 | Ga0207681_10013116 | 3300025923 | Bacteria | 5123 |
| 462 | Ga0207681_10018393 | 3300025923 | Bacteria | 4402 |
| 463 | Ga0207681_10027055 | 3300025923 | Bacteria | 3706 |
| 464 | Ga0207681_10031234 | 3300025923 | Bacteria | 3477 |
| 465 | Ga0207681_10407575 | 3300025923 | Bacteria | 1099 |
| 466 | Ga0207694_10034063 | 3300025924 | Bacteria | 3904 |
| 467 | Ga0207694_10037959 | 3300025924 | Bacteria | 3703 |
| 468 | Ga0207694_10238188 | 3300025924 | Bacteria | 1487 |
| 469 | Ga0207650_10011697 | 3300025925 | Bacteria | 6047 |
| 470 | Ga0207650_10025986 | 3300025925 | Bacteria | 4174 |
| 471 | Ga0207650_10041629 | 3300025925 | Bacteria | 3367 |
| 472 | Ga0207650_10049418 | 3300025925 | Bacteria | 3105 |
| 473 | Ga0207650_10127211 | 3300025925 | Bacteria | 1990 |
| 474 | Ga0207650_10209229 | 3300025925 | Bacteria | 1566 |
| 475 | Ga0207650_10338306 | 3300025925 | Bacteria | 1236 |
| 476 | Ga0207650_10421244 | 3300025925 | Bacteria | 1108 |
| 477 | Ga0207659_10006299 | 3300025926 | Bacteria | 7259 |
| 478 | Ga0207659_10026654 | 3300025926 | Bacteria | 3902 |
| 479 | Ga0207659_10046226 | 3300025926 | Bacteria | 3073 |
| 480 | Ga0207659_10047274 | 3300025926 | Bacteria | 3043 |
| 481 | Ga0207659_10060647 | 3300025926 | Bacteria | 2723 |
| 482 | Ga0207659_10130426 | 3300025926 | Bacteria | 1939 |
| 483 | Ga0207659_10494344 | 3300025926 | Bacteria | 1035 |
| 484 | Ga0207687_10011521 | 3300025927 | Bacteria | 5780 |
| 485 | Ga0207687_10019080 | 3300025927 | Bacteria | 4539 |
| 486 | Ga0207687_10098812 | 3300025927 | Bacteria | 2143 |
| 487 | Ga0207700_10046327 | 3300025928 | Bacteria | 3215 |
| 488 | Ga0207664_10011014 | 3300025929 | Bacteria | 6406 |
| 489 | Ga0207664_10246055 | 3300025929 | Bacteria | 1559 |
| 490 | Ga0207644_10002553 | 3300025931 | Bacteria | 11714 |
| 491 | Ga0207644_10014446 | 3300025931 | Bacteria | 5281 |
| 492 | Ga0207644_10018086 | 3300025931 | Bacteria | 4765 |
| 493 | Ga0207644_10061645 | 3300025931 | Bacteria | 2717 |
| 494 | Ga0207644_10085018 | 3300025931 | Bacteria | 2346 |
| 495 | Ga0207644_10326948 | 3300025931 | Bacteria | 1241 |
| 496 | Ga0207644_10374705 | 3300025931 | Unclassified | 1160 |
| 497 | Ga0207690_10041382 | 3300025932 | Bacteria | 3019 |
| 498 | Ga0207706_10000427 | 3300025933 | Bacteria | 45237 |
| 499 | Ga0207706_10002869 | 3300025933 | Bacteria | 16715 |
| 500 | Ga0207706_10004812 | 3300025933 | Bacteria | 12648 |
| 501 | Ga0207706_10059942 | 3300025933 | Bacteria | 3352 |
| 502 | Ga0207706_10184127 | 3300025933 | Bacteria | 1834 |
| 503 | Ga0207686_10001274 | 3300025934 | Bacteria | 14490 |
| 504 | Ga0207686_10090782 | 3300025934 | Bacteria | 2016 |
| 505 | Ga0207709_10132541 | 3300025935 | Bacteria | 1700 |
| 506 | Ga0207670_10009367 | 3300025936 | Bacteria | 5587 |
| 507 | Ga0207670_10097717 | 3300025936 | Bacteria | 2091 |
| 508 | Ga0207670_10100518 | 3300025936 | Bacteria | 2065 |
| 509 | Ga0207670_10127527 | 3300025936 | Bacteria | 1859 |
| 510 | Ga0207669_10004815 | 3300025937 | Bacteria | 5991 |
| 511 | Ga0207669_10005862 | 3300025937 | Bacteria | 5557 |
| 512 | Ga0207669_10009402 | 3300025937 | Bacteria | 4653 |
| 513 | Ga0207669_10134348 | 3300025937 | Bacteria | 1706 |
| 514 | Ga0207704_10016388 | 3300025938 | Bacteria | 3807 |
| 515 | Ga0207704_10091085 | 3300025938 | Bacteria | 2003 |
| 516 | Ga0207704_10153551 | 3300025938 | Bacteria | 1628 |
| 517 | Ga0207665_10043258 | 3300025939 | Bacteria | 3011 |
| 518 | Ga0207665_10497834 | 3300025939 | Bacteria | 941 |
| 519 | Ga0207691_10000153 | 3300025940 | Bacteria | 64312 |
| 520 | Ga0207691_10000546 | 3300025940 | Bacteria | 37681 |
| 521 | Ga0207691_10000868 | 3300025940 | Bacteria | 30058 |
| 522 | Ga0207691_10011464 | 3300025940 | Bacteria | 8506 |
| 523 | Ga0207691_10043897 | 3300025940 | Bacteria | 4117 |
| 524 | Ga0207691_10092480 | 3300025940 | Bacteria | 2709 |
| 525 | Ga0207691_10127993 | 3300025940 | Bacteria | 2245 |
| 526 | Ga0207711_10000185 | 3300025941 | Bacteria | 66575 |
| 527 | Ga0207711_10050593 | 3300025941 | Bacteria | 3557 |
| 528 | Ga0207711_10052020 | 3300025941 | Bacteria | 3509 |
| 529 | Ga0207689_10000952 | 3300025942 | Bacteria | 27860 |
| 530 | Ga0207689_10001219 | 3300025942 | Bacteria | 24713 |
| 531 | Ga0207689_10042935 | 3300025942 | Bacteria | 3738 |
| 532 | Ga0207689_10115984 | 3300025942 | Bacteria | 2202 |
| 533 | Ga0207689_10158122 | 3300025942 | Bacteria | 1868 |
| 534 | Ga0207689_10183018 | 3300025942 | Bacteria | 1728 |
| 535 | Ga0207661_10020887 | 3300025944 | Bacteria | 4902 |
| 536 | Ga0207661_10474602 | 3300025944 | Bacteria | 1141 |
| 537 | Ga0207679_10007632 | 3300025945 | Bacteria | 6871 |
| 538 | Ga0207679_10124919 | 3300025945 | Bacteria | 2055 |
| 539 | Ga0207667_10021483 | 3300025949 | Bacteria | 7150 |
| 540 | Ga0207667_10038657 | 3300025949 | Bacteria | 5094 |
| 541 | Ga0207667_10539569 | 3300025949 | Bacteria | 1180 |
| 542 | Ga0207651_10001263 | 3300025960 | Bacteria | 11382 |
| 543 | Ga0207651_10014138 | 3300025960 | Bacteria | 4598 |
| 544 | Ga0207651_10048053 | 3300025960 | Bacteria | 2881 |
| 545 | Ga0207651_10089953 | 3300025960 | Bacteria | 2243 |
| 546 | Ga0207651_10206070 | 3300025960 | Bacteria | 1580 |
| 547 | Ga0207668_10001645 | 3300025972 | Bacteria | 13055 |
| 548 | Ga0207668_10005674 | 3300025972 | Bacteria | 7347 |
| 549 | Ga0207668_10023963 | 3300025972 | Bacteria | 3932 |
| 550 | Ga0207668_10024247 | 3300025972 | Bacteria | 3912 |
| 551 | Ga0207668_10079774 | 3300025972 | Bacteria | 2369 |
| 552 | Ga0207668_10169583 | 3300025972 | Bacteria | 1710 |
| 553 | Ga0207668_10247323 | 3300025972 | Bacteria | 1446 |
| 554 | Ga0207668_10310750 | 3300025972 | Bacteria | 1304 |
| 555 | Ga0207640_10099501 | 3300025981 | Bacteria | 2035 |
| 556 | Ga0207658_10006807 | 3300025986 | Bacteria | 7788 |
| 557 | Ga0207658_10013941 | 3300025986 | Bacteria | 5500 |
| 558 | Ga0207658_10016683 | 3300025986 | Bacteria | 5054 |
| 559 | Ga0207658_10021208 | 3300025986 | Bacteria | 4506 |
| 560 | Ga0207658_10036639 | 3300025986 | Bacteria | 3518 |
| 561 | Ga0207658_10053547 | 3300025986 | Bacteria | 2982 |
| 562 | Ga0207658_10095051 | 3300025986 | Bacteria | 2321 |
| 563 | Ga0207658_10151891 | 3300025986 | Bacteria | 1888 |
| 564 | Ga0207658_10361904 | 3300025986 | Bacteria | 1266 |
| 565 | Ga0207677_10000148 | 3300026023 | Bacteria | 56316 |
| 566 | Ga0207677_10012812 | 3300026023 | Bacteria | 4838 |
| 567 | Ga0207677_10036718 | 3300026023 | Bacteria | 3196 |
| 568 | Ga0207677_10049777 | 3300026023 | Bacteria | 2830 |
| 569 | Ga0207677_10087399 | 3300026023 | Bacteria | 2257 |
| 570 | Ga0207703_10001265 | 3300026035 | Bacteria | 23535 |
| 571 | Ga0207703_10001381 | 3300026035 | Bacteria | 22179 |
| 572 | Ga0207703_10031384 | 3300026035 | Bacteria | 4201 |
| 573 | Ga0207639_10058769 | 3300026041 | Bacteria | 2959 |
| 574 | Ga0207639_10102145 | 3300026041 | Bacteria | 2320 |
| 575 | Ga0207639_10232296 | 3300026041 | Bacteria | 1599 |
| 576 | Ga0207678_10001649 | 3300026067 | Bacteria | 20457 |
| 577 | Ga0207678_10063510 | 3300026067 | Bacteria | 3173 |
| 578 | Ga0207678_10156186 | 3300026067 | Bacteria | 1948 |
| 579 | Ga0207678_10192795 | 3300026067 | Bacteria | 1742 |
| 580 | Ga0207708_10021704 | 3300026075 | Bacteria | 4844 |
| 581 | Ga0207708_10075859 | 3300026075 | Bacteria | 2578 |
| 582 | Ga0207702_10021245 | 3300026078 | Bacteria | 5372 |
| 583 | Ga0207702_10096171 | 3300026078 | Bacteria | 2604 |
| 584 | Ga0207702_10191223 | 3300026078 | Bacteria | 1891 |
| 585 | Ga0207702_10620753 | 3300026078 | Bacteria | 1062 |
| 586 | Ga0207641_10002346 | 3300026088 | Bacteria | 17515 |
| 587 | Ga0207641_10031156 | 3300026088 | Bacteria | 4422 |
| 588 | Ga0207641_10314310 | 3300026088 | Bacteria | 1483 |
| 589 | Ga0207641_10362715 | 3300026088 | Bacteria | 1384 |
| 590 | Ga0207648_10000165 | 3300026089 | Bacteria | 68239 |
| 591 | Ga0207648_10000564 | 3300026089 | Bacteria | 41549 |
| 592 | Ga0207648_10006558 | 3300026089 | Bacteria | 11558 |
| 593 | Ga0207648_10011183 | 3300026089 | Bacteria | 8463 |
| 594 | Ga0207648_10195307 | 3300026089 | Bacteria | 1794 |
| 595 | Ga0207648_10315325 | 3300026089 | Bacteria | 1404 |
| 596 | Ga0207676_10000516 | 3300026095 | Bacteria | 32481 |
| 597 | Ga0207676_10003043 | 3300026095 | Bacteria | 11967 |
| 598 | Ga0207676_10016044 | 3300026095 | Bacteria | 5419 |
| 599 | Ga0207676_10017861 | 3300026095 | Bacteria | 5147 |
| 600 | Ga0207676_10092131 | 3300026095 | Bacteria | 2491 |
| 601 | Ga0207674_10000180 | 3300026116 | Bacteria | 77710 |
| 602 | Ga0207674_10005309 | 3300026116 | Bacteria | 15327 |
| 603 | Ga0207674_10010649 | 3300026116 | Bacteria | 10399 |
| 604 | Ga0207674_10026146 | 3300026116 | Bacteria | 6210 |
| 605 | Ga0207674_10068510 | 3300026116 | Bacteria | 3571 |
| 606 | Ga0207674_10212663 | 3300026116 | Bacteria | 1882 |
| 607 | Ga0207675_100001139 | 3300026118 | Bacteria | 26331 |
| 608 | Ga0207675_100010670 | 3300026118 | Bacteria | 8608 |
| 609 | Ga0207675_100028041 | 3300026118 | Bacteria | 5243 |
| 610 | Ga0207675_100041207 | 3300026118 | Bacteria | 4312 |
| 611 | Ga0207675_100229770 | 3300026118 | Bacteria | 1790 |
| 612 | Ga0207675_100507702 | 3300026118 | Bacteria | 1201 |
| 613 | Ga0207675_100578947 | 3300026118 | Bacteria | 1124 |
| 614 | Ga0207683_10000140 | 3300026121 | Bacteria | 59648 |
| 615 | Ga0207683_10000424 | 3300026121 | Bacteria | 39012 |
| 616 | Ga0207683_10001594 | 3300026121 | Bacteria | 20407 |
| 617 | Ga0207683_10019340 | 3300026121 | Bacteria | 5815 |
| 618 | Ga0207698_10014775 | 3300026142 | Bacteria | 5204 |
| 619 | Ga0207698_10028625 | 3300026142 | Bacteria | 3976 |
| 620 | Ga0207698_10052008 | 3300026142 | Bacteria | 3135 |
| 621 | Ga0207698_10090781 | 3300026142 | Bacteria | 2499 |
| 622 | Ga0209996_1010164 | 3300027395 | Bacteria | 1246 |
| 623 | Ga0209982_1001047 | 3300027552 | Bacteria | 3689 |
| 624 | Ga0210002_1002629 | 3300027617 | Bacteria | 2600 |
| 625 | Ga0209983_1004485 | 3300027665 | Bacteria | 2934 |
| 626 | Ga0209971_1011008 | 3300027682 | Bacteria | 2142 |
| 627 | Ga0209998_10000997 | 3300027717 | Bacteria | 7133 |
| 628 | Ga0209998_10033926 | 3300027717 | Bacteria | 1140 |
| 629 | Ga0209974_10000131 | 3300027876 | Bacteria | 22213 |
| 630 | Ga0209974_10014844 | 3300027876 | Bacteria | 2586 |
| 631 | Ga0207428_10032798 | 3300027907 | Bacteria | 4271 |
| 632 | Ga0268266_10011410 | 3300028379 | Bacteria | 7726 |
| 633 | Ga0268266_10014198 | 3300028379 | Bacteria | 6851 |
| 634 | Ga0268266_10023660 | 3300028379 | Bacteria | 5228 |
| 635 | Ga0268266_10212777 | 3300028379 | Bacteria | 1773 |
| 636 | Ga0268266_10397398 | 3300028379 | Bacteria | 1303 |
| 637 | Ga0268266_10444989 | 3300028379 | Bacteria | 1231 |
| 638 | Ga0268265_10011281 | 3300028380 | Bacteria | 6041 |
| 639 | Ga0268265_10051717 | 3300028380 | Bacteria | 3102 |
| 640 | Ga0268265_10063872 | 3300028380 | Bacteria | 2834 |
| 641 | Ga0268265_10139772 | 3300028380 | Bacteria | 2026 |
| 642 | Ga0268265_10237666 | 3300028380 | Bacteria | 1605 |
| 643 | Ga0268264_10016725 | 3300028381 | Bacteria | 6004 |
| 644 | Ga0268264_10023422 | 3300028381 | Bacteria | 5038 |
| 645 | Ga0268264_10042725 | 3300028381 | Bacteria | 3753 |
| 646 | Ga0268264_10085573 | 3300028381 | Bacteria | 2706 |
| 647 | Ga0268264_10091094 | 3300028381 | Bacteria | 2630 |
| 648 | Ga0268264_10115040 | 3300028381 | Bacteria | 2363 |
| 649 | Ga0268264_10221446 | 3300028381 | Bacteria | 1742 |
| 650 | Ga0268264_10769563 | 3300028381 | Bacteria | 960 |
| 651 | Ga0307408_100037433 | 3300031548 | Bacteria | 3417 |
| 652 | Ga0307408_100067534 | 3300031548 | Bacteria | 2630 |
| 653 | Ga0307408_100092217 | 3300031548 | Bacteria | 2289 |
| 654 | Ga0316575_10007155 | 3300031665 | Bacteria | 4038 |
| 655 | Ga0316576_10001231 | 3300031727 | Bacteria | 13538 |
| 656 | Ga0316578_10136017 | 3300031728 | Bacteria | 1479 |
| 657 | Ga0307405_10026034 | 3300031731 | Bacteria | 3368 |
| 658 | Ga0307405_10060768 | 3300031731 | Bacteria | 2386 |
| 659 | Ga0316577_10024660 | 3300031733 | Bacteria | 3344 |
| 660 | Ga0307410_10003221 | 3300031852 | Bacteria | 8143 |
| 661 | Ga0307410_10117281 | 3300031852 | Bacteria | 1935 |
| 662 | Ga0307410_10119550 | 3300031852 | Bacteria | 1919 |
| 663 | Ga0307406_10139376 | 3300031901 | Bacteria | 1714 |
| 664 | Ga0307406_10278024 | 3300031901 | Bacteria | 1275 |
| 665 | Ga0307407_10002261 | 3300031903 | Bacteria | 7453 |
| 666 | Ga0307412_10056231 | 3300031911 | Bacteria | 2621 |
| 667 | Ga0307412_10270832 | 3300031911 | Bacteria | 1329 |
| 668 | Ga0307409_100202424 | 3300031995 | Bacteria | 1777 |
| 669 | Ga0307409_100675557 | 3300031995 | Bacteria | 1029 |
| 670 | Ga0307416_100004746 | 3300032002 | Bacteria | 8246 |
| 671 | Ga0307416_100019536 | 3300032002 | Bacteria | 4807 |
| 672 | Ga0307416_100532369 | 3300032002 | Bacteria | 1245 |
| 673 | Ga0307414_10069926 | 3300032004 | Bacteria | 2526 |
| 674 | Ga0307411_10004725 | 3300032005 | Bacteria | 6581 |
| 675 | Ga0307411_10187275 | 3300032005 | Unclassified | 1577 |
| 676 | Ga0307415_100001525 | 3300032126 | Bacteria | 11110 |
| 677 | Ga0307415_100087669 | 3300032126 | Bacteria | 2243 |
| 678 | Ga0316580_10012483 | 3300032139 | Bacteria | 2589 |
| 679 | Ga0373926_0021960 | 3300035083 | Bacteria | 2213 |
| 680 | Ga0373934_0022660 | 3300035086 | Bacteria | 2423 |
| 681 | Ga0373944_0025428 | 3300035089 | Bacteria | 1742 |
| 682 | Ga0373923_0001887 | 3300035111 | Bacteria | 6250 |
| 683 | Ga0373936_0039651 | 3300035113 | Bacteria | 1885 |
| 684 | Ga0373945_0020967 | 3300035116 | Bacteria | 2241 |
| 685 | Ga0373953_0004046 | 3300035117 | Bacteria | 4635 |
| 686 | Ga0373953_0134942 | 3300035117 | Bacteria | 1054 |
| 687 | Ga0373954_0029877 | 3300035118 | Bacteria | 2512 |
| 688 | Ga0373954_0045276 | 3300035118 | Bacteria | 2055 |
| 689 | Ga0373956_0035695 | 3300035119 | Bacteria | 2193 |
| 690 | Ga0373956_0090797 | 3300035119 | Bacteria | 1409 |
| 691 | Ga0373956_0140489 | 3300035119 | Bacteria | 1133 |
| 692 | Ga0373957_0050449 | 3300035120 | Bacteria | 1590 |
| 693 | Ga0373943_0028812 | 3300035170 | Bacteria | 2619 |
| 694 | Ga0373943_0065306 | 3300035170 | Bacteria | 1829 |
| 695 | Ga0373946_0029589 | 3300035171 | Bacteria | 2181 |
| 696 | Ga0373946_0139510 | 3300035171 | Bacteria | 1122 |
| 697 | Ga0373955_0069459 | 3300035172 | Bacteria | 1965 |
| 698 | Ga0373955_0122088 | 3300035172 | Bacteria | 1515 |
| 699 | Ga0316574_0008699 | 3300035398 | Bacteria | 5648 |
| 700 | Ga0316574_0231361 | 3300035398 | Bacteria | 1183 |
| 701 | Ga0373924_0034191 | 3300035410 | Bacteria | 2056 |
| 702 | Ga0373924_0069981 | 3300035410 | Bacteria | 1479 |
| 703 | Ga0373935_0054301 | 3300035692 | Bacteria | 2550 |
| 704 | Ga0373935_0105404 | 3300035692 | Bacteria | 1864 |
| 705 | Ga0373927_0021090 | 3300035695 | Bacteria | 4270 |
| 706 | Ga0373933_0020614 | 3300035724 | Bacteria | 3738 |
| 707 | Ga0373933_0101208 | 3300035724 | Bacteria | 1788 |
| 708 | Ga0373933_0225655 | 3300035724 | Bacteria | 1203 |
| 709 | Ga0373947_0007437 | 3300035725 | Bacteria | 6342 |
| 710 | Ga0373947_0015049 | 3300035725 | Bacteria | 4440 |
| 711 | Ga0373937_0022393 | 3300036401 | Bacteria | 5681 |
| 712 | Ga0373937_0024846 | 3300036401 | Bacteria | 5407 |
| 713 | Ga0316582_0001521 | 3300036647 | Bacteria | 10257 |
| 714 | Ga0316584_0007945 | 3300036712 | Bacteria | 7278 |
| 715 | Ga0373925_0052073 | 3300037068 | Bacteria | 3058 |
| 716 | Ga0373925_0188313 | 3300037068 | Bacteria | 1636 |
| 717 | Ga0451835_0415084 | 3300041492 | Bacteria | 1726 |
| 718 | Ga0451839_0187655 | 3300041496 | Bacteria | 1866 |
| 719 | Ga0451849_0235764 | 3300041505 | Bacteria | 1188 |
| 720 | Ga0451853_4110621 | 3300041512 | Bacteria | 1316 |
| 721 | Ga0439431_0009468 | 3300041997 | Bacteria | 2201 |
| 722 | Ga0439441_002167 | 3300042001 | Bacteria | 2724 |
| 723 | Ga0439443_000788 | 3300042003 | Bacteria | 3138 |
| 724 | Ga0450920_010731 | 3300042122 | Bacteria | 1701 |
| 725 | Ga0450921_004985 | 3300042123 | Unclassified | 990 |
| 726 | Ga0450923_002143 | 3300042125 | Bacteria | 2774 |
| 727 | Ga0450923_002469 | 3300042125 | Unclassified | 2659 |
| 728 | Ga0450923_006805 | 3300042125 | Bacteria | 1910 |
| 729 | Ga0450894_012969 | 3300042131 | Bacteria | 1092 |
| 730 | Ga0450896_007099 | 3300042133 | Bacteria | 1543 |
| 731 | Ga0439446_0011959 | 3300042156 | Bacteria | 2365 |
| 732 | Ga0450908_003805 | 3300042184 | Bacteria | 2921 |
| 733 | Ga0450908_009783 | 3300042184 | Bacteria | 1776 |
| 734 | Ga0439434_0018924 | 3300042435 | Bacteria | 2064 |
| 735 | Ga0439435_0003569 | 3300042436 | Bacteria | 3253 |
| 736 | Ga0439444_0000470 | 3300042437 | Bacteria | 4505 |
| 737 | Ga0439460_0018015 | 3300042461 | Bacteria | 1898 |
| 738 | Ga0450916_006472 | 3300042530 | Bacteria | 1380 |
| 739 | Ga0450916_021774 | 3300042530 | Bacteria | 885 |
| 740 | Ga0451577_0074025 | 3300042876 | Bacteria | 3038 |
| 741 | Ga0451577_0223359 | 3300042876 | Bacteria | 1702 |
| 742 | Ga0453683_0267674 | 3300044673 | Bacteria | 1090 |
| 743 | Ga0453684_0038752 | 3300044712 | Bacteria | 6506 |
| 744 | Ga0453684_0078214 | 3300044712 | Bacteria | 4140 |
| 745 | Ga0451576_0124578 | 3300045051 | Bacteria | 2685 |
| 746 | Ga0451576_0152462 | 3300045051 | Bacteria | 2410 |
| 747 | Ga0451576_0252978 | 3300045051 | Bacteria | 1841 |
| 748 | Ga0451576_0369481 | 3300045051 | Bacteria | 1503 |
| 749 | Ga0451576_0495449 | 3300045051 | Bacteria | 1283 |
| 750 | Ga0466958_0083951 | 3300045836 | Bacteria | 1964 |
| 751 | Ga0495592_0155456 | 3300046454 | Bacteria | 1578 |
| 752 | Ga0495629_0051508 | 3300046459 | Bacteria | 2881 |
| 753 | Ga0495580_0013205 | 3300046472 | Bacteria | 6317 |
| 754 | Ga0495580_0028562 | 3300046472 | Bacteria | 4054 |
| 755 | Ga0495639_0034852 | 3300046475 | Bacteria | 2251 |
| 756 | Ga0495662_0056511 | 3300046476 | Bacteria | 1895 |
| 757 | Ga0495664_0055457 | 3300046477 | Bacteria | 2358 |
| 758 | Ga0495594_0049798 | 3300046499 | Bacteria | 2303 |
| 759 | Ga0495630_0094643 | 3300046517 | Bacteria | 2258 |
| 760 | Ga0495665_0004127 | 3300046531 | Bacteria | 7831 |
| 761 | Ga0495640_0048466 | 3300046533 | Bacteria | 2936 |
| 762 | Ga0495586_0004535 | 3300046535 | Bacteria | 7422 |
| 763 | Ga0495621_0004535 | 3300046539 | Bacteria | 3918 |
| 764 | Ga0495621_0007655 | 3300046539 | Bacteria | 3207 |
| 765 | Ga0495645_0029848 | 3300046543 | Bacteria | 3970 |
| 766 | Ga0495645_0163142 | 3300046543 | Bacteria | 1539 |
| 767 | Ga0495667_0084333 | 3300046559 | Bacteria | 2063 |
| 768 | Ga0495667_0203949 | 3300046559 | Bacteria | 1265 |
| 769 | Ga0495634_0044052 | 3300046642 | Bacteria | 3022 |
| 770 | Ga0495635_0070908 | 3300046663 | Bacteria | 2388 |
| 771 | Ga0495659_0068201 | 3300046664 | Bacteria | 1328 |
| 772 | Ga0495657_0309684 | 3300046675 | Bacteria | 940 |
| 773 | Ga0495599_0103564 | 3300046678 | Bacteria | 1774 |
| 774 | Ga0495623_0053790 | 3300046679 | Bacteria | 2542 |
| 775 | Ga0495647_0005715 | 3300046681 | Bacteria | 4089 |
| 776 | Ga0495670_0315011 | 3300046691 | Bacteria | 840 |
| 777 | Ga0495604_0107881 | 3300047317 | Bacteria | 2035 |
| 778 | Ga0495674_0245934 | 3300047319 | Bacteria | 1473 |
| 779 | Ga0495684_0007967 | 3300047471 | Bacteria | 8187 |
| 780 | Ga0495684_0144227 | 3300047471 | Bacteria | 1784 |
| 781 | Ga0495593_0094326 | 3300047673 | Bacteria | 1539 |
| 782 | Ga0495614_0023756 | 3300048089 | Bacteria | 2646 |
| 783 | Ga0496101_0067354 | 3300048904 | Bacteria | 2614 |
| 784 | Ga0496101_0130790 | 3300048904 | Bacteria | 1906 |
| 785 | Ga0496101_0283940 | 3300048904 | Bacteria | 1294 |
| 786 | Ga0496101_0369240 | 3300048904 | Bacteria | 1128 |
| 787 | Ga0496101_0403262 | 3300048904 | Bacteria | 1077 |
| 788 | Ga0496102_0003428 | 3300048905 | Bacteria | 13442 |
| 789 | Ga0496102_0084226 | 3300048905 | Bacteria | 2934 |
| 790 | Ga0496103_0024811 | 3300048906 | Bacteria | 3619 |
| 791 | Ga0496103_0187879 | 3300048906 | Bacteria | 1328 |
| 792 | Ga0496104_0022719 | 3300048907 | Bacteria | 5761 |
| 793 | Ga0496104_0292101 | 3300048907 | Bacteria | 1542 |
| 794 | Ga0496104_0390028 | 3300048907 | Bacteria | 1305 |
| 795 | Ga0496105_0002462 | 3300048908 | Bacteria | 13400 |
| 796 | Ga0496105_0004497 | 3300048908 | Bacteria | 10496 |
| 797 | Ga0496105_0378222 | 3300048908 | Bacteria | 1127 |
| 798 | Ga0496106_0041299 | 3300048909 | Bacteria | 3456 |
| 799 | Ga0496106_0063390 | 3300048909 | Bacteria | 2809 |
| 800 | Ga0496106_0152726 | 3300048909 | Bacteria | 1822 |
| 801 | Ga0496106_0479385 | 3300048909 | Bacteria | 999 |
| 802 | Ga0496107_0050601 | 3300048910 | Bacteria | 2995 |
| 803 | Ga0496107_0052403 | 3300048910 | Bacteria | 2943 |
| 804 | Ga0496108_0029077 | 3300048911 | Bacteria | 4575 |
| 805 | Ga0496108_0166049 | 3300048911 | Bacteria | 1909 |
| 806 | Ga0496108_0171966 | 3300048911 | Bacteria | 1875 |
| 807 | Ga0496108_0671792 | 3300048911 | Bacteria | 900 |
| 808 | Ga0496109_0011357 | 3300048912 | Bacteria | 7652 |
| 809 | Ga0496109_0042188 | 3300048912 | Bacteria | 4132 |
| 810 | Ga0496109_0574714 | 3300048912 | Bacteria | 1062 |
| 811 | Ga0496110_0230622 | 3300048913 | Bacteria | 1684 |
| 812 | Ga0496110_0300639 | 3300048913 | Bacteria | 1462 |
| 813 | Ga0496112_0001578 | 3300048915 | Bacteria | 17624 |
| 814 | Ga0496112_0003046 | 3300048915 | Bacteria | 13716 |
| 815 | Ga0496113_0033218 | 3300048916 | Bacteria | 3756 |
| 816 | Ga0496114_0060614 | 3300048917 | Bacteria | 3163 |
| 817 | Ga0496114_0074434 | 3300048917 | Bacteria | 2859 |
| 818 | Ga0496114_0590060 | 3300048917 | Bacteria | 980 |
| 819 | Ga0496115_0038958 | 3300048918 | Bacteria | 3774 |
| 820 | Ga0496115_0191196 | 3300048918 | Bacteria | 1691 |
| 821 | Ga0501031_0050139 | 3300049568 | Bacteria | 2720 |
| 822 | Ga0501031_0188517 | 3300049568 | Bacteria | 1347 |
| 823 | Ga0501032_0072597 | 3300049569 | Bacteria | 2294 |
| 824 | Ga0501036_0004094 | 3300049572 | Bacteria | 11735 |
| 825 | Ga0501036_0412147 | 3300049572 | Bacteria | 1127 |
| 826 | Ga0501038_0081552 | 3300049574 | Bacteria | 2725 |
| 827 | Ga0501039_0010083 | 3300049575 | Bacteria | 7198 |
| 828 | Ga0501039_0311556 | 3300049575 | Bacteria | 1237 |
| 829 | Ga0501040_0085262 | 3300049576 | Bacteria | 2192 |
| 830 | Ga0501040_0096546 | 3300049576 | Bacteria | 2058 |
| 831 | Ga0501040_0125724 | 3300049576 | Bacteria | 1801 |
| 832 | Ga0501041_0128962 | 3300049577 | Bacteria | 1575 |
| 833 | Ga0501042_0335975 | 3300049578 | Bacteria | 1092 |
| 834 | Ga0501042_0438107 | 3300049578 | Bacteria | 947 |
| 835 | Ga0501043_0069312 | 3300049579 | Bacteria | 2770 |
| 836 | Ga0501046_0222958 | 3300049580 | Bacteria | 1395 |
| 837 | Ga0501048_0043892 | 3300049582 | Bacteria | 3198 |
| 838 | Ga0501048_0087933 | 3300049582 | Bacteria | 2192 |
| 839 | Ga0501048_0505887 | 3300049582 | Bacteria | 866 |
| 840 | Ga0501068_0149169 | 3300049584 | Bacteria | 1469 |
| 841 | Ga0501071_0086575 | 3300049587 | Bacteria | 2298 |
| 842 | Ga0501071_0116443 | 3300049587 | Bacteria | 1978 |
| 843 | Ga0501071_0125029 | 3300049587 | Bacteria | 1908 |
| 844 | Ga0501071_0232036 | 3300049587 | Bacteria | 1390 |
| 845 | Ga0501072_0016575 | 3300049588 | Bacteria | 5660 |
| 846 | Ga0501072_0197435 | 3300049588 | Bacteria | 1604 |
| 847 | Ga0501074_0172011 | 3300049590 | Bacteria | 1546 |
| 848 | Ga0501075_0011459 | 3300049591 | Bacteria | 6275 |
| 849 | Ga0501075_0014457 | 3300049591 | Bacteria | 5657 |
| 850 | Ga0501076_0043403 | 3300049592 | Bacteria | 3543 |
| 851 | Ga0501076_0054207 | 3300049592 | Bacteria | 3177 |
| 852 | Ga0501079_0088972 | 3300049741 | Bacteria | 2391 |
| 853 | Ga0501079_0214322 | 3300049741 | Bacteria | 1504 |
| 854 | Ga0501079_0279111 | 3300049741 | Unclassified | 1306 |
| 855 | Ga0501080_0263037 | 3300049742 | Bacteria | 1571 |
| 856 | Ga0501080_0410330 | 3300049742 | Bacteria | 1218 |
| 857 | Ga0501081_0071918 | 3300049743 | Bacteria | 2411 |
| 858 | Ga0501081_0080107 | 3300049743 | Unclassified | 2285 |
| 859 | Ga0501081_0575350 | 3300049743 | Bacteria | 842 |
| 860 | Ga0501035_0099750 | 3300049822 | Bacteria | 2549 |
| 861 | Ga0501035_0688221 | 3300049822 | Bacteria | 826 |
| 862 | Ga0501044_0180693 | 3300049823 | Bacteria | 2077 |
| 863 | Ga0501045_0067108 | 3300049824 | Bacteria | 2634 |
| 864 | Ga0501045_0079481 | 3300049824 | Bacteria | 2418 |
| 865 | Ga0501045_0193611 | 3300049824 | Bacteria | 1515 |
| 866 | nmdc:mga05p37_640621_c1 | 3300050507 | Bacteria | 1192 |
| 867 | nmdc:mga09592_296968_c1 | 3300050508 | Bacteria | 1401 |
| 868 | nmdc:mga06r32_47829_c1 | 3300050510 | Bacteria | 4087 |
| 869 | nmdc:mga0n895_105516_c1 | 3300050512 | Bacteria | 2830 |
| 870 | nmdc:mga0n895_151849_c1 | 3300050512 | Bacteria | 2346 |
| 871 | nmdc:mga0rr50_423107_c1 | 3300050513 | Bacteria | 1127 |
| 872 | Ga0495612_0028286 | 3300053078 | Bacteria | 2257 |
| 873 | Ga0495619_0004965 | 3300053085 | Bacteria | 8451 |
| 874 | Ga0501084_0249868 | 3300054114 | Bacteria | 1497 |
| 875 | Ga0501082_0080058 | 3300060353 | Bacteria | 2819 |
| 876 | Ga0530510_0274501 | 3300061734 | Bacteria | 1258 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100001414 | Ga0068855_1000014145 | 219 |
| 2 | 3300005614 | Ga0068856_100039254 | Ga0068856_1000392544 | 219 |
| 3 | 3300009093 | Ga0105240_10056346 | Ga0105240_100563461 | 219 |
| 4 | 3300009545 | Ga0105237_10256046 | Ga0105237_102560463 | 219 |
| 5 | 3300009551 | Ga0105238_10058562 | Ga0105238_100585623 | 219 |
| 6 | 3300025924 | Ga0207694_10238188 | Ga0207694_102381882 | 219 |
| 7 | 3300025949 | Ga0207667_10038657 | Ga0207667_100386574 | 219 |
| 8 | 3300005445 | Ga0070708_100000226 | Ga0070708_10000022641 | 222 |
| 9 | 3300035171 | Ga0373946_0139510 | Ga0373946_0139510_11_733 | 222 |
| 10 | 3300035398 | Ga0316574_0231361 | Ga0316574_0231361_44_787 | 222 |
| 11 | 3300013102 | Ga0157371_10156499 | Ga0157371_101564992 | 227 |
| 12 | 3300013105 | Ga0157369_10110699 | Ga0157369_101106993 | 227 |
| 13 | 3300013307 | Ga0157372_10015144 | Ga0157372_100151442 | 227 |
| 14 | 3300013104 | Ga0157370_10235754 | Ga0157370_102357542 | 229 |
| 15 | 3300013307 | Ga0157372_10186556 | Ga0157372_101865562 | 229 |
| 16 | 3300014497 | Ga0182008_10157950 | Ga0182008_101579502 | 229 |
| 17 | 3300025917 | Ga0207660_10132305 | Ga0207660_101323052 | 229 |
| 18 | 3300005719 | Ga0068861_100517404 | Ga0068861_1005174042 | 231 |
| 19 | 3300010375 | Ga0105239_11186336 | Ga0105239_111863361 | 232 |
| 20 | 3300026118 | Ga0207675_100507702 | Ga0207675_1005077022 | 233 |
| 21 | 3300032005 | Ga0307411_10187275 | Ga0307411_101872752 | 233 |
| 22 | 3300005329 | Ga0070683_100157463 | Ga0070683_1001574633 | 235 |
| 23 | 3300005331 | Ga0070670_100049505 | Ga0070670_1000495053 | 235 |
| 24 | 3300005331 | Ga0070670_100111365 | Ga0070670_1001113652 | 235 |
| 25 | 3300005344 | Ga0070661_100031240 | Ga0070661_1000312406 | 235 |
| 26 | 3300005578 | Ga0068854_100016025 | Ga0068854_1000160256 | 235 |
| 27 | 3300005616 | Ga0068852_100029101 | Ga0068852_1000291016 | 235 |
| 28 | 3300005834 | Ga0068851_10039830 | Ga0068851_100398302 | 235 |
| 29 | 3300025944 | Ga0207661_10020887 | Ga0207661_100208872 | 235 |
| 30 | 3300026116 | Ga0207674_10068510 | Ga0207674_100685103 | 235 |
| 31 | 3300032002 | Ga0307416_100019536 | Ga0307416_1000195365 | 236 |
| 32 | 3300049743 | Ga0501081_0080107 | Ga0501081_0080107_1562_2272 | 236 |
| 33 | 3300005327 | Ga0070658_10219464 | Ga0070658_102194642 | 237 |
| 34 | 3300005344 | Ga0070661_100151788 | Ga0070661_1001517882 | 237 |
| 35 | 3300025893 | Ga0207682_10039663 | Ga0207682_100396633 | 237 |
| 36 | 3300025933 | Ga0207706_10184127 | Ga0207706_101841272 | 237 |
| 37 | 3300035410 | Ga0373924_0069981 | Ga0373924_0069981_441_1241 | 237 |
| 38 | 3300035725 | Ga0373947_0007437 | Ga0373947_0007437_79_879 | 237 |
| 39 | 3300037068 | Ga0373925_0052073 | Ga0373925_0052073_1038_1838 | 237 |
| 40 | 3300046691 | Ga0495670_0315011 | Ga0495670_0315011_111_824 | 237 |
| 41 | 3300049576 | Ga0501040_0096546 | Ga0501040_0096546_792_1532 | 237 |
| 42 | 3300053078 | Ga0495612_0028286 | Ga0495612_0028286_982_1782 | 237 |
| 43 | 3300005459 | Ga0068867_100003602 | Ga0068867_10000360211 | 239 |
| 44 | 3300005546 | Ga0070696_100078471 | Ga0070696_1000784712 | 239 |
| 45 | 3300005578 | Ga0068854_100255146 | Ga0068854_1002551462 | 239 |
| 46 | 3300005719 | Ga0068861_100008052 | Ga0068861_1000080523 | 239 |
| 47 | 3300005840 | Ga0068870_10021475 | Ga0068870_100214755 | 239 |
| 48 | 3300006881 | Ga0068865_100068642 | Ga0068865_1000686424 | 239 |
| 49 | 3300009094 | Ga0111539_10041702 | Ga0111539_100417025 | 239 |
| 50 | 3300009147 | Ga0114129_10493286 | Ga0114129_104932862 | 239 |
| 51 | 3300025893 | Ga0207682_10090778 | Ga0207682_100907782 | 239 |
| 52 | 3300025899 | Ga0207642_10009668 | Ga0207642_100096683 | 239 |
| 53 | 3300025917 | Ga0207660_10075921 | Ga0207660_100759212 | 239 |
| 54 | 3300025938 | Ga0207704_10091085 | Ga0207704_100910852 | 239 |
| 55 | 3300025940 | Ga0207691_10000868 | Ga0207691_100008686 | 239 |
| 56 | 3300025972 | Ga0207668_10169583 | Ga0207668_101695832 | 239 |
| 57 | 3300025981 | Ga0207640_10099501 | Ga0207640_100995012 | 239 |
| 58 | 3300026075 | Ga0207708_10021704 | Ga0207708_100217042 | 239 |
| 59 | 3300026089 | Ga0207648_10000165 | Ga0207648_1000016539 | 239 |
| 60 | 3300026118 | Ga0207675_100001139 | Ga0207675_1000011392 | 239 |
| 61 | 3300027552 | Ga0209982_1001047 | Ga0209982_10010474 | 239 |
| 62 | 3300050508 | nmdc:mga09592_296968_c1 | nmdc:mga09592_296968_c1_454_1194 | 239 |
| 63 | 3300042123 | Ga0450921_004985 | Ga0450921_004985_22_762 | 240 |
| 64 | 3300009176 | Ga0105242_10768953 | Ga0105242_107689531 | 241 |
| 65 | 3300035398 | Ga0316574_0008699 | Ga0316574_0008699_2541_3266 | 241 |
| 66 | 3300005295 | Ga0065707_10142604 | Ga0065707_101426042 | 242 |
| 67 | 3300005347 | Ga0070668_100002086 | Ga0070668_1000020866 | 242 |
| 68 | 3300005441 | Ga0070700_100012772 | Ga0070700_1000127722 | 242 |
| 69 | 3300005444 | Ga0070694_100149410 | Ga0070694_1001494102 | 242 |
| 70 | 3300005457 | Ga0070662_100037518 | Ga0070662_1000375183 | 242 |
| 71 | 3300005536 | Ga0070697_100017968 | Ga0070697_1000179686 | 242 |
| 72 | 3300005543 | Ga0070672_100015341 | Ga0070672_1000153415 | 242 |
| 73 | 3300005546 | Ga0070696_100257180 | Ga0070696_1002571802 | 242 |
| 74 | 3300005549 | Ga0070704_100128475 | Ga0070704_1001284752 | 242 |
| 75 | 3300005844 | Ga0068862_100013912 | Ga0068862_1000139122 | 242 |
| 76 | 3300025907 | Ga0207645_10000197 | Ga0207645_1000019738 | 242 |
| 77 | 3300025910 | Ga0207684_10036155 | Ga0207684_100361552 | 242 |
| 78 | 3300025920 | Ga0207649_10029099 | Ga0207649_100290993 | 242 |
| 79 | 3300025923 | Ga0207681_10018393 | Ga0207681_100183934 | 242 |
| 80 | 3300025933 | Ga0207706_10000427 | Ga0207706_1000042715 | 242 |
| 81 | 3300026116 | Ga0207674_10212663 | Ga0207674_102126631 | 242 |
| 82 | 3300048911 | Ga0496108_0166049 | Ga0496108_0166049_99_890 | 242 |
| 83 | 3300049587 | Ga0501071_0116443 | Ga0501071_0116443_911_1642 | 242 |
| 84 | 3300049587 | Ga0501071_0125029 | Ga0501071_0125029_82_813 | 242 |
| 85 | 3300049592 | Ga0501076_0043403 | Ga0501076_0043403_594_1325 | 242 |
| 86 | 3300049741 | Ga0501079_0279111 | Ga0501079_0279111_138_869 | 242 |
| 87 | 3300049824 | Ga0501045_0193611 | Ga0501045_0193611_469_1200 | 242 |
| 88 | 3300061734 | Ga0530510_0274501 | Ga0530510_0274501_365_1096 | 242 |
| 89 | 3300005331 | Ga0070670_100445016 | Ga0070670_1004450162 | 243 |
| 90 | 3300005347 | Ga0070668_100047104 | Ga0070668_1000471044 | 243 |
| 91 | 3300005353 | Ga0070669_100278533 | Ga0070669_1002785332 | 243 |
| 92 | 3300005354 | Ga0070675_100171980 | Ga0070675_1001719802 | 243 |
| 93 | 3300006871 | Ga0075434_100279564 | Ga0075434_1002795642 | 243 |
| 94 | 3300007076 | Ga0075435_100362083 | Ga0075435_1003620832 | 243 |
| 95 | 3300013102 | Ga0157371_10453133 | Ga0157371_104531331 | 243 |
| 96 | 3300025903 | Ga0207680_10162479 | Ga0207680_101624792 | 243 |
| 97 | 3300025925 | Ga0207650_10025986 | Ga0207650_100259862 | 243 |
| 98 | 3300025926 | Ga0207659_10046226 | Ga0207659_100462263 | 243 |
| 99 | 3300025936 | Ga0207670_10127527 | Ga0207670_101275272 | 243 |
| 100 | 3300025972 | Ga0207668_10001645 | Ga0207668_100016455 | 243 |
| 101 | 3300041997 | Ga0439431_0009468 | Ga0439431_0009468_834_1565 | 243 |
| 102 | 3300042001 | Ga0439441_002167 | Ga0439441_002167_498_1229 | 243 |
| 103 | 3300042003 | Ga0439443_000788 | Ga0439443_000788_1856_2587 | 243 |
| 104 | 3300042125 | Ga0450923_002143 | Ga0450923_002143_649_1380 | 243 |
| 105 | 3300042133 | Ga0450896_007099 | Ga0450896_007099_713_1444 | 243 |
| 106 | 3300042156 | Ga0439446_0011959 | Ga0439446_0011959_682_1413 | 243 |
| 107 | 3300042184 | Ga0450908_009783 | Ga0450908_009783_269_1000 | 243 |
| 108 | 3300042435 | Ga0439434_0018924 | Ga0439434_0018924_427_1158 | 243 |
| 109 | 3300042436 | Ga0439435_0003569 | Ga0439435_0003569_1081_1812 | 243 |
| 110 | 3300042437 | Ga0439444_0000470 | Ga0439444_0000470_2740_3471 | 243 |
| 111 | 3300042461 | Ga0439460_0018015 | Ga0439460_0018015_583_1314 | 243 |
| 112 | 3300048918 | Ga0496115_0191196 | Ga0496115_0191196_61_852 | 243 |
| 113 | 3300050512 | nmdc:mga0n895_105516_c1 | nmdc:mga0n895_105516_c1_855_1655 | 243 |
| 114 | 3300005327 | Ga0070658_10110098 | Ga0070658_101100982 | 244 |
| 115 | 3300005328 | Ga0070676_10086327 | Ga0070676_100863273 | 244 |
| 116 | 3300005328 | Ga0070676_10137278 | Ga0070676_101372782 | 244 |
| 117 | 3300005329 | Ga0070683_100028011 | Ga0070683_1000280114 | 244 |
| 118 | 3300005331 | Ga0070670_100026783 | Ga0070670_1000267831 | 244 |
| 119 | 3300005334 | Ga0068869_100071189 | Ga0068869_1000711892 | 244 |
| 120 | 3300005334 | Ga0068869_100440178 | Ga0068869_1004401782 | 244 |
| 121 | 3300005335 | Ga0070666_10091534 | Ga0070666_100915342 | 244 |
| 122 | 3300005336 | Ga0070680_100006224 | Ga0070680_1000062245 | 244 |
| 123 | 3300005336 | Ga0070680_100025860 | Ga0070680_1000258602 | 244 |
| 124 | 3300005338 | Ga0068868_100091901 | Ga0068868_1000919012 | 244 |
| 125 | 3300005344 | Ga0070661_100003414 | Ga0070661_10000341411 | 244 |
| 126 | 3300005344 | Ga0070661_100099154 | Ga0070661_1000991542 | 244 |
| 127 | 3300005347 | Ga0070668_100060269 | Ga0070668_1000602692 | 244 |
| 128 | 3300005355 | Ga0070671_100354965 | Ga0070671_1003549652 | 244 |
| 129 | 3300005356 | Ga0070674_100012630 | Ga0070674_1000126304 | 244 |
| 130 | 3300005356 | Ga0070674_100117767 | Ga0070674_1001177673 | 244 |
| 131 | 3300005364 | Ga0070673_100206106 | Ga0070673_1002061062 | 244 |
| 132 | 3300005364 | Ga0070673_100303291 | Ga0070673_1003032912 | 244 |
| 133 | 3300005366 | Ga0070659_100019972 | Ga0070659_1000199729 | 244 |
| 134 | 3300005434 | Ga0070709_10048079 | Ga0070709_100480793 | 244 |
| 135 | 3300005435 | Ga0070714_100007228 | Ga0070714_10000722813 | 244 |
| 136 | 3300005435 | Ga0070714_100070272 | Ga0070714_1000702722 | 244 |
| 137 | 3300005436 | Ga0070713_100018888 | Ga0070713_1000188886 | 244 |
| 138 | 3300005439 | Ga0070711_100165423 | Ga0070711_1001654232 | 244 |
| 139 | 3300005440 | Ga0070705_100099259 | Ga0070705_1000992591 | 244 |
| 140 | 3300005444 | Ga0070694_100043441 | Ga0070694_1000434416 | 244 |
| 141 | 3300005445 | Ga0070708_100102612 | Ga0070708_1001026123 | 244 |
| 142 | 3300005455 | Ga0070663_100136139 | Ga0070663_1001361392 | 244 |
| 143 | 3300005455 | Ga0070663_100222956 | Ga0070663_1002229562 | 244 |
| 144 | 3300005455 | Ga0070663_100265503 | Ga0070663_1002655032 | 244 |
| 145 | 3300005456 | Ga0070678_100002693 | Ga0070678_1000026937 | 244 |
| 146 | 3300005457 | Ga0070662_100031395 | Ga0070662_1000313953 | 244 |
| 147 | 3300005457 | Ga0070662_100132420 | Ga0070662_1001324202 | 244 |
| 148 | 3300005457 | Ga0070662_100159063 | Ga0070662_1001590632 | 244 |
| 149 | 3300005458 | Ga0070681_10088009 | Ga0070681_100880093 | 244 |
| 150 | 3300005458 | Ga0070681_10146322 | Ga0070681_101463221 | 244 |
| 151 | 3300005459 | Ga0068867_100374808 | Ga0068867_1003748081 | 244 |
| 152 | 3300005467 | Ga0070706_100021806 | Ga0070706_1000218064 | 244 |
| 153 | 3300005468 | Ga0070707_100248985 | Ga0070707_1002489851 | 244 |
| 154 | 3300005530 | Ga0070679_100025281 | Ga0070679_1000252811 | 244 |
| 155 | 3300005535 | Ga0070684_100002779 | Ga0070684_10000277916 | 244 |
| 156 | 3300005535 | Ga0070684_100059586 | Ga0070684_1000595862 | 244 |
| 157 | 3300005536 | Ga0070697_100010920 | Ga0070697_1000109206 | 244 |
| 158 | 3300005539 | Ga0068853_100037114 | Ga0068853_1000371143 | 244 |
| 159 | 3300005543 | Ga0070672_100522252 | Ga0070672_1005222521 | 244 |
| 160 | 3300005545 | Ga0070695_100013581 | Ga0070695_1000135815 | 244 |
| 161 | 3300005546 | Ga0070696_100010800 | Ga0070696_1000108004 | 244 |
| 162 | 3300005547 | Ga0070693_100004709 | Ga0070693_1000047095 | 244 |
| 163 | 3300005547 | Ga0070693_100009846 | Ga0070693_1000098461 | 244 |
| 164 | 3300005549 | Ga0070704_100139697 | Ga0070704_1001396972 | 244 |
| 165 | 3300005563 | Ga0068855_100002157 | Ga0068855_1000021575 | 244 |
| 166 | 3300005564 | Ga0070664_100001435 | Ga0070664_1000014356 | 244 |
| 167 | 3300005564 | Ga0070664_100038600 | Ga0070664_1000386002 | 244 |
| 168 | 3300005577 | Ga0068857_100000326 | Ga0068857_10000032622 | 244 |
| 169 | 3300005577 | Ga0068857_100265166 | Ga0068857_1002651662 | 244 |
| 170 | 3300005578 | Ga0068854_100001495 | Ga0068854_10000149518 | 244 |
| 171 | 3300005578 | Ga0068854_100018625 | Ga0068854_1000186256 | 244 |
| 172 | 3300005614 | Ga0068856_100009494 | Ga0068856_1000094945 | 244 |
| 173 | 3300005614 | Ga0068856_100392434 | Ga0068856_1003924341 | 244 |
| 174 | 3300005615 | Ga0070702_100373043 | Ga0070702_1003730431 | 244 |
| 175 | 3300005616 | Ga0068852_100183219 | Ga0068852_1001832192 | 244 |
| 176 | 3300005618 | Ga0068864_100082545 | Ga0068864_1000825452 | 244 |
| 177 | 3300005718 | Ga0068866_10002008 | Ga0068866_1000200811 | 244 |
| 178 | 3300005719 | Ga0068861_100146840 | Ga0068861_1001468402 | 244 |
| 179 | 3300005843 | Ga0068860_100074296 | Ga0068860_1000742962 | 244 |
| 180 | 3300005843 | Ga0068860_100224056 | Ga0068860_1002240562 | 244 |
| 181 | 3300005844 | Ga0068862_100112173 | Ga0068862_1001121732 | 244 |
| 182 | 3300006028 | Ga0070717_10230702 | Ga0070717_102307022 | 244 |
| 183 | 3300006163 | Ga0070715_10015069 | Ga0070715_100150693 | 244 |
| 184 | 3300006173 | Ga0070716_100029452 | Ga0070716_1000294523 | 244 |
| 185 | 3300006175 | Ga0070712_100134119 | Ga0070712_1001341191 | 244 |
| 186 | 3300006237 | Ga0097621_100019709 | Ga0097621_1000197094 | 244 |
| 187 | 3300006358 | Ga0068871_100022284 | Ga0068871_1000222845 | 244 |
| 188 | 3300009093 | Ga0105240_10015929 | Ga0105240_100159295 | 244 |
| 189 | 3300009098 | Ga0105245_10033582 | Ga0105245_100335822 | 244 |
| 190 | 3300009174 | Ga0105241_10011819 | Ga0105241_100118192 | 244 |
| 191 | 3300009174 | Ga0105241_10089380 | Ga0105241_100893803 | 244 |
| 192 | 3300009174 | Ga0105241_10358364 | Ga0105241_103583641 | 244 |
| 193 | 3300009176 | Ga0105242_10013861 | Ga0105242_100138617 | 244 |
| 194 | 3300009177 | Ga0105248_10221761 | Ga0105248_102217612 | 244 |
| 195 | 3300009545 | Ga0105237_10250278 | Ga0105237_102502782 | 244 |
| 196 | 3300009545 | Ga0105237_10362532 | Ga0105237_103625322 | 244 |
| 197 | 3300009551 | Ga0105238_10000556 | Ga0105238_1000055646 | 244 |
| 198 | 3300012503 | Ga0157313_1004244 | Ga0157313_10042442 | 244 |
| 199 | 3300013100 | Ga0157373_10054390 | Ga0157373_100543903 | 244 |
| 200 | 3300013102 | Ga0157371_10091083 | Ga0157371_100910832 | 244 |
| 201 | 3300013104 | Ga0157370_10105890 | Ga0157370_101058904 | 244 |
| 202 | 3300013104 | Ga0157370_10214273 | Ga0157370_102142732 | 244 |
| 203 | 3300013105 | Ga0157369_10036084 | Ga0157369_100360843 | 244 |
| 204 | 3300013296 | Ga0157374_10051984 | Ga0157374_100519842 | 244 |
| 205 | 3300013297 | Ga0157378_10017983 | Ga0157378_100179837 | 244 |
| 206 | 3300013306 | Ga0163162_10066621 | Ga0163162_100666214 | 244 |
| 207 | 3300013307 | Ga0157372_10028920 | Ga0157372_100289205 | 244 |
| 208 | 3300013308 | Ga0157375_10307387 | Ga0157375_103073872 | 244 |
| 209 | 3300013308 | Ga0157375_10808616 | Ga0157375_108086162 | 244 |
| 210 | 3300014969 | Ga0157376_10057257 | Ga0157376_100572573 | 244 |
| 211 | 3300025899 | Ga0207642_10002936 | Ga0207642_100029364 | 244 |
| 212 | 3300025906 | Ga0207699_10086441 | Ga0207699_100864412 | 244 |
| 213 | 3300025907 | Ga0207645_10051958 | Ga0207645_100519582 | 244 |
| 214 | 3300025907 | Ga0207645_10157111 | Ga0207645_101571112 | 244 |
| 215 | 3300025909 | Ga0207705_10060403 | Ga0207705_100604034 | 244 |
| 216 | 3300025911 | Ga0207654_10023310 | Ga0207654_100233105 | 244 |
| 217 | 3300025912 | Ga0207707_10221171 | Ga0207707_102211712 | 244 |
| 218 | 3300025913 | Ga0207695_10083819 | Ga0207695_100838192 | 244 |
| 219 | 3300025914 | Ga0207671_10117016 | Ga0207671_101170162 | 244 |
| 220 | 3300025914 | Ga0207671_10206525 | Ga0207671_102065252 | 244 |
| 221 | 3300025915 | Ga0207693_10161475 | Ga0207693_101614751 | 244 |
| 222 | 3300025917 | Ga0207660_10027395 | Ga0207660_100273952 | 244 |
| 223 | 3300025917 | Ga0207660_10163495 | Ga0207660_101634952 | 244 |
| 224 | 3300025919 | Ga0207657_10000469 | Ga0207657_1000046913 | 244 |
| 225 | 3300025919 | Ga0207657_10041205 | Ga0207657_100412052 | 244 |
| 226 | 3300025919 | Ga0207657_10460832 | Ga0207657_104608321 | 244 |
| 227 | 3300025920 | Ga0207649_10003824 | Ga0207649_100038245 | 244 |
| 228 | 3300025920 | Ga0207649_10055632 | Ga0207649_100556322 | 244 |
| 229 | 3300025921 | Ga0207652_10388398 | Ga0207652_103883982 | 244 |
| 230 | 3300025922 | Ga0207646_10311560 | Ga0207646_103115602 | 244 |
| 231 | 3300025923 | Ga0207681_10027055 | Ga0207681_100270552 | 244 |
| 232 | 3300025924 | Ga0207694_10034063 | Ga0207694_100340632 | 244 |
| 233 | 3300025924 | Ga0207694_10037959 | Ga0207694_100379596 | 244 |
| 234 | 3300025925 | Ga0207650_10127211 | Ga0207650_101272111 | 244 |
| 235 | 3300025926 | Ga0207659_10130426 | Ga0207659_101304263 | 244 |
| 236 | 3300025927 | Ga0207687_10019080 | Ga0207687_100190805 | 244 |
| 237 | 3300025929 | Ga0207664_10011014 | Ga0207664_100110146 | 244 |
| 238 | 3300025931 | Ga0207644_10014446 | Ga0207644_100144463 | 244 |
| 239 | 3300025932 | Ga0207690_10041382 | Ga0207690_100413823 | 244 |
| 240 | 3300025933 | Ga0207706_10002869 | Ga0207706_100028696 | 244 |
| 241 | 3300025933 | Ga0207706_10059942 | Ga0207706_100599423 | 244 |
| 242 | 3300025934 | Ga0207686_10001274 | Ga0207686_1000127416 | 244 |
| 243 | 3300025937 | Ga0207669_10005862 | Ga0207669_100058625 | 244 |
| 244 | 3300025937 | Ga0207669_10134348 | Ga0207669_101343483 | 244 |
| 245 | 3300025939 | Ga0207665_10043258 | Ga0207665_100432582 | 244 |
| 246 | 3300025942 | Ga0207689_10042935 | Ga0207689_100429354 | 244 |
| 247 | 3300025944 | Ga0207661_10474602 | Ga0207661_104746022 | 244 |
| 248 | 3300025945 | Ga0207679_10007632 | Ga0207679_100076324 | 244 |
| 249 | 3300025949 | Ga0207667_10021483 | Ga0207667_100214834 | 244 |
| 250 | 3300025960 | Ga0207651_10089953 | Ga0207651_100899533 | 244 |
| 251 | 3300026023 | Ga0207677_10012812 | Ga0207677_100128125 | 244 |
| 252 | 3300026041 | Ga0207639_10102145 | Ga0207639_101021452 | 244 |
| 253 | 3300026041 | Ga0207639_10232296 | Ga0207639_102322962 | 244 |
| 254 | 3300026067 | Ga0207678_10192795 | Ga0207678_101927952 | 244 |
| 255 | 3300026078 | Ga0207702_10021245 | Ga0207702_100212455 | 244 |
| 256 | 3300026078 | Ga0207702_10191223 | Ga0207702_101912233 | 244 |
| 257 | 3300026078 | Ga0207702_10620753 | Ga0207702_106207531 | 244 |
| 258 | 3300026089 | Ga0207648_10195307 | Ga0207648_101953071 | 244 |
| 259 | 3300026116 | Ga0207674_10000180 | Ga0207674_1000018019 | 244 |
| 260 | 3300026116 | Ga0207674_10005309 | Ga0207674_1000530918 | 244 |
| 261 | 3300026118 | Ga0207675_100028041 | Ga0207675_1000280413 | 244 |
| 262 | 3300026142 | Ga0207698_10014775 | Ga0207698_100147759 | 244 |
| 263 | 3300028379 | Ga0268266_10397398 | Ga0268266_103973982 | 244 |
| 264 | 3300028380 | Ga0268265_10051717 | Ga0268265_100517173 | 244 |
| 265 | 3300028381 | Ga0268264_10042725 | Ga0268264_100427257 | 244 |
| 266 | 3300028381 | Ga0268264_10221446 | Ga0268264_102214462 | 244 |
| 267 | 3300035083 | Ga0373926_0021960 | Ga0373926_0021960_516_1313 | 244 |
| 268 | 3300035089 | Ga0373944_0025428 | Ga0373944_0025428_868_1665 | 244 |
| 269 | 3300035118 | Ga0373954_0045276 | Ga0373954_0045276_721_1518 | 244 |
| 270 | 3300035119 | Ga0373956_0140489 | Ga0373956_0140489_306_1103 | 244 |
| 271 | 3300035170 | Ga0373943_0065306 | Ga0373943_0065306_549_1346 | 244 |
| 272 | 3300035171 | Ga0373946_0029589 | Ga0373946_0029589_1214_2011 | 244 |
| 273 | 3300035172 | Ga0373955_0122088 | Ga0373955_0122088_412_1209 | 244 |
| 274 | 3300035410 | Ga0373924_0034191 | Ga0373924_0034191_598_1395 | 244 |
| 275 | 3300035692 | Ga0373935_0105404 | Ga0373935_0105404_991_1788 | 244 |
| 276 | 3300035695 | Ga0373927_0021090 | Ga0373927_0021090_3016_3813 | 244 |
| 277 | 3300035724 | Ga0373933_0225655 | Ga0373933_0225655_338_1135 | 244 |
| 278 | 3300036401 | Ga0373937_0022393 | Ga0373937_0022393_4550_5347 | 244 |
| 279 | 3300037068 | Ga0373925_0188313 | Ga0373925_0188313_637_1434 | 244 |
| 280 | 3300041496 | Ga0451839_0187655 | Ga0451839_0187655_732_1529 | 244 |
| 281 | 3300041505 | Ga0451849_0235764 | Ga0451849_0235764_242_1039 | 244 |
| 282 | 3300046459 | Ga0495629_0051508 | Ga0495629_0051508_1449_2246 | 244 |
| 283 | 3300046472 | Ga0495580_0013205 | Ga0495580_0013205_1805_2602 | 244 |
| 284 | 3300046475 | Ga0495639_0034852 | Ga0495639_0034852_744_1541 | 244 |
| 285 | 3300046476 | Ga0495662_0056511 | Ga0495662_0056511_912_1709 | 244 |
| 286 | 3300046477 | Ga0495664_0055457 | Ga0495664_0055457_1313_2110 | 244 |
| 287 | 3300046499 | Ga0495594_0049798 | Ga0495594_0049798_912_1709 | 244 |
| 288 | 3300046517 | Ga0495630_0094643 | Ga0495630_0094643_980_1777 | 244 |
| 289 | 3300046531 | Ga0495665_0004127 | Ga0495665_0004127_1698_2495 | 244 |
| 290 | 3300046539 | Ga0495621_0004535 | Ga0495621_0004535_1792_2589 | 244 |
| 291 | 3300046543 | Ga0495645_0029848 | Ga0495645_0029848_238_1035 | 244 |
| 292 | 3300046559 | Ga0495667_0084333 | Ga0495667_0084333_857_1654 | 244 |
| 293 | 3300046642 | Ga0495634_0044052 | Ga0495634_0044052_1608_2405 | 244 |
| 294 | 3300046663 | Ga0495635_0070908 | Ga0495635_0070908_714_1511 | 244 |
| 295 | 3300046664 | Ga0495659_0068201 | Ga0495659_0068201_33_830 | 244 |
| 296 | 3300046675 | Ga0495657_0309684 | Ga0495657_0309684_100_897 | 244 |
| 297 | 3300046681 | Ga0495647_0005715 | Ga0495647_0005715_2380_3177 | 244 |
| 298 | 3300047319 | Ga0495674_0245934 | Ga0495674_0245934_448_1245 | 244 |
| 299 | 3300047471 | Ga0495684_0007967 | Ga0495684_0007967_6549_7346 | 244 |
| 300 | 3300047673 | Ga0495593_0094326 | Ga0495593_0094326_119_916 | 244 |
| 301 | 3300048089 | Ga0495614_0023756 | Ga0495614_0023756_1392_2189 | 244 |
| 302 | 3300048904 | Ga0496101_0369240 | Ga0496101_0369240_12_806 | 244 |
| 303 | 3300048904 | Ga0496101_0403262 | Ga0496101_0403262_179_976 | 244 |
| 304 | 3300048905 | Ga0496102_0003428 | Ga0496102_0003428_5913_6707 | 244 |
| 305 | 3300048905 | Ga0496102_0084226 | Ga0496102_0084226_648_1445 | 244 |
| 306 | 3300048906 | Ga0496103_0187879 | Ga0496103_0187879_323_1120 | 244 |
| 307 | 3300048910 | Ga0496107_0050601 | Ga0496107_0050601_1044_1838 | 244 |
| 308 | 3300048910 | Ga0496107_0052403 | Ga0496107_0052403_2084_2881 | 244 |
| 309 | 3300048915 | Ga0496112_0001578 | Ga0496112_0001578_11833_12633 | 244 |
| 310 | 3300048916 | Ga0496113_0033218 | Ga0496113_0033218_2409_3209 | 244 |
| 311 | 3300053085 | Ga0495619_0004965 | Ga0495619_0004965_740_1537 | 244 |
| 312 | 3300001991 | JGI24743J22301_10000670 | JGI24743J22301_100006703 | 245 |
| 313 | 3300005290 | Ga0065712_10002008 | Ga0065712_100020084 | 245 |
| 314 | 3300005293 | Ga0065715_10001695 | Ga0065715_100016952 | 245 |
| 315 | 3300005293 | Ga0065715_10016770 | Ga0065715_100167702 | 245 |
| 316 | 3300005328 | Ga0070676_10000209 | Ga0070676_1000020924 | 245 |
| 317 | 3300005328 | Ga0070676_10000253 | Ga0070676_100002532 | 245 |
| 318 | 3300005328 | Ga0070676_10054820 | Ga0070676_100548202 | 245 |
| 319 | 3300005328 | Ga0070676_10501395 | Ga0070676_105013951 | 245 |
| 320 | 3300005329 | Ga0070683_100229543 | Ga0070683_1002295431 | 245 |
| 321 | 3300005330 | Ga0070690_100019760 | Ga0070690_1000197602 | 245 |
| 322 | 3300005330 | Ga0070690_100175169 | Ga0070690_1001751692 | 245 |
| 323 | 3300005331 | Ga0070670_100040265 | Ga0070670_1000402652 | 245 |
| 324 | 3300005331 | Ga0070670_100058515 | Ga0070670_1000585152 | 245 |
| 325 | 3300005331 | Ga0070670_100493933 | Ga0070670_1004939331 | 245 |
| 326 | 3300005333 | Ga0070677_10000328 | Ga0070677_100003286 | 245 |
| 327 | 3300005333 | Ga0070677_10035804 | Ga0070677_100358042 | 245 |
| 328 | 3300005334 | Ga0068869_100000066 | Ga0068869_10000006615 | 245 |
| 329 | 3300005334 | Ga0068869_100015982 | Ga0068869_1000159824 | 245 |
| 330 | 3300005334 | Ga0068869_100041944 | Ga0068869_1000419442 | 245 |
| 331 | 3300005334 | Ga0068869_100125751 | Ga0068869_1001257512 | 245 |
| 332 | 3300005335 | Ga0070666_10016139 | Ga0070666_100161392 | 245 |
| 333 | 3300005335 | Ga0070666_10028634 | Ga0070666_100286342 | 245 |
| 334 | 3300005338 | Ga0068868_100024910 | Ga0068868_1000249106 | 245 |
| 335 | 3300005338 | Ga0068868_100026954 | Ga0068868_1000269543 | 245 |
| 336 | 3300005338 | Ga0068868_100048068 | Ga0068868_1000480681 | 245 |
| 337 | 3300005338 | Ga0068868_100086487 | Ga0068868_1000864873 | 245 |
| 338 | 3300005338 | Ga0068868_100121103 | Ga0068868_1001211032 | 245 |
| 339 | 3300005339 | Ga0070660_100152343 | Ga0070660_1001523431 | 245 |
| 340 | 3300005340 | Ga0070689_100003075 | Ga0070689_1000030757 | 245 |
| 341 | 3300005340 | Ga0070689_100144075 | Ga0070689_1001440752 | 245 |
| 342 | 3300005343 | Ga0070687_100017773 | Ga0070687_1000177732 | 245 |
| 343 | 3300005345 | Ga0070692_10051933 | Ga0070692_100519332 | 245 |
| 344 | 3300005347 | Ga0070668_100000817 | Ga0070668_1000008172 | 245 |
| 345 | 3300005347 | Ga0070668_100005793 | Ga0070668_1000057934 | 245 |
| 346 | 3300005347 | Ga0070668_100008912 | Ga0070668_1000089123 | 245 |
| 347 | 3300005347 | Ga0070668_100043437 | Ga0070668_1000434372 | 245 |
| 348 | 3300005347 | Ga0070668_100504260 | Ga0070668_1005042601 | 245 |
| 349 | 3300005353 | Ga0070669_100012967 | Ga0070669_1000129675 | 245 |
| 350 | 3300005353 | Ga0070669_100017596 | Ga0070669_1000175966 | 245 |
| 351 | 3300005353 | Ga0070669_100173853 | Ga0070669_1001738531 | 245 |
| 352 | 3300005353 | Ga0070669_100216942 | Ga0070669_1002169422 | 245 |
| 353 | 3300005354 | Ga0070675_100000831 | Ga0070675_10000083114 | 245 |
| 354 | 3300005354 | Ga0070675_100033312 | Ga0070675_1000333126 | 245 |
| 355 | 3300005354 | Ga0070675_100114564 | Ga0070675_1001145642 | 245 |
| 356 | 3300005355 | Ga0070671_100005474 | Ga0070671_10000547411 | 245 |
| 357 | 3300005355 | Ga0070671_100028879 | Ga0070671_1000288793 | 245 |
| 358 | 3300005355 | Ga0070671_100059696 | Ga0070671_1000596961 | 245 |
| 359 | 3300005355 | Ga0070671_100233563 | Ga0070671_1002335632 | 245 |
| 360 | 3300005356 | Ga0070674_100016927 | Ga0070674_1000169272 | 245 |
| 361 | 3300005356 | Ga0070674_100246006 | Ga0070674_1002460062 | 245 |
| 362 | 3300005356 | Ga0070674_100271509 | Ga0070674_1002715092 | 245 |
| 363 | 3300005364 | Ga0070673_100000413 | Ga0070673_10000041315 | 245 |
| 364 | 3300005364 | Ga0070673_100010128 | Ga0070673_1000101282 | 245 |
| 365 | 3300005364 | Ga0070673_100055309 | Ga0070673_1000553094 | 245 |
| 366 | 3300005364 | Ga0070673_100416057 | Ga0070673_1004160571 | 245 |
| 367 | 3300005365 | Ga0070688_100161482 | Ga0070688_1001614822 | 245 |
| 368 | 3300005365 | Ga0070688_100170794 | Ga0070688_1001707942 | 245 |
| 369 | 3300005367 | Ga0070667_100002478 | Ga0070667_10000247821 | 245 |
| 370 | 3300005367 | Ga0070667_100045307 | Ga0070667_1000453074 | 245 |
| 371 | 3300005367 | Ga0070667_100077085 | Ga0070667_1000770852 | 245 |
| 372 | 3300005367 | Ga0070667_100378482 | Ga0070667_1003784822 | 245 |
| 373 | 3300005441 | Ga0070700_100012956 | Ga0070700_1000129567 | 245 |
| 374 | 3300005455 | Ga0070663_100036009 | Ga0070663_1000360094 | 245 |
| 375 | 3300005455 | Ga0070663_100157130 | Ga0070663_1001571301 | 245 |
| 376 | 3300005456 | Ga0070678_100002430 | Ga0070678_10000243012 | 245 |
| 377 | 3300005456 | Ga0070678_100003724 | Ga0070678_1000037245 | 245 |
| 378 | 3300005457 | Ga0070662_100286871 | Ga0070662_1002868712 | 245 |
| 379 | 3300005459 | Ga0068867_100001614 | Ga0068867_10000161415 | 245 |
| 380 | 3300005459 | Ga0068867_100010593 | Ga0068867_1000105934 | 245 |
| 381 | 3300005459 | Ga0068867_100015427 | Ga0068867_1000154272 | 245 |
| 382 | 3300005466 | Ga0070685_10004436 | Ga0070685_100044361 | 245 |
| 383 | 3300005535 | Ga0070684_100048448 | Ga0070684_1000484482 | 245 |
| 384 | 3300005539 | Ga0068853_100016993 | Ga0068853_1000169937 | 245 |
| 385 | 3300005539 | Ga0068853_100352951 | Ga0068853_1003529512 | 245 |
| 386 | 3300005539 | Ga0068853_100407324 | Ga0068853_1004073242 | 245 |
| 387 | 3300005543 | Ga0070672_100001217 | Ga0070672_10000121710 | 245 |
| 388 | 3300005543 | Ga0070672_100002335 | Ga0070672_10000233513 | 245 |
| 389 | 3300005544 | Ga0070686_100051635 | Ga0070686_1000516352 | 245 |
| 390 | 3300005545 | Ga0070695_100281063 | Ga0070695_1002810632 | 245 |
| 391 | 3300005548 | Ga0070665_100008510 | Ga0070665_10000851012 | 245 |
| 392 | 3300005564 | Ga0070664_100061713 | Ga0070664_1000617132 | 245 |
| 393 | 3300005577 | Ga0068857_100003154 | Ga0068857_1000031542 | 245 |
| 394 | 3300005577 | Ga0068857_100020455 | Ga0068857_1000204556 | 245 |
| 395 | 3300005578 | Ga0068854_100013835 | Ga0068854_1000138351 | 245 |
| 396 | 3300005614 | Ga0068856_100067794 | Ga0068856_1000677943 | 245 |
| 397 | 3300005615 | Ga0070702_100017084 | Ga0070702_1000170842 | 245 |
| 398 | 3300005616 | Ga0068852_100002200 | Ga0068852_10000220014 | 245 |
| 399 | 3300005616 | Ga0068852_100013233 | Ga0068852_1000132337 | 245 |
| 400 | 3300005616 | Ga0068852_100344394 | Ga0068852_1003443942 | 245 |
| 401 | 3300005617 | Ga0068859_100001650 | Ga0068859_10000165015 | 245 |
| 402 | 3300005617 | Ga0068859_100011314 | Ga0068859_1000113142 | 245 |
| 403 | 3300005618 | Ga0068864_100007124 | Ga0068864_1000071242 | 245 |
| 404 | 3300005618 | Ga0068864_100013967 | Ga0068864_1000139677 | 245 |
| 405 | 3300005719 | Ga0068861_100024048 | Ga0068861_1000240486 | 245 |
| 406 | 3300005719 | Ga0068861_100036158 | Ga0068861_1000361582 | 245 |
| 407 | 3300005719 | Ga0068861_100042928 | Ga0068861_1000429286 | 245 |
| 408 | 3300005719 | Ga0068861_100269395 | Ga0068861_1002693952 | 245 |
| 409 | 3300005719 | Ga0068861_100317382 | Ga0068861_1003173822 | 245 |
| 410 | 3300005834 | Ga0068851_10000383 | Ga0068851_1000038320 | 245 |
| 411 | 3300005834 | Ga0068851_10062316 | Ga0068851_100623161 | 245 |
| 412 | 3300005840 | Ga0068870_10006811 | Ga0068870_100068116 | 245 |
| 413 | 3300005840 | Ga0068870_10010159 | Ga0068870_100101591 | 245 |
| 414 | 3300005840 | Ga0068870_10061781 | Ga0068870_100617812 | 245 |
| 415 | 3300005840 | Ga0068870_10064707 | Ga0068870_100647072 | 245 |
| 416 | 3300005841 | Ga0068863_100001407 | Ga0068863_1000014074 | 245 |
| 417 | 3300005841 | Ga0068863_100013405 | Ga0068863_10001340510 | 245 |
| 418 | 3300005841 | Ga0068863_100054046 | Ga0068863_1000540466 | 245 |
| 419 | 3300005841 | Ga0068863_100218344 | Ga0068863_1002183442 | 245 |
| 420 | 3300005841 | Ga0068863_100534934 | Ga0068863_1005349342 | 245 |
| 421 | 3300005841 | Ga0068863_100550993 | Ga0068863_1005509932 | 245 |
| 422 | 3300005842 | Ga0068858_100000615 | Ga0068858_10000061532 | 245 |
| 423 | 3300005842 | Ga0068858_100036643 | Ga0068858_1000366432 | 245 |
| 424 | 3300005842 | Ga0068858_100122012 | Ga0068858_1001220121 | 245 |
| 425 | 3300005842 | Ga0068858_100141655 | Ga0068858_1001416552 | 245 |
| 426 | 3300005842 | Ga0068858_100334884 | Ga0068858_1003348841 | 245 |
| 427 | 3300005842 | Ga0068858_100345992 | Ga0068858_1003459922 | 245 |
| 428 | 3300005843 | Ga0068860_100031322 | Ga0068860_1000313223 | 245 |
| 429 | 3300005843 | Ga0068860_100035908 | Ga0068860_1000359087 | 245 |
| 430 | 3300005843 | Ga0068860_100087976 | Ga0068860_1000879761 | 245 |
| 431 | 3300005844 | Ga0068862_100008666 | Ga0068862_1000086665 | 245 |
| 432 | 3300005844 | Ga0068862_100065631 | Ga0068862_1000656316 | 245 |
| 433 | 3300005844 | Ga0068862_100150051 | Ga0068862_1001500512 | 245 |
| 434 | 3300005844 | Ga0068862_100193012 | Ga0068862_1001930122 | 245 |
| 435 | 3300006237 | Ga0097621_100003826 | Ga0097621_10000382612 | 245 |
| 436 | 3300006237 | Ga0097621_100005074 | Ga0097621_1000050747 | 245 |
| 437 | 3300006237 | Ga0097621_100049676 | Ga0097621_1000496765 | 245 |
| 438 | 3300006237 | Ga0097621_100174127 | Ga0097621_1001741272 | 245 |
| 439 | 3300006358 | Ga0068871_100020561 | Ga0068871_1000205612 | 245 |
| 440 | 3300006358 | Ga0068871_100035062 | Ga0068871_1000350627 | 245 |
| 441 | 3300006358 | Ga0068871_100588179 | Ga0068871_1005881791 | 245 |
| 442 | 3300006881 | Ga0068865_100014955 | Ga0068865_1000149554 | 245 |
| 443 | 3300006881 | Ga0068865_100126138 | Ga0068865_1001261383 | 245 |
| 444 | 3300006931 | Ga0097620_100001650 | Ga0097620_10000165015 | 245 |
| 445 | 3300006931 | Ga0097620_100011314 | Ga0097620_1000113142 | 245 |
| 446 | 3300009011 | Ga0105251_10164455 | Ga0105251_101644552 | 245 |
| 447 | 3300009094 | Ga0111539_10012267 | Ga0111539_100122674 | 245 |
| 448 | 3300009094 | Ga0111539_10798034 | Ga0111539_107980342 | 245 |
| 449 | 3300009101 | Ga0105247_10065316 | Ga0105247_100653163 | 245 |
| 450 | 3300009176 | Ga0105242_10126433 | Ga0105242_101264332 | 245 |
| 451 | 3300009177 | Ga0105248_10003381 | Ga0105248_100033815 | 245 |
| 452 | 3300009177 | Ga0105248_10024842 | Ga0105248_1002484210 | 245 |
| 453 | 3300009177 | Ga0105248_10159694 | Ga0105248_101596942 | 245 |
| 454 | 3300009553 | Ga0105249_10075642 | Ga0105249_100756423 | 245 |
| 455 | 3300009553 | Ga0105249_10236167 | Ga0105249_102361672 | 245 |
| 456 | 3300013104 | Ga0157370_10060029 | Ga0157370_100600292 | 245 |
| 457 | 3300013296 | Ga0157374_10000652 | Ga0157374_1000065231 | 245 |
| 458 | 3300013296 | Ga0157374_10007334 | Ga0157374_100073343 | 245 |
| 459 | 3300013296 | Ga0157374_10044664 | Ga0157374_100446642 | 245 |
| 460 | 3300013297 | Ga0157378_10075050 | Ga0157378_100750504 | 245 |
| 461 | 3300013297 | Ga0157378_10280144 | Ga0157378_102801441 | 245 |
| 462 | 3300013297 | Ga0157378_10293937 | Ga0157378_102939372 | 245 |
| 463 | 3300013306 | Ga0163162_10015881 | Ga0163162_100158812 | 245 |
| 464 | 3300013306 | Ga0163162_10240711 | Ga0163162_102407112 | 245 |
| 465 | 3300013308 | Ga0157375_10000922 | Ga0157375_1000092220 | 245 |
| 466 | 3300013308 | Ga0157375_10024378 | Ga0157375_100243787 | 245 |
| 467 | 3300013308 | Ga0157375_10808022 | Ga0157375_108080222 | 245 |
| 468 | 3300014325 | Ga0163163_10102090 | Ga0163163_101020902 | 245 |
| 469 | 3300014326 | Ga0157380_10185317 | Ga0157380_101853173 | 245 |
| 470 | 3300014326 | Ga0157380_10335601 | Ga0157380_103356011 | 245 |
| 471 | 3300014326 | Ga0157380_10356854 | Ga0157380_103568542 | 245 |
| 472 | 3300014968 | Ga0157379_10001318 | Ga0157379_1000131822 | 245 |
| 473 | 3300014968 | Ga0157379_10003993 | Ga0157379_1000399315 | 245 |
| 474 | 3300014968 | Ga0157379_10036140 | Ga0157379_100361402 | 245 |
| 475 | 3300014969 | Ga0157376_10044611 | Ga0157376_100446112 | 245 |
| 476 | 3300014969 | Ga0157376_10163303 | Ga0157376_101633032 | 245 |
| 477 | 3300014969 | Ga0157376_10193816 | Ga0157376_101938161 | 245 |
| 478 | 3300017792 | Ga0163161_10012517 | Ga0163161_100125177 | 245 |
| 479 | 3300025315 | Ga0207697_10010060 | Ga0207697_100100602 | 245 |
| 480 | 3300025315 | Ga0207697_10034268 | Ga0207697_100342682 | 245 |
| 481 | 3300025321 | Ga0207656_10128849 | Ga0207656_101288492 | 245 |
| 482 | 3300025893 | Ga0207682_10001544 | Ga0207682_1000154414 | 245 |
| 483 | 3300025893 | Ga0207682_10002336 | Ga0207682_1000233610 | 245 |
| 484 | 3300025899 | Ga0207642_10029981 | Ga0207642_100299811 | 245 |
| 485 | 3300025900 | Ga0207710_10049544 | Ga0207710_100495442 | 245 |
| 486 | 3300025901 | Ga0207688_10018407 | Ga0207688_100184072 | 245 |
| 487 | 3300025901 | Ga0207688_10081412 | Ga0207688_100814121 | 245 |
| 488 | 3300025903 | Ga0207680_10008165 | Ga0207680_100081658 | 245 |
| 489 | 3300025903 | Ga0207680_10053415 | Ga0207680_100534152 | 245 |
| 490 | 3300025907 | Ga0207645_10000209 | Ga0207645_1000020912 | 245 |
| 491 | 3300025907 | Ga0207645_10000283 | Ga0207645_1000028324 | 245 |
| 492 | 3300025907 | Ga0207645_10006292 | Ga0207645_100062923 | 245 |
| 493 | 3300025907 | Ga0207645_10258553 | Ga0207645_102585532 | 245 |
| 494 | 3300025908 | Ga0207643_10003271 | Ga0207643_100032716 | 245 |
| 495 | 3300025908 | Ga0207643_10033446 | Ga0207643_100334462 | 245 |
| 496 | 3300025908 | Ga0207643_10117100 | Ga0207643_101171002 | 245 |
| 497 | 3300025918 | Ga0207662_10005532 | Ga0207662_100055326 | 245 |
| 498 | 3300025919 | Ga0207657_10021361 | Ga0207657_100213612 | 245 |
| 499 | 3300025923 | Ga0207681_10009719 | Ga0207681_100097193 | 245 |
| 500 | 3300025923 | Ga0207681_10013116 | Ga0207681_100131162 | 245 |
| 501 | 3300025923 | Ga0207681_10031234 | Ga0207681_100312341 | 245 |
| 502 | 3300025923 | Ga0207681_10407575 | Ga0207681_104075752 | 245 |
| 503 | 3300025925 | Ga0207650_10011697 | Ga0207650_100116974 | 245 |
| 504 | 3300025925 | Ga0207650_10041629 | Ga0207650_100416294 | 245 |
| 505 | 3300025925 | Ga0207650_10049418 | Ga0207650_100494182 | 245 |
| 506 | 3300025925 | Ga0207650_10209229 | Ga0207650_102092292 | 245 |
| 507 | 3300025925 | Ga0207650_10338306 | Ga0207650_103383062 | 245 |
| 508 | 3300025926 | Ga0207659_10006299 | Ga0207659_100062999 | 245 |
| 509 | 3300025926 | Ga0207659_10026654 | Ga0207659_100266542 | 245 |
| 510 | 3300025926 | Ga0207659_10047274 | Ga0207659_100472744 | 245 |
| 511 | 3300025927 | Ga0207687_10098812 | Ga0207687_100988121 | 245 |
| 512 | 3300025931 | Ga0207644_10002553 | Ga0207644_1000255311 | 245 |
| 513 | 3300025931 | Ga0207644_10061645 | Ga0207644_100616453 | 245 |
| 514 | 3300025931 | Ga0207644_10085018 | Ga0207644_100850182 | 245 |
| 515 | 3300025931 | Ga0207644_10326948 | Ga0207644_103269481 | 245 |
| 516 | 3300025931 | Ga0207644_10374705 | Ga0207644_103747052 | 245 |
| 517 | 3300025933 | Ga0207706_10004812 | Ga0207706_1000481215 | 245 |
| 518 | 3300025934 | Ga0207686_10090782 | Ga0207686_100907822 | 245 |
| 519 | 3300025935 | Ga0207709_10132541 | Ga0207709_101325412 | 245 |
| 520 | 3300025936 | Ga0207670_10100518 | Ga0207670_101005182 | 245 |
| 521 | 3300025937 | Ga0207669_10004815 | Ga0207669_100048155 | 245 |
| 522 | 3300025937 | Ga0207669_10009402 | Ga0207669_100094028 | 245 |
| 523 | 3300025938 | Ga0207704_10016388 | Ga0207704_100163887 | 245 |
| 524 | 3300025938 | Ga0207704_10153551 | Ga0207704_101535512 | 245 |
| 525 | 3300025939 | Ga0207665_10497834 | Ga0207665_104978342 | 245 |
| 526 | 3300025940 | Ga0207691_10000153 | Ga0207691_1000015364 | 245 |
| 527 | 3300025940 | Ga0207691_10000546 | Ga0207691_1000054633 | 245 |
| 528 | 3300025940 | Ga0207691_10011464 | Ga0207691_100114644 | 245 |
| 529 | 3300025940 | Ga0207691_10043897 | Ga0207691_100438973 | 245 |
| 530 | 3300025940 | Ga0207691_10127993 | Ga0207691_101279932 | 245 |
| 531 | 3300025941 | Ga0207711_10050593 | Ga0207711_100505932 | 245 |
| 532 | 3300025941 | Ga0207711_10052020 | Ga0207711_100520201 | 245 |
| 533 | 3300025942 | Ga0207689_10000952 | Ga0207689_1000095215 | 245 |
| 534 | 3300025942 | Ga0207689_10001219 | Ga0207689_1000121926 | 245 |
| 535 | 3300025942 | Ga0207689_10115984 | Ga0207689_101159843 | 245 |
| 536 | 3300025945 | Ga0207679_10124919 | Ga0207679_101249192 | 245 |
| 537 | 3300025949 | Ga0207667_10539569 | Ga0207667_105395691 | 245 |
| 538 | 3300025960 | Ga0207651_10001263 | Ga0207651_100012638 | 245 |
| 539 | 3300025960 | Ga0207651_10014138 | Ga0207651_100141382 | 245 |
| 540 | 3300025972 | Ga0207668_10005674 | Ga0207668_100056743 | 245 |
| 541 | 3300025972 | Ga0207668_10023963 | Ga0207668_100239634 | 245 |
| 542 | 3300025972 | Ga0207668_10024247 | Ga0207668_100242472 | 245 |
| 543 | 3300025972 | Ga0207668_10247323 | Ga0207668_102473232 | 245 |
| 544 | 3300025972 | Ga0207668_10310750 | Ga0207668_103107502 | 245 |
| 545 | 3300025986 | Ga0207658_10006807 | Ga0207658_1000680711 | 245 |
| 546 | 3300025986 | Ga0207658_10013941 | Ga0207658_100139414 | 245 |
| 547 | 3300025986 | Ga0207658_10016683 | Ga0207658_100166833 | 245 |
| 548 | 3300025986 | Ga0207658_10021208 | Ga0207658_100212083 | 245 |
| 549 | 3300025986 | Ga0207658_10151891 | Ga0207658_101518912 | 245 |
| 550 | 3300025986 | Ga0207658_10361904 | Ga0207658_103619042 | 245 |
| 551 | 3300026023 | Ga0207677_10036718 | Ga0207677_100367181 | 245 |
| 552 | 3300026023 | Ga0207677_10049777 | Ga0207677_100497772 | 245 |
| 553 | 3300026023 | Ga0207677_10087399 | Ga0207677_100873992 | 245 |
| 554 | 3300026035 | Ga0207703_10001381 | Ga0207703_1000138121 | 245 |
| 555 | 3300026035 | Ga0207703_10031384 | Ga0207703_100313847 | 245 |
| 556 | 3300026041 | Ga0207639_10058769 | Ga0207639_100587691 | 245 |
| 557 | 3300026067 | Ga0207678_10001649 | Ga0207678_1000164917 | 245 |
| 558 | 3300026067 | Ga0207678_10063510 | Ga0207678_100635102 | 245 |
| 559 | 3300026067 | Ga0207678_10156186 | Ga0207678_101561862 | 245 |
| 560 | 3300026075 | Ga0207708_10075859 | Ga0207708_100758592 | 245 |
| 561 | 3300026088 | Ga0207641_10002346 | Ga0207641_1000234620 | 245 |
| 562 | 3300026088 | Ga0207641_10031156 | Ga0207641_100311566 | 245 |
| 563 | 3300026088 | Ga0207641_10314310 | Ga0207641_103143102 | 245 |
| 564 | 3300026088 | Ga0207641_10362715 | Ga0207641_103627152 | 245 |
| 565 | 3300026089 | Ga0207648_10000564 | Ga0207648_1000056433 | 245 |
| 566 | 3300026089 | Ga0207648_10006558 | Ga0207648_100065582 | 245 |
| 567 | 3300026089 | Ga0207648_10011183 | Ga0207648_100111834 | 245 |
| 568 | 3300026089 | Ga0207648_10315325 | Ga0207648_103153252 | 245 |
| 569 | 3300026095 | Ga0207676_10003043 | Ga0207676_1000304313 | 245 |
| 570 | 3300026095 | Ga0207676_10016044 | Ga0207676_100160446 | 245 |
| 571 | 3300026095 | Ga0207676_10017861 | Ga0207676_100178613 | 245 |
| 572 | 3300026095 | Ga0207676_10092131 | Ga0207676_100921312 | 245 |
| 573 | 3300026116 | Ga0207674_10010649 | Ga0207674_1001064910 | 245 |
| 574 | 3300026116 | Ga0207674_10026146 | Ga0207674_1002614611 | 245 |
| 575 | 3300026118 | Ga0207675_100010670 | Ga0207675_10001067010 | 245 |
| 576 | 3300026118 | Ga0207675_100041207 | Ga0207675_1000412076 | 245 |
| 577 | 3300026118 | Ga0207675_100229770 | Ga0207675_1002297703 | 245 |
| 578 | 3300026121 | Ga0207683_10000140 | Ga0207683_1000014018 | 245 |
| 579 | 3300026121 | Ga0207683_10000424 | Ga0207683_1000042423 | 245 |
| 580 | 3300026121 | Ga0207683_10019340 | Ga0207683_100193404 | 245 |
| 581 | 3300026142 | Ga0207698_10028625 | Ga0207698_100286255 | 245 |
| 582 | 3300026142 | Ga0207698_10052008 | Ga0207698_100520081 | 245 |
| 583 | 3300026142 | Ga0207698_10090781 | Ga0207698_100907812 | 245 |
| 584 | 3300027717 | Ga0209998_10033926 | Ga0209998_100339262 | 245 |
| 585 | 3300027907 | Ga0207428_10032798 | Ga0207428_100327983 | 245 |
| 586 | 3300028379 | Ga0268266_10014198 | Ga0268266_100141985 | 245 |
| 587 | 3300028379 | Ga0268266_10212777 | Ga0268266_102127772 | 245 |
| 588 | 3300028379 | Ga0268266_10444989 | Ga0268266_104449892 | 245 |
| 589 | 3300028380 | Ga0268265_10011281 | Ga0268265_100112816 | 245 |
| 590 | 3300028380 | Ga0268265_10063872 | Ga0268265_100638726 | 245 |
| 591 | 3300028380 | Ga0268265_10139772 | Ga0268265_101397722 | 245 |
| 592 | 3300028380 | Ga0268265_10237666 | Ga0268265_102376662 | 245 |
| 593 | 3300028381 | Ga0268264_10016725 | Ga0268264_100167253 | 245 |
| 594 | 3300028381 | Ga0268264_10085573 | Ga0268264_100855734 | 245 |
| 595 | 3300028381 | Ga0268264_10091094 | Ga0268264_100910942 | 245 |
| 596 | 3300028381 | Ga0268264_10115040 | Ga0268264_101150402 | 245 |
| 597 | 3300028381 | Ga0268264_10769563 | Ga0268264_107695631 | 245 |
| 598 | 3300031548 | Ga0307408_100037433 | Ga0307408_1000374334 | 245 |
| 599 | 3300031548 | Ga0307408_100067534 | Ga0307408_1000675343 | 245 |
| 600 | 3300031731 | Ga0307405_10026034 | Ga0307405_100260343 | 245 |
| 601 | 3300031852 | Ga0307410_10117281 | Ga0307410_101172812 | 245 |
| 602 | 3300031901 | Ga0307406_10278024 | Ga0307406_102780242 | 245 |
| 603 | 3300031911 | Ga0307412_10056231 | Ga0307412_100562312 | 245 |
| 604 | 3300031911 | Ga0307412_10270832 | Ga0307412_102708322 | 245 |
| 605 | 3300031995 | Ga0307409_100675557 | Ga0307409_1006755572 | 245 |
| 606 | 3300041492 | Ga0451835_0415084 | Ga0451835_0415084_848_1645 | 245 |
| 607 | 3300041512 | Ga0451853_4110621 | Ga0451853_4110621_425_1222 | 245 |
| 608 | 3300042122 | Ga0450920_010731 | Ga0450920_010731_520_1260 | 245 |
| 609 | 3300042530 | Ga0450916_006472 | Ga0450916_006472_497_1237 | 245 |
| 610 | 3300042530 | Ga0450916_021774 | Ga0450916_021774_81_821 | 245 |
| 611 | 3300045051 | Ga0451576_0369481 | Ga0451576_0369481_217_1023 | 245 |
| 612 | 3300045836 | Ga0466958_0083951 | Ga0466958_0083951_160_960 | 245 |
| 613 | 3300046539 | Ga0495621_0007655 | Ga0495621_0007655_990_1787 | 245 |
| 614 | 3300048904 | Ga0496101_0067354 | Ga0496101_0067354_986_1783 | 245 |
| 615 | 3300048904 | Ga0496101_0283940 | Ga0496101_0283940_96_905 | 245 |
| 616 | 3300048906 | Ga0496103_0024811 | Ga0496103_0024811_1083_1889 | 245 |
| 617 | 3300048907 | Ga0496104_0292101 | Ga0496104_0292101_387_1184 | 245 |
| 618 | 3300048907 | Ga0496104_0390028 | Ga0496104_0390028_75_884 | 245 |
| 619 | 3300048908 | Ga0496105_0004497 | Ga0496105_0004497_8966_9763 | 245 |
| 620 | 3300048908 | Ga0496105_0378222 | Ga0496105_0378222_37_846 | 245 |
| 621 | 3300048909 | Ga0496106_0063390 | Ga0496106_0063390_637_1434 | 245 |
| 622 | 3300048911 | Ga0496108_0029077 | Ga0496108_0029077_1601_2398 | 245 |
| 623 | 3300048911 | Ga0496108_0171966 | Ga0496108_0171966_80_886 | 245 |
| 624 | 3300048911 | Ga0496108_0671792 | Ga0496108_0671792_74_880 | 245 |
| 625 | 3300048912 | Ga0496109_0011357 | Ga0496109_0011357_6267_7064 | 245 |
| 626 | 3300048912 | Ga0496109_0042188 | Ga0496109_0042188_973_1779 | 245 |
| 627 | 3300048912 | Ga0496109_0574714 | Ga0496109_0574714_226_1032 | 245 |
| 628 | 3300048913 | Ga0496110_0230622 | Ga0496110_0230622_332_1138 | 245 |
| 629 | 3300048913 | Ga0496110_0300639 | Ga0496110_0300639_207_1007 | 245 |
| 630 | 3300048917 | Ga0496114_0060614 | Ga0496114_0060614_379_1185 | 245 |
| 631 | 3300048917 | Ga0496114_0590060 | Ga0496114_0590060_72_869 | 245 |
| 632 | 3300049568 | Ga0501031_0050139 | Ga0501031_0050139_1697_2437 | 245 |
| 633 | 3300049569 | Ga0501032_0072597 | Ga0501032_0072597_1266_2006 | 245 |
| 634 | 3300049572 | Ga0501036_0004094 | Ga0501036_0004094_7967_8707 | 245 |
| 635 | 3300049574 | Ga0501038_0081552 | Ga0501038_0081552_289_1029 | 245 |
| 636 | 3300049575 | Ga0501039_0010083 | Ga0501039_0010083_5069_5809 | 245 |
| 637 | 3300049576 | Ga0501040_0085262 | Ga0501040_0085262_1379_2119 | 245 |
| 638 | 3300049576 | Ga0501040_0125724 | Ga0501040_0125724_957_1697 | 245 |
| 639 | 3300049577 | Ga0501041_0128962 | Ga0501041_0128962_278_1018 | 245 |
| 640 | 3300049578 | Ga0501042_0438107 | Ga0501042_0438107_43_783 | 245 |
| 641 | 3300049579 | Ga0501043_0069312 | Ga0501043_0069312_1961_2701 | 245 |
| 642 | 3300049582 | Ga0501048_0043892 | Ga0501048_0043892_1333_2073 | 245 |
| 643 | 3300049582 | Ga0501048_0505887 | Ga0501048_0505887_43_783 | 245 |
| 644 | 3300049584 | Ga0501068_0149169 | Ga0501068_0149169_435_1175 | 245 |
| 645 | 3300049587 | Ga0501071_0086575 | Ga0501071_0086575_146_886 | 245 |
| 646 | 3300049588 | Ga0501072_0016575 | Ga0501072_0016575_3534_4274 | 245 |
| 647 | 3300049590 | Ga0501074_0172011 | Ga0501074_0172011_643_1383 | 245 |
| 648 | 3300049591 | Ga0501075_0011459 | Ga0501075_0011459_2190_2930 | 245 |
| 649 | 3300049592 | Ga0501076_0054207 | Ga0501076_0054207_1395_2135 | 245 |
| 650 | 3300049741 | Ga0501079_0214322 | Ga0501079_0214322_444_1184 | 245 |
| 651 | 3300049742 | Ga0501080_0263037 | Ga0501080_0263037_786_1526 | 245 |
| 652 | 3300049743 | Ga0501081_0071918 | Ga0501081_0071918_1383_2123 | 245 |
| 653 | 3300049822 | Ga0501035_0099750 | Ga0501035_0099750_1410_2150 | 245 |
| 654 | 3300049822 | Ga0501035_0688221 | Ga0501035_0688221_17_757 | 245 |
| 655 | 3300049823 | Ga0501044_0180693 | Ga0501044_0180693_14_754 | 245 |
| 656 | 3300049824 | Ga0501045_0079481 | Ga0501045_0079481_823_1563 | 245 |
| 657 | 3300050507 | nmdc:mga05p37_640621_c1 | nmdc:mga05p37_640621_c1_371_1171 | 245 |
| 658 | 3300005293 | Ga0065715_10233042 | Ga0065715_102330422 | 246 |
| 659 | 3300005330 | Ga0070690_100003569 | Ga0070690_10000356911 | 246 |
| 660 | 3300005331 | Ga0070670_100053429 | Ga0070670_1000534292 | 246 |
| 661 | 3300005335 | Ga0070666_10005215 | Ga0070666_100052154 | 246 |
| 662 | 3300005335 | Ga0070666_10011040 | Ga0070666_100110402 | 246 |
| 663 | 3300005338 | Ga0068868_100009045 | Ga0068868_1000090456 | 246 |
| 664 | 3300005340 | Ga0070689_100046367 | Ga0070689_1000463673 | 246 |
| 665 | 3300005341 | Ga0070691_10079199 | Ga0070691_100791992 | 246 |
| 666 | 3300005343 | Ga0070687_100022003 | Ga0070687_1000220032 | 246 |
| 667 | 3300005353 | Ga0070669_100145976 | Ga0070669_1001459762 | 246 |
| 668 | 3300005354 | Ga0070675_100081135 | Ga0070675_1000811353 | 246 |
| 669 | 3300005354 | Ga0070675_100120696 | Ga0070675_1001206962 | 246 |
| 670 | 3300005355 | Ga0070671_100053436 | Ga0070671_1000534363 | 246 |
| 671 | 3300005355 | Ga0070671_100315787 | Ga0070671_1003157872 | 246 |
| 672 | 3300005364 | Ga0070673_100012723 | Ga0070673_1000127236 | 246 |
| 673 | 3300005364 | Ga0070673_100536363 | Ga0070673_1005363632 | 246 |
| 674 | 3300005365 | Ga0070688_100001381 | Ga0070688_1000013816 | 246 |
| 675 | 3300005367 | Ga0070667_100007387 | Ga0070667_10000738711 | 246 |
| 676 | 3300005367 | Ga0070667_100105466 | Ga0070667_1001054662 | 246 |
| 677 | 3300005436 | Ga0070713_100006522 | Ga0070713_1000065221 | 246 |
| 678 | 3300005437 | Ga0070710_10047733 | Ga0070710_100477332 | 246 |
| 679 | 3300005439 | Ga0070711_100042907 | Ga0070711_1000429072 | 246 |
| 680 | 3300005456 | Ga0070678_100008098 | Ga0070678_1000080985 | 246 |
| 681 | 3300005456 | Ga0070678_100817332 | Ga0070678_1008173321 | 246 |
| 682 | 3300005466 | Ga0070685_10007773 | Ga0070685_100077733 | 246 |
| 683 | 3300005535 | Ga0070684_100152946 | Ga0070684_1001529462 | 246 |
| 684 | 3300005543 | Ga0070672_100142996 | Ga0070672_1001429962 | 246 |
| 685 | 3300005544 | Ga0070686_100069118 | Ga0070686_1000691182 | 246 |
| 686 | 3300005548 | Ga0070665_100001378 | Ga0070665_10000137830 | 246 |
| 687 | 3300005548 | Ga0070665_100017516 | Ga0070665_10001751611 | 246 |
| 688 | 3300005616 | Ga0068852_100280594 | Ga0068852_1002805941 | 246 |
| 689 | 3300005617 | Ga0068859_100000398 | Ga0068859_1000003985 | 246 |
| 690 | 3300005617 | Ga0068859_100026072 | Ga0068859_1000260724 | 246 |
| 691 | 3300005618 | Ga0068864_100002525 | Ga0068864_10000252513 | 246 |
| 692 | 3300005841 | Ga0068863_100000366 | Ga0068863_10000036642 | 246 |
| 693 | 3300005842 | Ga0068858_100000781 | Ga0068858_10000078136 | 246 |
| 694 | 3300006175 | Ga0070712_100009734 | Ga0070712_1000097342 | 246 |
| 695 | 3300006237 | Ga0097621_100232233 | Ga0097621_1002322332 | 246 |
| 696 | 3300006844 | Ga0075428_100009793 | Ga0075428_1000097935 | 246 |
| 697 | 3300006846 | Ga0075430_100394080 | Ga0075430_1003940802 | 246 |
| 698 | 3300006847 | Ga0075431_100017650 | Ga0075431_1000176508 | 246 |
| 699 | 3300006881 | Ga0068865_100154050 | Ga0068865_1001540502 | 246 |
| 700 | 3300006931 | Ga0097620_100000398 | Ga0097620_1000003985 | 246 |
| 701 | 3300006931 | Ga0097620_100026072 | Ga0097620_1000260724 | 246 |
| 702 | 3300007076 | Ga0075435_100505501 | Ga0075435_1005055012 | 246 |
| 703 | 3300009098 | Ga0105245_10096955 | Ga0105245_100969552 | 246 |
| 704 | 3300009101 | Ga0105247_10012621 | Ga0105247_100126215 | 246 |
| 705 | 3300009147 | Ga0114129_10659995 | Ga0114129_106599952 | 246 |
| 706 | 3300009174 | Ga0105241_10715616 | Ga0105241_107156161 | 246 |
| 707 | 3300009177 | Ga0105248_10057815 | Ga0105248_100578152 | 246 |
| 708 | 3300013296 | Ga0157374_10000460 | Ga0157374_100004604 | 246 |
| 709 | 3300013296 | Ga0157374_10151285 | Ga0157374_101512852 | 246 |
| 710 | 3300013297 | Ga0157378_10302991 | Ga0157378_103029912 | 246 |
| 711 | 3300013306 | Ga0163162_10057423 | Ga0163162_100574232 | 246 |
| 712 | 3300013307 | Ga0157372_10059945 | Ga0157372_100599452 | 246 |
| 713 | 3300013308 | Ga0157375_10008960 | Ga0157375_1000896011 | 246 |
| 714 | 3300013308 | Ga0157375_10127459 | Ga0157375_101274593 | 246 |
| 715 | 3300014325 | Ga0163163_10012877 | Ga0163163_100128776 | 246 |
| 716 | 3300014326 | Ga0157380_10182686 | Ga0157380_101826862 | 246 |
| 717 | 3300014745 | Ga0157377_10089189 | Ga0157377_100891892 | 246 |
| 718 | 3300014968 | Ga0157379_10003843 | Ga0157379_1000384314 | 246 |
| 719 | 3300014969 | Ga0157376_10030581 | Ga0157376_100305814 | 246 |
| 720 | 3300014969 | Ga0157376_10175518 | Ga0157376_101755182 | 246 |
| 721 | 3300025898 | Ga0207692_10076306 | Ga0207692_100763062 | 246 |
| 722 | 3300025903 | Ga0207680_10001232 | Ga0207680_1000123211 | 246 |
| 723 | 3300025903 | Ga0207680_10005392 | Ga0207680_100053926 | 246 |
| 724 | 3300025907 | Ga0207645_10256083 | Ga0207645_102560832 | 246 |
| 725 | 3300025908 | Ga0207643_10072236 | Ga0207643_100722362 | 246 |
| 726 | 3300025915 | Ga0207693_10000364 | Ga0207693_1000036425 | 246 |
| 727 | 3300025916 | Ga0207663_10033753 | Ga0207663_100337532 | 246 |
| 728 | 3300025916 | Ga0207663_10073440 | Ga0207663_100734402 | 246 |
| 729 | 3300025918 | Ga0207662_10022887 | Ga0207662_100228873 | 246 |
| 730 | 3300025925 | Ga0207650_10421244 | Ga0207650_104212441 | 246 |
| 731 | 3300025926 | Ga0207659_10060647 | Ga0207659_100606472 | 246 |
| 732 | 3300025927 | Ga0207687_10011521 | Ga0207687_100115215 | 246 |
| 733 | 3300025928 | Ga0207700_10046327 | Ga0207700_100463273 | 246 |
| 734 | 3300025929 | Ga0207664_10246055 | Ga0207664_102460552 | 246 |
| 735 | 3300025931 | Ga0207644_10018086 | Ga0207644_100180866 | 246 |
| 736 | 3300025936 | Ga0207670_10009367 | Ga0207670_100093673 | 246 |
| 737 | 3300025936 | Ga0207670_10097717 | Ga0207670_100977172 | 246 |
| 738 | 3300025940 | Ga0207691_10092480 | Ga0207691_100924802 | 246 |
| 739 | 3300025941 | Ga0207711_10000185 | Ga0207711_1000018520 | 246 |
| 740 | 3300025942 | Ga0207689_10158122 | Ga0207689_101581222 | 246 |
| 741 | 3300025960 | Ga0207651_10048053 | Ga0207651_100480534 | 246 |
| 742 | 3300025960 | Ga0207651_10206070 | Ga0207651_102060702 | 246 |
| 743 | 3300025972 | Ga0207668_10079774 | Ga0207668_100797743 | 246 |
| 744 | 3300025986 | Ga0207658_10036639 | Ga0207658_100366395 | 246 |
| 745 | 3300025986 | Ga0207658_10053547 | Ga0207658_100535472 | 246 |
| 746 | 3300026023 | Ga0207677_10000148 | Ga0207677_100001487 | 246 |
| 747 | 3300026035 | Ga0207703_10001265 | Ga0207703_1000126514 | 246 |
| 748 | 3300026078 | Ga0207702_10096171 | Ga0207702_100961712 | 246 |
| 749 | 3300026095 | Ga0207676_10000516 | Ga0207676_1000051634 | 246 |
| 750 | 3300026118 | Ga0207675_100578947 | Ga0207675_1005789472 | 246 |
| 751 | 3300026121 | Ga0207683_10001594 | Ga0207683_1000159410 | 246 |
| 752 | 3300027395 | Ga0209996_1010164 | Ga0209996_10101642 | 246 |
| 753 | 3300027617 | Ga0210002_1002629 | Ga0210002_10026292 | 246 |
| 754 | 3300027665 | Ga0209983_1004485 | Ga0209983_10044854 | 246 |
| 755 | 3300027717 | Ga0209998_10000997 | Ga0209998_100009975 | 246 |
| 756 | 3300027876 | Ga0209974_10000131 | Ga0209974_1000013123 | 246 |
| 757 | 3300028379 | Ga0268266_10011410 | Ga0268266_100114102 | 246 |
| 758 | 3300028379 | Ga0268266_10023660 | Ga0268266_100236606 | 246 |
| 759 | 3300028381 | Ga0268264_10023422 | Ga0268264_100234225 | 246 |
| 760 | 3300031665 | Ga0316575_10007155 | Ga0316575_100071552 | 246 |
| 761 | 3300031727 | Ga0316576_10001231 | Ga0316576_1000123116 | 246 |
| 762 | 3300031728 | Ga0316578_10136017 | Ga0316578_101360172 | 246 |
| 763 | 3300031733 | Ga0316577_10024660 | Ga0316577_100246603 | 246 |
| 764 | 3300032139 | Ga0316580_10012483 | Ga0316580_100124832 | 246 |
| 765 | 3300035086 | Ga0373934_0022660 | Ga0373934_0022660_344_1147 | 246 |
| 766 | 3300035111 | Ga0373923_0001887 | Ga0373923_0001887_4576_5379 | 246 |
| 767 | 3300035113 | Ga0373936_0039651 | Ga0373936_0039651_151_954 | 246 |
| 768 | 3300035116 | Ga0373945_0020967 | Ga0373945_0020967_893_1696 | 246 |
| 769 | 3300035117 | Ga0373953_0004046 | Ga0373953_0004046_1592_2395 | 246 |
| 770 | 3300035118 | Ga0373954_0029877 | Ga0373954_0029877_675_1478 | 246 |
| 771 | 3300035119 | Ga0373956_0035695 | Ga0373956_0035695_726_1529 | 246 |
| 772 | 3300035120 | Ga0373957_0050449 | Ga0373957_0050449_358_1161 | 246 |
| 773 | 3300035170 | Ga0373943_0028812 | Ga0373943_0028812_338_1141 | 246 |
| 774 | 3300035172 | Ga0373955_0069459 | Ga0373955_0069459_576_1379 | 246 |
| 775 | 3300035692 | Ga0373935_0054301 | Ga0373935_0054301_208_1011 | 246 |
| 776 | 3300035724 | Ga0373933_0020614 | Ga0373933_0020614_1268_2071 | 246 |
| 777 | 3300035725 | Ga0373947_0015049 | Ga0373947_0015049_2312_3115 | 246 |
| 778 | 3300036401 | Ga0373937_0024846 | Ga0373937_0024846_4459_5262 | 246 |
| 779 | 3300036647 | Ga0316582_0001521 | Ga0316582_0001521_8792_9532 | 246 |
| 780 | 3300036712 | Ga0316584_0007945 | Ga0316584_0007945_231_971 | 246 |
| 781 | 3300042125 | Ga0450923_002469 | Ga0450923_002469_17_760 | 246 |
| 782 | 3300042125 | Ga0450923_006805 | Ga0450923_006805_273_1016 | 246 |
| 783 | 3300042131 | Ga0450894_012969 | Ga0450894_012969_258_1001 | 246 |
| 784 | 3300042184 | Ga0450908_003805 | Ga0450908_003805_909_1652 | 246 |
| 785 | 3300045051 | Ga0451576_0124578 | Ga0451576_0124578_178_981 | 246 |
| 786 | 3300046454 | Ga0495592_0155456 | Ga0495592_0155456_586_1389 | 246 |
| 787 | 3300046472 | Ga0495580_0028562 | Ga0495580_0028562_2876_3679 | 246 |
| 788 | 3300046533 | Ga0495640_0048466 | Ga0495640_0048466_858_1661 | 246 |
| 789 | 3300046543 | Ga0495645_0163142 | Ga0495645_0163142_272_1075 | 246 |
| 790 | 3300046559 | Ga0495667_0203949 | Ga0495667_0203949_400_1203 | 246 |
| 791 | 3300046678 | Ga0495599_0103564 | Ga0495599_0103564_955_1758 | 246 |
| 792 | 3300046679 | Ga0495623_0053790 | Ga0495623_0053790_437_1240 | 246 |
| 793 | 3300047317 | Ga0495604_0107881 | Ga0495604_0107881_740_1543 | 246 |
| 794 | 3300047471 | Ga0495684_0144227 | Ga0495684_0144227_332_1135 | 246 |
| 795 | 3300048904 | Ga0496101_0130790 | Ga0496101_0130790_800_1603 | 246 |
| 796 | 3300048907 | Ga0496104_0022719 | Ga0496104_0022719_3926_4729 | 246 |
| 797 | 3300048908 | Ga0496105_0002462 | Ga0496105_0002462_9802_10605 | 246 |
| 798 | 3300048909 | Ga0496106_0041299 | Ga0496106_0041299_2619_3422 | 246 |
| 799 | 3300048909 | Ga0496106_0152726 | Ga0496106_0152726_944_1795 | 246 |
| 800 | 3300048909 | Ga0496106_0479385 | Ga0496106_0479385_19_822 | 246 |
| 801 | 3300048915 | Ga0496112_0003046 | Ga0496112_0003046_1334_2137 | 246 |
| 802 | 3300048917 | Ga0496114_0074434 | Ga0496114_0074434_1225_2028 | 246 |
| 803 | 3300048918 | Ga0496115_0038958 | Ga0496115_0038958_114_917 | 246 |
| 804 | 3300049568 | Ga0501031_0188517 | Ga0501031_0188517_522_1262 | 246 |
| 805 | 3300049572 | Ga0501036_0412147 | Ga0501036_0412147_374_1114 | 246 |
| 806 | 3300049575 | Ga0501039_0311556 | Ga0501039_0311556_429_1169 | 246 |
| 807 | 3300049578 | Ga0501042_0335975 | Ga0501042_0335975_252_995 | 246 |
| 808 | 3300049580 | Ga0501046_0222958 | Ga0501046_0222958_45_785 | 246 |
| 809 | 3300049582 | Ga0501048_0087933 | Ga0501048_0087933_480_1220 | 246 |
| 810 | 3300049587 | Ga0501071_0232036 | Ga0501071_0232036_167_907 | 246 |
| 811 | 3300049588 | Ga0501072_0197435 | Ga0501072_0197435_668_1408 | 246 |
| 812 | 3300049591 | Ga0501075_0014457 | Ga0501075_0014457_3660_4400 | 246 |
| 813 | 3300049741 | Ga0501079_0088972 | Ga0501079_0088972_488_1228 | 246 |
| 814 | 3300049742 | Ga0501080_0410330 | Ga0501080_0410330_331_1074 | 246 |
| 815 | 3300049743 | Ga0501081_0575350 | Ga0501081_0575350_18_758 | 246 |
| 816 | 3300049824 | Ga0501045_0067108 | Ga0501045_0067108_1310_2050 | 246 |
| 817 | 3300050510 | nmdc:mga06r32_47829_c1 | nmdc:mga06r32_47829_c1_455_1195 | 246 |
| 818 | 3300050512 | nmdc:mga0n895_151849_c1 | nmdc:mga0n895_151849_c1_369_1172 | 246 |
| 819 | 3300050513 | nmdc:mga0rr50_423107_c1 | nmdc:mga0rr50_423107_c1_179_982 | 246 |
| 820 | 3300054114 | Ga0501084_0249868 | Ga0501084_0249868_291_1031 | 246 |
| 821 | 3300060353 | Ga0501082_0080058 | Ga0501082_0080058_1547_2290 | 246 |
| 822 | 3300005339 | Ga0070660_100010354 | Ga0070660_1000103545 | 247 |
| 823 | 3300005344 | Ga0070661_100004272 | Ga0070661_1000042727 | 247 |
| 824 | 3300005345 | Ga0070692_10188557 | Ga0070692_101885572 | 247 |
| 825 | 3300005355 | Ga0070671_100013306 | Ga0070671_1000133066 | 247 |
| 826 | 3300005366 | Ga0070659_100001024 | Ga0070659_10000102417 | 247 |
| 827 | 3300005367 | Ga0070667_100389000 | Ga0070667_1003890002 | 247 |
| 828 | 3300005455 | Ga0070663_100007890 | Ga0070663_1000078903 | 247 |
| 829 | 3300005457 | Ga0070662_100000907 | Ga0070662_10000090714 | 247 |
| 830 | 3300005458 | Ga0070681_10050336 | Ga0070681_100503362 | 247 |
| 831 | 3300005530 | Ga0070679_100258544 | Ga0070679_1002585442 | 247 |
| 832 | 3300005539 | Ga0068853_100033484 | Ga0068853_1000334842 | 247 |
| 833 | 3300005545 | Ga0070695_100307653 | Ga0070695_1003076532 | 247 |
| 834 | 3300005563 | Ga0068855_100000852 | Ga0068855_10000085211 | 247 |
| 835 | 3300005564 | Ga0070664_100007701 | Ga0070664_10000770111 | 247 |
| 836 | 3300005614 | Ga0068856_100000664 | Ga0068856_10000066411 | 247 |
| 837 | 3300005616 | Ga0068852_100200000 | Ga0068852_1002000002 | 247 |
| 838 | 3300005834 | Ga0068851_10099266 | Ga0068851_100992662 | 247 |
| 839 | 3300013100 | Ga0157373_10005158 | Ga0157373_1000515811 | 247 |
| 840 | 3300013102 | Ga0157371_10001509 | Ga0157371_1000150922 | 247 |
| 841 | 3300013105 | Ga0157369_10068515 | Ga0157369_100685152 | 247 |
| 842 | 3300014969 | Ga0157376_10288006 | Ga0157376_102880062 | 247 |
| 843 | 3300025912 | Ga0207707_10116986 | Ga0207707_101169862 | 247 |
| 844 | 3300025926 | Ga0207659_10494344 | Ga0207659_104943441 | 247 |
| 845 | 3300025942 | Ga0207689_10183018 | Ga0207689_101830182 | 247 |
| 846 | 3300025986 | Ga0207658_10095051 | Ga0207658_100950512 | 247 |
| 847 | 3300027682 | Ga0209971_1011008 | Ga0209971_10110082 | 247 |
| 848 | 3300027876 | Ga0209974_10014844 | Ga0209974_100148443 | 247 |
| 849 | 3300031548 | Ga0307408_100092217 | Ga0307408_1000922172 | 247 |
| 850 | 3300031731 | Ga0307405_10060768 | Ga0307405_100607682 | 247 |
| 851 | 3300031852 | Ga0307410_10003221 | Ga0307410_100032215 | 247 |
| 852 | 3300031901 | Ga0307406_10139376 | Ga0307406_101393762 | 247 |
| 853 | 3300031903 | Ga0307407_10002261 | Ga0307407_100022619 | 247 |
| 854 | 3300031995 | Ga0307409_100202424 | Ga0307409_1002024242 | 247 |
| 855 | 3300032002 | Ga0307416_100004746 | Ga0307416_1000047467 | 247 |
| 856 | 3300032004 | Ga0307414_10069926 | Ga0307414_100699262 | 247 |
| 857 | 3300032005 | Ga0307411_10004725 | Ga0307411_100047259 | 247 |
| 858 | 3300032126 | Ga0307415_100001525 | Ga0307415_10000152515 | 247 |
| 859 | 3300035117 | Ga0373953_0134942 | Ga0373953_0134942_36_863 | 247 |
| 860 | 3300035119 | Ga0373956_0090797 | Ga0373956_0090797_522_1349 | 247 |
| 861 | 3300035724 | Ga0373933_0101208 | Ga0373933_0101208_113_940 | 247 |
| 862 | 3300042876 | Ga0451577_0074025 | Ga0451577_0074025_848_1594 | 248 |
| 863 | 3300044673 | Ga0453683_0267674 | Ga0453683_0267674_29_775 | 248 |
| 864 | 3300044712 | Ga0453684_0038752 | Ga0453684_0038752_1520_2266 | 248 |
| 865 | 3300045051 | Ga0451576_0152462 | Ga0451576_0152462_1478_2224 | 248 |
| 866 | 3300046535 | Ga0495586_0004535 | Ga0495586_0004535_3156_3911 | 249 |
| 867 | 3300005293 | Ga0065715_10446636 | Ga0065715_104466361 | 251 |
| 868 | 3300031852 | Ga0307410_10119550 | Ga0307410_101195501 | 251 |
| 869 | 3300032002 | Ga0307416_100532369 | Ga0307416_1005323692 | 251 |
| 870 | 3300032126 | Ga0307415_100087669 | Ga0307415_1000876692 | 251 |
| 871 | 3300042876 | Ga0451577_0223359 | Ga0451577_0223359_731_1492 | 251 |
| 872 | 3300044712 | Ga0453684_0078214 | Ga0453684_0078214_1847_2608 | 251 |
| 873 | 3300045051 | Ga0451576_0252978 | Ga0451576_0252978_80_841 | 251 |
| 874 | 3300045051 | Ga0451576_0495449 | Ga0451576_0495449_112_873 | 251 |
| 875 | 2162886007 | SwRhRL2b_contig_2542722 | SwRhRL2b_0004.00001520 | 252 |
| 876 | 3300005289 | Ga0065704_10003802 | Ga0065704_100038022 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8snh-assembly1.cif.gz_M | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.8075 | 32 | 248 |
| 8snh-assembly1.cif.gz_M | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.7931 | 32 | 248 |
| 8snh-assembly1.cif.gz_J | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.7475 | 32 | 248 |
| 8snh-assembly1.cif.gz_J | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.7003 | 32 | 248 |
| 2yiu-assembly1.cif.gz_E | x-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution | 0.6629 | 41 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PNS7_2_227_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6859 | 168 | 189 | 2.130.10.10 |
| 2ex3K05 | Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 5 | 0.5987 | 166 | 192 | 4.10.80.20 |
| af_D3ZZ42_329_426_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.5799 | 165 | 184 | 2.110.10.10 |
| 2ex3K05 | Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 5 | 0.5719 | 166 | 192 | 4.10.80.20 |
| af_A4HRF4_4_304_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.5686 | 165 | 192 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3T4F5-F1-model_v4 | Ubiquinol-cytochrome C reductase | 0.9104 | 52 | 137 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A3D3T4F5-F1-model_v4 | Ubiquinol-cytochrome C reductase | 0.9007 | 52 | 137 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A2A5A6F7-F1-model_v4 | Cytochrome C | 0.8454 | 23 | 252 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A2A5A6F7-F1-model_v4 | Cytochrome C | 0.83 | 23 | 252 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A7X5SBL7-F1-model_v4 | Cytochrome c1 | 0.8263 | 26 | 169 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar