F484366

General Info

Members Datasets Scaffolds Average Seq Length
876 331 876 261

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0152726|Ga0496106_0152726_944_1795
Length 283
Sequence VVHRARRDEAGAGKGDLEMKTVIRWIGVVLLVAASGAFAAEAGLRLDPAPGRRLDHESLQRGARDFVNYCLTCHSAQYMRYNRLTDLGLNEQQIRDNLMFATDKIGSTMTVAMTKADATAWFGAPPPDLSVEARVRGADWLYSYLNAFYRDEKAPSGWNNLVFPNVAMPHVLWAVQGVNKLVETEYEDREKAEAAWIAAKGLAKLERAADGKYVVKTLAQQTPGSLSPVEYKALVADLVNYLGYMAEPARNQRINAGIAVLIFLGVLFAFAYALKRDYWRDVH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
241 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
242 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
245 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.34
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2542722 2162886007 Bacteria 3487
2 JGI24743J22301_10000670 3300001991 Bacteria 4204
3 Ga0065704_10003802 3300005289 Bacteria 3792
4 Ga0065712_10002008 3300005290 Bacteria 5397
5 Ga0065715_10001695 3300005293 Bacteria 5749
6 Ga0065715_10016770 3300005293 Bacteria 1961
7 Ga0065715_10233042 3300005293 Bacteria 1224
8 Ga0065715_10446636 3300005293 Bacteria 830
9 Ga0065707_10142604 3300005295 Bacteria 1753
10 Ga0070658_10110098 3300005327 Bacteria 2281
11 Ga0070658_10219464 3300005327 Bacteria 1607
12 Ga0070676_10000209 3300005328 Bacteria 24884
13 Ga0070676_10000253 3300005328 Bacteria 23246
14 Ga0070676_10054820 3300005328 Bacteria 2351
15 Ga0070676_10086327 3300005328 Bacteria 1914
16 Ga0070676_10137278 3300005328 Bacteria 1553
17 Ga0070676_10501395 3300005328 Bacteria 862
18 Ga0070683_100028011 3300005329 Bacteria 5087
19 Ga0070683_100157463 3300005329 Bacteria 2154
20 Ga0070683_100229543 3300005329 Bacteria 1765
21 Ga0070690_100003569 3300005330 Bacteria 8537
22 Ga0070690_100019760 3300005330 Bacteria 4096
23 Ga0070690_100175169 3300005330 Bacteria 1479
24 Ga0070670_100026783 3300005331 Bacteria 4959
25 Ga0070670_100040265 3300005331 Bacteria 4019
26 Ga0070670_100049505 3300005331 Bacteria 3613
27 Ga0070670_100053429 3300005331 Bacteria 3469
28 Ga0070670_100058515 3300005331 Bacteria 3308
29 Ga0070670_100111365 3300005331 Bacteria 2359
30 Ga0070670_100445016 3300005331 Bacteria 1148
31 Ga0070670_100493933 3300005331 Bacteria 1088
32 Ga0070677_10000328 3300005333 Bacteria 16612
33 Ga0070677_10035804 3300005333 Bacteria 1927
34 Ga0068869_100000066 3300005334 Bacteria 47457
35 Ga0068869_100015982 3300005334 Bacteria 5051
36 Ga0068869_100041944 3300005334 Bacteria 3278
37 Ga0068869_100071189 3300005334 Bacteria 2574
38 Ga0068869_100125751 3300005334 Bacteria 1966
39 Ga0068869_100440178 3300005334 Bacteria 1079
40 Ga0070666_10005215 3300005335 Bacteria 7957
41 Ga0070666_10011040 3300005335 Bacteria 5661
42 Ga0070666_10016139 3300005335 Bacteria 4772
43 Ga0070666_10028634 3300005335 Bacteria 3656
44 Ga0070666_10091534 3300005335 Bacteria 2089
45 Ga0070680_100006224 3300005336 Bacteria 9055
46 Ga0070680_100025860 3300005336 Bacteria 4694
47 Ga0068868_100009045 3300005338 Bacteria 7150
48 Ga0068868_100024910 3300005338 Bacteria 4544
49 Ga0068868_100026954 3300005338 Bacteria 4381
50 Ga0068868_100048068 3300005338 Bacteria 3346
51 Ga0068868_100086487 3300005338 Bacteria 2520
52 Ga0068868_100091901 3300005338 Bacteria 2445
53 Ga0068868_100121103 3300005338 Bacteria 2134
54 Ga0070660_100010354 3300005339 Bacteria 6588
55 Ga0070660_100152343 3300005339 Bacteria 1859
56 Ga0070689_100003075 3300005340 Bacteria 10993
57 Ga0070689_100046367 3300005340 Bacteria 3349
58 Ga0070689_100144075 3300005340 Bacteria 1918
59 Ga0070691_10079199 3300005341 Bacteria 1606
60 Ga0070687_100017773 3300005343 Bacteria 3278
61 Ga0070687_100022003 3300005343 Bacteria 3007
62 Ga0070661_100003414 3300005344 Bacteria 10969
63 Ga0070661_100004272 3300005344 Bacteria 9853
64 Ga0070661_100031240 3300005344 Bacteria 3849
65 Ga0070661_100099154 3300005344 Bacteria 2164
66 Ga0070661_100151788 3300005344 Bacteria 1751
67 Ga0070692_10051933 3300005345 Bacteria 2134
68 Ga0070692_10188557 3300005345 Bacteria 1200
69 Ga0070668_100000817 3300005347 Bacteria 21469
70 Ga0070668_100002086 3300005347 Bacteria 14617
71 Ga0070668_100005793 3300005347 Bacteria 9164
72 Ga0070668_100008912 3300005347 Bacteria 7449
73 Ga0070668_100043437 3300005347 Bacteria 3447
74 Ga0070668_100047104 3300005347 Bacteria 3313
75 Ga0070668_100060269 3300005347 Bacteria 2938
76 Ga0070668_100504260 3300005347 Bacteria 1048
77 Ga0070669_100012967 3300005353 Bacteria 5921
78 Ga0070669_100017596 3300005353 Bacteria 5098
79 Ga0070669_100145976 3300005353 Bacteria 1828
80 Ga0070669_100173853 3300005353 Bacteria 1681
81 Ga0070669_100216942 3300005353 Bacteria 1511
82 Ga0070669_100278533 3300005353 Bacteria 1339
83 Ga0070675_100000831 3300005354 Bacteria 21825
84 Ga0070675_100033312 3300005354 Bacteria 4176
85 Ga0070675_100081135 3300005354 Bacteria 2705
86 Ga0070675_100114564 3300005354 Bacteria 2284
87 Ga0070675_100120696 3300005354 Bacteria 2227
88 Ga0070675_100171980 3300005354 Bacteria 1868
89 Ga0070671_100005474 3300005355 Bacteria 10130
90 Ga0070671_100013306 3300005355 Bacteria 6633
91 Ga0070671_100028879 3300005355 Bacteria 4570
92 Ga0070671_100053436 3300005355 Bacteria 3358
93 Ga0070671_100059696 3300005355 Bacteria 3174
94 Ga0070671_100233563 3300005355 Bacteria 1561
95 Ga0070671_100315787 3300005355 Bacteria 1331
96 Ga0070671_100354965 3300005355 Bacteria 1252
97 Ga0070674_100012630 3300005356 Bacteria 5191
98 Ga0070674_100016927 3300005356 Bacteria 4575
99 Ga0070674_100117767 3300005356 Bacteria 1962
100 Ga0070674_100246006 3300005356 Bacteria 1403
101 Ga0070674_100271509 3300005356 Bacteria 1340
102 Ga0070673_100000413 3300005364 Bacteria 22545
103 Ga0070673_100010128 3300005364 Bacteria 6365
104 Ga0070673_100012723 3300005364 Bacteria 5788
105 Ga0070673_100055309 3300005364 Bacteria 3126
106 Ga0070673_100206106 3300005364 Bacteria 1696
107 Ga0070673_100303291 3300005364 Bacteria 1407
108 Ga0070673_100416057 3300005364 Bacteria 1204
109 Ga0070673_100536363 3300005364 Unclassified 1062
110 Ga0070688_100001381 3300005365 Bacteria 12063
111 Ga0070688_100161482 3300005365 Bacteria 1540
112 Ga0070688_100170794 3300005365 Bacteria 1500
113 Ga0070659_100001024 3300005366 Bacteria 20502
114 Ga0070659_100019972 3300005366 Bacteria 5086
115 Ga0070667_100002478 3300005367 Bacteria 16112
116 Ga0070667_100007387 3300005367 Bacteria 9126
117 Ga0070667_100045307 3300005367 Bacteria 3697
118 Ga0070667_100077085 3300005367 Bacteria 2846
119 Ga0070667_100105466 3300005367 Bacteria 2439
120 Ga0070667_100378482 3300005367 Bacteria 1285
121 Ga0070667_100389000 3300005367 Bacteria 1268
122 Ga0070709_10048079 3300005434 Bacteria 2660
123 Ga0070714_100007228 3300005435 Bacteria 8623
124 Ga0070714_100070272 3300005435 Bacteria 3026
125 Ga0070713_100006522 3300005436 Bacteria 8102
126 Ga0070713_100018888 3300005436 Bacteria 5248
127 Ga0070710_10047733 3300005437 Bacteria 2389
128 Ga0070711_100042907 3300005439 Bacteria 3060
129 Ga0070711_100165423 3300005439 Bacteria 1681
130 Ga0070705_100099259 3300005440 Bacteria 1834
131 Ga0070700_100012772 3300005441 Bacteria 4701
132 Ga0070700_100012956 3300005441 Bacteria 4674
133 Ga0070694_100043441 3300005444 Bacteria 3005
134 Ga0070694_100149410 3300005444 Bacteria 1705
135 Ga0070708_100000226 3300005445 Bacteria 42003
136 Ga0070708_100102612 3300005445 Bacteria 2621
137 Ga0070663_100007890 3300005455 Bacteria 6514
138 Ga0070663_100036009 3300005455 Bacteria 3437
139 Ga0070663_100136139 3300005455 Bacteria 1870
140 Ga0070663_100157130 3300005455 Bacteria 1748
141 Ga0070663_100222956 3300005455 Bacteria 1481
142 Ga0070663_100265503 3300005455 Bacteria 1363
143 Ga0070678_100002430 3300005456 Bacteria 10211
144 Ga0070678_100002693 3300005456 Bacteria 9797
145 Ga0070678_100003724 3300005456 Bacteria 8534
146 Ga0070678_100008098 3300005456 Bacteria 6276
147 Ga0070678_100817332 3300005456 Bacteria 847
148 Ga0070662_100000907 3300005457 Bacteria 18094
149 Ga0070662_100031395 3300005457 Bacteria 3728
150 Ga0070662_100037518 3300005457 Bacteria 3436
151 Ga0070662_100132420 3300005457 Bacteria 1924
152 Ga0070662_100159063 3300005457 Bacteria 1766
153 Ga0070662_100286871 3300005457 Bacteria 1333
154 Ga0070681_10050336 3300005458 Bacteria 4157
155 Ga0070681_10088009 3300005458 Bacteria 3058
156 Ga0070681_10146322 3300005458 Bacteria 2292
157 Ga0068867_100001614 3300005459 Bacteria 15670
158 Ga0068867_100003602 3300005459 Bacteria 10898
159 Ga0068867_100010593 3300005459 Bacteria 6506
160 Ga0068867_100015427 3300005459 Bacteria 5419
161 Ga0068867_100374808 3300005459 Bacteria 1194
162 Ga0070685_10004436 3300005466 Bacteria 7093
163 Ga0070685_10007773 3300005466 Bacteria 5488
164 Ga0070706_100021806 3300005467 Bacteria 5898
165 Ga0070707_100248985 3300005468 Bacteria 1729
166 Ga0070679_100025281 3300005530 Bacteria 5825
167 Ga0070679_100258544 3300005530 Bacteria 1696
168 Ga0070684_100002779 3300005535 Bacteria 12960
169 Ga0070684_100048448 3300005535 Bacteria 3686
170 Ga0070684_100059586 3300005535 Bacteria 3338
171 Ga0070684_100152946 3300005535 Bacteria 2091
172 Ga0070697_100010920 3300005536 Bacteria 7093
173 Ga0070697_100017968 3300005536 Bacteria 5572
174 Ga0068853_100016993 3300005539 Bacteria 5998
175 Ga0068853_100033484 3300005539 Bacteria 4360
176 Ga0068853_100037114 3300005539 Bacteria 4145
177 Ga0068853_100352951 3300005539 Bacteria 1368
178 Ga0068853_100407324 3300005539 Bacteria 1274
179 Ga0070672_100001217 3300005543 Bacteria 15789
180 Ga0070672_100002335 3300005543 Bacteria 11999
181 Ga0070672_100015341 3300005543 Bacteria 5453
182 Ga0070672_100142996 3300005543 Bacteria 1975
183 Ga0070672_100522252 3300005543 Unclassified 1029
184 Ga0070686_100051635 3300005544 Bacteria 2618
185 Ga0070686_100069118 3300005544 Bacteria 2306
186 Ga0070695_100013581 3300005545 Bacteria 4895
187 Ga0070695_100281063 3300005545 Bacteria 1223
188 Ga0070695_100307653 3300005545 Bacteria 1174
189 Ga0070696_100010800 3300005546 Bacteria 6118
190 Ga0070696_100078471 3300005546 Bacteria 2335
191 Ga0070696_100257180 3300005546 Bacteria 1323
192 Ga0070693_100004709 3300005547 Bacteria 6486
193 Ga0070693_100009846 3300005547 Bacteria 4767
194 Ga0070665_100001378 3300005548 Bacteria 28614
195 Ga0070665_100008510 3300005548 Bacteria 10377
196 Ga0070665_100017516 3300005548 Bacteria 7194
197 Ga0070704_100128475 3300005549 Bacteria 1960
198 Ga0070704_100139697 3300005549 Bacteria 1889
199 Ga0068855_100000852 3300005563 Bacteria 37837
200 Ga0068855_100001414 3300005563 Bacteria 29795
201 Ga0068855_100002157 3300005563 Bacteria 24326
202 Ga0070664_100001435 3300005564 Bacteria 19005
203 Ga0070664_100007701 3300005564 Bacteria 8698
204 Ga0070664_100038600 3300005564 Bacteria 4020
205 Ga0070664_100061713 3300005564 Bacteria 3195
206 Ga0068857_100000326 3300005577 Bacteria 32742
207 Ga0068857_100003154 3300005577 Bacteria 13663
208 Ga0068857_100020455 3300005577 Bacteria 5821
209 Ga0068857_100265166 3300005577 Bacteria 1577
210 Ga0068854_100001495 3300005578 Bacteria 14165
211 Ga0068854_100013835 3300005578 Bacteria 5306
212 Ga0068854_100016025 3300005578 Bacteria 4985
213 Ga0068854_100018625 3300005578 Bacteria 4665
214 Ga0068854_100255146 3300005578 Bacteria 1402
215 Ga0068856_100000664 3300005614 Bacteria 37278
216 Ga0068856_100009494 3300005614 Bacteria 9446
217 Ga0068856_100039254 3300005614 Bacteria 4648
218 Ga0068856_100067794 3300005614 Bacteria 3526
219 Ga0068856_100392434 3300005614 Bacteria 1407
220 Ga0070702_100017084 3300005615 Bacteria 3735
221 Ga0070702_100373043 3300005615 Bacteria 1012
222 Ga0068852_100002200 3300005616 Bacteria 13385
223 Ga0068852_100013233 3300005616 Bacteria 6307
224 Ga0068852_100029101 3300005616 Bacteria 4532
225 Ga0068852_100183219 3300005616 Bacteria 1970
226 Ga0068852_100200000 3300005616 Bacteria 1891
227 Ga0068852_100280594 3300005616 Bacteria 1606
228 Ga0068852_100344394 3300005616 Bacteria 1454
229 Ga0068859_100000398 3300005617 Bacteria 43145
230 Ga0068859_100001650 3300005617 Bacteria 22761
231 Ga0068859_100011314 3300005617 Bacteria 8979
232 Ga0068859_100026072 3300005617 Bacteria 5864
233 Ga0068864_100002525 3300005618 Bacteria 15118
234 Ga0068864_100007124 3300005618 Bacteria 9185
235 Ga0068864_100013967 3300005618 Bacteria 6658
236 Ga0068864_100082545 3300005618 Bacteria 2820
237 Ga0068866_10002008 3300005718 Bacteria 8468
238 Ga0068861_100008052 3300005719 Bacteria 7250
239 Ga0068861_100024048 3300005719 Bacteria 4401
240 Ga0068861_100036158 3300005719 Bacteria 3664
241 Ga0068861_100042928 3300005719 Bacteria 3391
242 Ga0068861_100146840 3300005719 Bacteria 1931
243 Ga0068861_100269395 3300005719 Bacteria 1462
244 Ga0068861_100317382 3300005719 Bacteria 1356
245 Ga0068861_100517404 3300005719 Bacteria 1082
246 Ga0068851_10000383 3300005834 Bacteria 20034
247 Ga0068851_10039830 3300005834 Bacteria 2361
248 Ga0068851_10062316 3300005834 Bacteria 1913
249 Ga0068851_10099266 3300005834 Bacteria 1543
250 Ga0068870_10006811 3300005840 Bacteria 5065
251 Ga0068870_10010159 3300005840 Bacteria 4310
252 Ga0068870_10021475 3300005840 Bacteria 3158
253 Ga0068870_10061781 3300005840 Bacteria 2015
254 Ga0068870_10064707 3300005840 Bacteria 1976
255 Ga0068863_100000366 3300005841 Bacteria 45953
256 Ga0068863_100001407 3300005841 Bacteria 23854
257 Ga0068863_100013405 3300005841 Bacteria 7904
258 Ga0068863_100054046 3300005841 Bacteria 3806
259 Ga0068863_100218344 3300005841 Bacteria 1836
260 Ga0068863_100534934 3300005841 Bacteria 1156
261 Ga0068863_100550993 3300005841 Bacteria 1139
262 Ga0068858_100000615 3300005842 Bacteria 37292
263 Ga0068858_100000781 3300005842 Bacteria 33250
264 Ga0068858_100036643 3300005842 Bacteria 4548
265 Ga0068858_100122012 3300005842 Bacteria 2438
266 Ga0068858_100141655 3300005842 Bacteria 2257
267 Ga0068858_100334884 3300005842 Bacteria 1448
268 Ga0068858_100345992 3300005842 Bacteria 1423
269 Ga0068860_100031322 3300005843 Bacteria 5112
270 Ga0068860_100035908 3300005843 Bacteria 4752
271 Ga0068860_100074296 3300005843 Bacteria 3232
272 Ga0068860_100087976 3300005843 Bacteria 2957
273 Ga0068860_100224056 3300005843 Bacteria 1826
274 Ga0068862_100008666 3300005844 Bacteria 8412
275 Ga0068862_100013912 3300005844 Bacteria 6670
276 Ga0068862_100065631 3300005844 Bacteria 3127
277 Ga0068862_100112173 3300005844 Bacteria 2394
278 Ga0068862_100150051 3300005844 Bacteria 2074
279 Ga0068862_100193012 3300005844 Bacteria 1833
280 Ga0070717_10230702 3300006028 Bacteria 1630
281 Ga0070715_10015069 3300006163 Bacteria 2877
282 Ga0070716_100029452 3300006173 Bacteria 2969
283 Ga0070712_100009734 3300006175 Bacteria 6059
284 Ga0070712_100134119 3300006175 Bacteria 1880
285 Ga0097621_100003826 3300006237 Bacteria 10426
286 Ga0097621_100005074 3300006237 Bacteria 9252
287 Ga0097621_100019709 3300006237 Bacteria 5185
288 Ga0097621_100049676 3300006237 Bacteria 3408
289 Ga0097621_100174127 3300006237 Bacteria 1857
290 Ga0097621_100232233 3300006237 Bacteria 1611
291 Ga0068871_100020561 3300006358 Bacteria 5059
292 Ga0068871_100022284 3300006358 Bacteria 4883
293 Ga0068871_100035062 3300006358 Bacteria 3985
294 Ga0068871_100588179 3300006358 Bacteria 1011
295 Ga0075428_100009793 3300006844 Bacteria 10650
296 Ga0075430_100394080 3300006846 Bacteria 1143
297 Ga0075431_100017650 3300006847 Bacteria 7256
298 Ga0075434_100279564 3300006871 Bacteria 1689
299 Ga0068865_100014955 3300006881 Bacteria 4942
300 Ga0068865_100068642 3300006881 Bacteria 2506
301 Ga0068865_100126138 3300006881 Bacteria 1911
302 Ga0068865_100154050 3300006881 Bacteria 1746
303 Ga0097620_100000398 3300006931 Bacteria 43145
304 Ga0097620_100001650 3300006931 Bacteria 22761
305 Ga0097620_100011314 3300006931 Bacteria 8979
306 Ga0097620_100026072 3300006931 Bacteria 5864
307 Ga0075435_100362083 3300007076 Bacteria 1244
308 Ga0075435_100505501 3300007076 Bacteria 1045
309 Ga0105251_10164455 3300009011 Bacteria 1000
310 Ga0105240_10015929 3300009093 Bacteria 10197
311 Ga0105240_10056346 3300009093 Bacteria 4919
312 Ga0111539_10012267 3300009094 Bacteria 10744
313 Ga0111539_10041702 3300009094 Bacteria 5516
314 Ga0111539_10798034 3300009094 Bacteria 1099
315 Ga0105245_10033582 3300009098 Bacteria 4548
316 Ga0105245_10096955 3300009098 Bacteria 2722
317 Ga0105247_10012621 3300009101 Bacteria 5073
318 Ga0105247_10065316 3300009101 Bacteria 2263
319 Ga0114129_10493286 3300009147 Bacteria 1601
320 Ga0114129_10659995 3300009147 Bacteria 1349
321 Ga0105241_10011819 3300009174 Bacteria 6412
322 Ga0105241_10089380 3300009174 Bacteria 2427
323 Ga0105241_10358364 3300009174 Bacteria 1268
324 Ga0105241_10715616 3300009174 Bacteria 915
325 Ga0105242_10013861 3300009176 Bacteria 6237
326 Ga0105242_10126433 3300009176 Bacteria 2201
327 Ga0105242_10768953 3300009176 Bacteria 950
328 Ga0105248_10003381 3300009177 Bacteria 17733
329 Ga0105248_10024842 3300009177 Bacteria 6661
330 Ga0105248_10057815 3300009177 Bacteria 4354
331 Ga0105248_10159694 3300009177 Bacteria 2543
332 Ga0105248_10221761 3300009177 Bacteria 2128
333 Ga0105237_10250278 3300009545 Bacteria 1774
334 Ga0105237_10256046 3300009545 Bacteria 1752
335 Ga0105237_10362532 3300009545 Bacteria 1454
336 Ga0105238_10000556 3300009551 Bacteria 39015
337 Ga0105238_10058562 3300009551 Bacteria 3860
338 Ga0105249_10075642 3300009553 Bacteria 3119
339 Ga0105249_10236167 3300009553 Bacteria 1805
340 Ga0105239_11186336 3300010375 Bacteria 880
341 Ga0157313_1004244 3300012503 Bacteria 974
342 Ga0157373_10005158 3300013100 Bacteria 9815
343 Ga0157373_10054390 3300013100 Bacteria 2844
344 Ga0157371_10001509 3300013102 Bacteria 24045
345 Ga0157371_10091083 3300013102 Bacteria 2160
346 Ga0157371_10156499 3300013102 Bacteria 1626
347 Ga0157371_10453133 3300013102 Bacteria 943
348 Ga0157370_10060029 3300013104 Bacteria 3612
349 Ga0157370_10105890 3300013104 Bacteria 2632
350 Ga0157370_10214273 3300013104 Bacteria 1784
351 Ga0157370_10235754 3300013104 Bacteria 1693
352 Ga0157369_10036084 3300013105 Bacteria 5419
353 Ga0157369_10068515 3300013105 Bacteria 3812
354 Ga0157369_10110699 3300013105 Bacteria 2919
355 Ga0157374_10000460 3300013296 Bacteria 37061
356 Ga0157374_10000652 3300013296 Bacteria 30624
357 Ga0157374_10007334 3300013296 Bacteria 9404
358 Ga0157374_10044664 3300013296 Bacteria 4095
359 Ga0157374_10051984 3300013296 Bacteria 3814
360 Ga0157374_10151285 3300013296 Bacteria 2256
361 Ga0157378_10017983 3300013297 Bacteria 6205
362 Ga0157378_10075050 3300013297 Bacteria 3043
363 Ga0157378_10280144 3300013297 Bacteria 1607
364 Ga0157378_10293937 3300013297 Bacteria 1570
365 Ga0157378_10302991 3300013297 Bacteria 1547
366 Ga0163162_10015881 3300013306 Bacteria 7358
367 Ga0163162_10057423 3300013306 Bacteria 3920
368 Ga0163162_10066621 3300013306 Bacteria 3650
369 Ga0163162_10240711 3300013306 Bacteria 1940
370 Ga0157372_10015144 3300013307 Bacteria 8253
371 Ga0157372_10028920 3300013307 Bacteria 6047
372 Ga0157372_10059945 3300013307 Bacteria 4258
373 Ga0157372_10186556 3300013307 Bacteria 2402
374 Ga0157375_10000922 3300013308 Bacteria 25513
375 Ga0157375_10008960 3300013308 Bacteria 8756
376 Ga0157375_10024378 3300013308 Bacteria 5598
377 Ga0157375_10127459 3300013308 Bacteria 2662
378 Ga0157375_10307387 3300013308 Bacteria 1750
379 Ga0157375_10808022 3300013308 Bacteria 1086
380 Ga0157375_10808616 3300013308 Bacteria 1086
381 Ga0163163_10012877 3300014325 Bacteria 7637
382 Ga0163163_10102090 3300014325 Bacteria 2891
383 Ga0157380_10182686 3300014326 Bacteria 1844
384 Ga0157380_10185317 3300014326 Bacteria 1833
385 Ga0157380_10335601 3300014326 Bacteria 1408
386 Ga0157380_10356854 3300014326 Unclassified 1370
387 Ga0182008_10157950 3300014497 Bacteria 1140
388 Ga0157377_10089189 3300014745 Bacteria 1817
389 Ga0157379_10001318 3300014968 Bacteria 20255
390 Ga0157379_10003843 3300014968 Bacteria 12803
391 Ga0157379_10003993 3300014968 Bacteria 12576
392 Ga0157379_10036140 3300014968 Bacteria 4405
393 Ga0157376_10030581 3300014969 Bacteria 4301
394 Ga0157376_10044611 3300014969 Bacteria 3645
395 Ga0157376_10057257 3300014969 Bacteria 3259
396 Ga0157376_10163303 3300014969 Bacteria 2021
397 Ga0157376_10175518 3300014969 Bacteria 1954
398 Ga0157376_10193816 3300014969 Bacteria 1865
399 Ga0157376_10288006 3300014969 Bacteria 1550
400 Ga0163161_10012517 3300017792 Bacteria 5890
401 Ga0207697_10010060 3300025315 Bacteria 4062
402 Ga0207697_10034268 3300025315 Bacteria 2078
403 Ga0207656_10128849 3300025321 Bacteria 1184
404 Ga0207682_10001544 3300025893 Bacteria 10577
405 Ga0207682_10002336 3300025893 Bacteria 8551
406 Ga0207682_10039663 3300025893 Bacteria 1916
407 Ga0207682_10090778 3300025893 Bacteria 1324
408 Ga0207692_10076306 3300025898 Bacteria 1780
409 Ga0207642_10002936 3300025899 Bacteria 5336
410 Ga0207642_10009668 3300025899 Bacteria 3365
411 Ga0207642_10029981 3300025899 Bacteria 2260
412 Ga0207710_10049544 3300025900 Bacteria 1882
413 Ga0207688_10018407 3300025901 Bacteria 3801
414 Ga0207688_10081412 3300025901 Bacteria 1849
415 Ga0207680_10001232 3300025903 Bacteria 12087
416 Ga0207680_10005392 3300025903 Bacteria 6110
417 Ga0207680_10008165 3300025903 Bacteria 5129
418 Ga0207680_10053415 3300025903 Bacteria 2425
419 Ga0207680_10162479 3300025903 Bacteria 1499
420 Ga0207699_10086441 3300025906 Bacteria 1958
421 Ga0207645_10000197 3300025907 Bacteria 49246
422 Ga0207645_10000209 3300025907 Bacteria 48175
423 Ga0207645_10000283 3300025907 Bacteria 42259
424 Ga0207645_10006292 3300025907 Bacteria 8534
425 Ga0207645_10051958 3300025907 Bacteria 2619
426 Ga0207645_10157111 3300025907 Bacteria 1486
427 Ga0207645_10256083 3300025907 Bacteria 1159
428 Ga0207645_10258553 3300025907 Bacteria 1153
429 Ga0207643_10003271 3300025908 Bacteria 8750
430 Ga0207643_10033446 3300025908 Bacteria 2877
431 Ga0207643_10072236 3300025908 Bacteria 1987
432 Ga0207643_10117100 3300025908 Bacteria 1575
433 Ga0207705_10060403 3300025909 Bacteria 2738
434 Ga0207684_10036155 3300025910 Bacteria 4192
435 Ga0207654_10023310 3300025911 Bacteria 3314
436 Ga0207707_10116986 3300025912 Bacteria 2330
437 Ga0207707_10221171 3300025912 Bacteria 1648
438 Ga0207695_10083819 3300025913 Bacteria 3220
439 Ga0207671_10117016 3300025914 Bacteria 2034
440 Ga0207671_10206525 3300025914 Bacteria 1535
441 Ga0207693_10000364 3300025915 Bacteria 41420
442 Ga0207693_10161475 3300025915 Bacteria 1763
443 Ga0207663_10033753 3300025916 Bacteria 3052
444 Ga0207663_10073440 3300025916 Bacteria 2214
445 Ga0207660_10027395 3300025917 Bacteria 3888
446 Ga0207660_10075921 3300025917 Bacteria 2456
447 Ga0207660_10132305 3300025917 Bacteria 1900
448 Ga0207660_10163495 3300025917 Bacteria 1719
449 Ga0207662_10005532 3300025918 Bacteria 6748
450 Ga0207662_10022887 3300025918 Bacteria 3586
451 Ga0207657_10000469 3300025919 Bacteria 42688
452 Ga0207657_10021361 3300025919 Bacteria 6094
453 Ga0207657_10041205 3300025919 Bacteria 4085
454 Ga0207657_10460832 3300025919 Bacteria 997
455 Ga0207649_10003824 3300025920 Bacteria 8209
456 Ga0207649_10029099 3300025920 Bacteria 3260
457 Ga0207649_10055632 3300025920 Bacteria 2467
458 Ga0207652_10388398 3300025921 Bacteria 1260
459 Ga0207646_10311560 3300025922 Bacteria 1422
460 Ga0207681_10009719 3300025923 Bacteria 5887
461 Ga0207681_10013116 3300025923 Bacteria 5123
462 Ga0207681_10018393 3300025923 Bacteria 4402
463 Ga0207681_10027055 3300025923 Bacteria 3706
464 Ga0207681_10031234 3300025923 Bacteria 3477
465 Ga0207681_10407575 3300025923 Bacteria 1099
466 Ga0207694_10034063 3300025924 Bacteria 3904
467 Ga0207694_10037959 3300025924 Bacteria 3703
468 Ga0207694_10238188 3300025924 Bacteria 1487
469 Ga0207650_10011697 3300025925 Bacteria 6047
470 Ga0207650_10025986 3300025925 Bacteria 4174
471 Ga0207650_10041629 3300025925 Bacteria 3367
472 Ga0207650_10049418 3300025925 Bacteria 3105
473 Ga0207650_10127211 3300025925 Bacteria 1990
474 Ga0207650_10209229 3300025925 Bacteria 1566
475 Ga0207650_10338306 3300025925 Bacteria 1236
476 Ga0207650_10421244 3300025925 Bacteria 1108
477 Ga0207659_10006299 3300025926 Bacteria 7259
478 Ga0207659_10026654 3300025926 Bacteria 3902
479 Ga0207659_10046226 3300025926 Bacteria 3073
480 Ga0207659_10047274 3300025926 Bacteria 3043
481 Ga0207659_10060647 3300025926 Bacteria 2723
482 Ga0207659_10130426 3300025926 Bacteria 1939
483 Ga0207659_10494344 3300025926 Bacteria 1035
484 Ga0207687_10011521 3300025927 Bacteria 5780
485 Ga0207687_10019080 3300025927 Bacteria 4539
486 Ga0207687_10098812 3300025927 Bacteria 2143
487 Ga0207700_10046327 3300025928 Bacteria 3215
488 Ga0207664_10011014 3300025929 Bacteria 6406
489 Ga0207664_10246055 3300025929 Bacteria 1559
490 Ga0207644_10002553 3300025931 Bacteria 11714
491 Ga0207644_10014446 3300025931 Bacteria 5281
492 Ga0207644_10018086 3300025931 Bacteria 4765
493 Ga0207644_10061645 3300025931 Bacteria 2717
494 Ga0207644_10085018 3300025931 Bacteria 2346
495 Ga0207644_10326948 3300025931 Bacteria 1241
496 Ga0207644_10374705 3300025931 Unclassified 1160
497 Ga0207690_10041382 3300025932 Bacteria 3019
498 Ga0207706_10000427 3300025933 Bacteria 45237
499 Ga0207706_10002869 3300025933 Bacteria 16715
500 Ga0207706_10004812 3300025933 Bacteria 12648
501 Ga0207706_10059942 3300025933 Bacteria 3352
502 Ga0207706_10184127 3300025933 Bacteria 1834
503 Ga0207686_10001274 3300025934 Bacteria 14490
504 Ga0207686_10090782 3300025934 Bacteria 2016
505 Ga0207709_10132541 3300025935 Bacteria 1700
506 Ga0207670_10009367 3300025936 Bacteria 5587
507 Ga0207670_10097717 3300025936 Bacteria 2091
508 Ga0207670_10100518 3300025936 Bacteria 2065
509 Ga0207670_10127527 3300025936 Bacteria 1859
510 Ga0207669_10004815 3300025937 Bacteria 5991
511 Ga0207669_10005862 3300025937 Bacteria 5557
512 Ga0207669_10009402 3300025937 Bacteria 4653
513 Ga0207669_10134348 3300025937 Bacteria 1706
514 Ga0207704_10016388 3300025938 Bacteria 3807
515 Ga0207704_10091085 3300025938 Bacteria 2003
516 Ga0207704_10153551 3300025938 Bacteria 1628
517 Ga0207665_10043258 3300025939 Bacteria 3011
518 Ga0207665_10497834 3300025939 Bacteria 941
519 Ga0207691_10000153 3300025940 Bacteria 64312
520 Ga0207691_10000546 3300025940 Bacteria 37681
521 Ga0207691_10000868 3300025940 Bacteria 30058
522 Ga0207691_10011464 3300025940 Bacteria 8506
523 Ga0207691_10043897 3300025940 Bacteria 4117
524 Ga0207691_10092480 3300025940 Bacteria 2709
525 Ga0207691_10127993 3300025940 Bacteria 2245
526 Ga0207711_10000185 3300025941 Bacteria 66575
527 Ga0207711_10050593 3300025941 Bacteria 3557
528 Ga0207711_10052020 3300025941 Bacteria 3509
529 Ga0207689_10000952 3300025942 Bacteria 27860
530 Ga0207689_10001219 3300025942 Bacteria 24713
531 Ga0207689_10042935 3300025942 Bacteria 3738
532 Ga0207689_10115984 3300025942 Bacteria 2202
533 Ga0207689_10158122 3300025942 Bacteria 1868
534 Ga0207689_10183018 3300025942 Bacteria 1728
535 Ga0207661_10020887 3300025944 Bacteria 4902
536 Ga0207661_10474602 3300025944 Bacteria 1141
537 Ga0207679_10007632 3300025945 Bacteria 6871
538 Ga0207679_10124919 3300025945 Bacteria 2055
539 Ga0207667_10021483 3300025949 Bacteria 7150
540 Ga0207667_10038657 3300025949 Bacteria 5094
541 Ga0207667_10539569 3300025949 Bacteria 1180
542 Ga0207651_10001263 3300025960 Bacteria 11382
543 Ga0207651_10014138 3300025960 Bacteria 4598
544 Ga0207651_10048053 3300025960 Bacteria 2881
545 Ga0207651_10089953 3300025960 Bacteria 2243
546 Ga0207651_10206070 3300025960 Bacteria 1580
547 Ga0207668_10001645 3300025972 Bacteria 13055
548 Ga0207668_10005674 3300025972 Bacteria 7347
549 Ga0207668_10023963 3300025972 Bacteria 3932
550 Ga0207668_10024247 3300025972 Bacteria 3912
551 Ga0207668_10079774 3300025972 Bacteria 2369
552 Ga0207668_10169583 3300025972 Bacteria 1710
553 Ga0207668_10247323 3300025972 Bacteria 1446
554 Ga0207668_10310750 3300025972 Bacteria 1304
555 Ga0207640_10099501 3300025981 Bacteria 2035
556 Ga0207658_10006807 3300025986 Bacteria 7788
557 Ga0207658_10013941 3300025986 Bacteria 5500
558 Ga0207658_10016683 3300025986 Bacteria 5054
559 Ga0207658_10021208 3300025986 Bacteria 4506
560 Ga0207658_10036639 3300025986 Bacteria 3518
561 Ga0207658_10053547 3300025986 Bacteria 2982
562 Ga0207658_10095051 3300025986 Bacteria 2321
563 Ga0207658_10151891 3300025986 Bacteria 1888
564 Ga0207658_10361904 3300025986 Bacteria 1266
565 Ga0207677_10000148 3300026023 Bacteria 56316
566 Ga0207677_10012812 3300026023 Bacteria 4838
567 Ga0207677_10036718 3300026023 Bacteria 3196
568 Ga0207677_10049777 3300026023 Bacteria 2830
569 Ga0207677_10087399 3300026023 Bacteria 2257
570 Ga0207703_10001265 3300026035 Bacteria 23535
571 Ga0207703_10001381 3300026035 Bacteria 22179
572 Ga0207703_10031384 3300026035 Bacteria 4201
573 Ga0207639_10058769 3300026041 Bacteria 2959
574 Ga0207639_10102145 3300026041 Bacteria 2320
575 Ga0207639_10232296 3300026041 Bacteria 1599
576 Ga0207678_10001649 3300026067 Bacteria 20457
577 Ga0207678_10063510 3300026067 Bacteria 3173
578 Ga0207678_10156186 3300026067 Bacteria 1948
579 Ga0207678_10192795 3300026067 Bacteria 1742
580 Ga0207708_10021704 3300026075 Bacteria 4844
581 Ga0207708_10075859 3300026075 Bacteria 2578
582 Ga0207702_10021245 3300026078 Bacteria 5372
583 Ga0207702_10096171 3300026078 Bacteria 2604
584 Ga0207702_10191223 3300026078 Bacteria 1891
585 Ga0207702_10620753 3300026078 Bacteria 1062
586 Ga0207641_10002346 3300026088 Bacteria 17515
587 Ga0207641_10031156 3300026088 Bacteria 4422
588 Ga0207641_10314310 3300026088 Bacteria 1483
589 Ga0207641_10362715 3300026088 Bacteria 1384
590 Ga0207648_10000165 3300026089 Bacteria 68239
591 Ga0207648_10000564 3300026089 Bacteria 41549
592 Ga0207648_10006558 3300026089 Bacteria 11558
593 Ga0207648_10011183 3300026089 Bacteria 8463
594 Ga0207648_10195307 3300026089 Bacteria 1794
595 Ga0207648_10315325 3300026089 Bacteria 1404
596 Ga0207676_10000516 3300026095 Bacteria 32481
597 Ga0207676_10003043 3300026095 Bacteria 11967
598 Ga0207676_10016044 3300026095 Bacteria 5419
599 Ga0207676_10017861 3300026095 Bacteria 5147
600 Ga0207676_10092131 3300026095 Bacteria 2491
601 Ga0207674_10000180 3300026116 Bacteria 77710
602 Ga0207674_10005309 3300026116 Bacteria 15327
603 Ga0207674_10010649 3300026116 Bacteria 10399
604 Ga0207674_10026146 3300026116 Bacteria 6210
605 Ga0207674_10068510 3300026116 Bacteria 3571
606 Ga0207674_10212663 3300026116 Bacteria 1882
607 Ga0207675_100001139 3300026118 Bacteria 26331
608 Ga0207675_100010670 3300026118 Bacteria 8608
609 Ga0207675_100028041 3300026118 Bacteria 5243
610 Ga0207675_100041207 3300026118 Bacteria 4312
611 Ga0207675_100229770 3300026118 Bacteria 1790
612 Ga0207675_100507702 3300026118 Bacteria 1201
613 Ga0207675_100578947 3300026118 Bacteria 1124
614 Ga0207683_10000140 3300026121 Bacteria 59648
615 Ga0207683_10000424 3300026121 Bacteria 39012
616 Ga0207683_10001594 3300026121 Bacteria 20407
617 Ga0207683_10019340 3300026121 Bacteria 5815
618 Ga0207698_10014775 3300026142 Bacteria 5204
619 Ga0207698_10028625 3300026142 Bacteria 3976
620 Ga0207698_10052008 3300026142 Bacteria 3135
621 Ga0207698_10090781 3300026142 Bacteria 2499
622 Ga0209996_1010164 3300027395 Bacteria 1246
623 Ga0209982_1001047 3300027552 Bacteria 3689
624 Ga0210002_1002629 3300027617 Bacteria 2600
625 Ga0209983_1004485 3300027665 Bacteria 2934
626 Ga0209971_1011008 3300027682 Bacteria 2142
627 Ga0209998_10000997 3300027717 Bacteria 7133
628 Ga0209998_10033926 3300027717 Bacteria 1140
629 Ga0209974_10000131 3300027876 Bacteria 22213
630 Ga0209974_10014844 3300027876 Bacteria 2586
631 Ga0207428_10032798 3300027907 Bacteria 4271
632 Ga0268266_10011410 3300028379 Bacteria 7726
633 Ga0268266_10014198 3300028379 Bacteria 6851
634 Ga0268266_10023660 3300028379 Bacteria 5228
635 Ga0268266_10212777 3300028379 Bacteria 1773
636 Ga0268266_10397398 3300028379 Bacteria 1303
637 Ga0268266_10444989 3300028379 Bacteria 1231
638 Ga0268265_10011281 3300028380 Bacteria 6041
639 Ga0268265_10051717 3300028380 Bacteria 3102
640 Ga0268265_10063872 3300028380 Bacteria 2834
641 Ga0268265_10139772 3300028380 Bacteria 2026
642 Ga0268265_10237666 3300028380 Bacteria 1605
643 Ga0268264_10016725 3300028381 Bacteria 6004
644 Ga0268264_10023422 3300028381 Bacteria 5038
645 Ga0268264_10042725 3300028381 Bacteria 3753
646 Ga0268264_10085573 3300028381 Bacteria 2706
647 Ga0268264_10091094 3300028381 Bacteria 2630
648 Ga0268264_10115040 3300028381 Bacteria 2363
649 Ga0268264_10221446 3300028381 Bacteria 1742
650 Ga0268264_10769563 3300028381 Bacteria 960
651 Ga0307408_100037433 3300031548 Bacteria 3417
652 Ga0307408_100067534 3300031548 Bacteria 2630
653 Ga0307408_100092217 3300031548 Bacteria 2289
654 Ga0316575_10007155 3300031665 Bacteria 4038
655 Ga0316576_10001231 3300031727 Bacteria 13538
656 Ga0316578_10136017 3300031728 Bacteria 1479
657 Ga0307405_10026034 3300031731 Bacteria 3368
658 Ga0307405_10060768 3300031731 Bacteria 2386
659 Ga0316577_10024660 3300031733 Bacteria 3344
660 Ga0307410_10003221 3300031852 Bacteria 8143
661 Ga0307410_10117281 3300031852 Bacteria 1935
662 Ga0307410_10119550 3300031852 Bacteria 1919
663 Ga0307406_10139376 3300031901 Bacteria 1714
664 Ga0307406_10278024 3300031901 Bacteria 1275
665 Ga0307407_10002261 3300031903 Bacteria 7453
666 Ga0307412_10056231 3300031911 Bacteria 2621
667 Ga0307412_10270832 3300031911 Bacteria 1329
668 Ga0307409_100202424 3300031995 Bacteria 1777
669 Ga0307409_100675557 3300031995 Bacteria 1029
670 Ga0307416_100004746 3300032002 Bacteria 8246
671 Ga0307416_100019536 3300032002 Bacteria 4807
672 Ga0307416_100532369 3300032002 Bacteria 1245
673 Ga0307414_10069926 3300032004 Bacteria 2526
674 Ga0307411_10004725 3300032005 Bacteria 6581
675 Ga0307411_10187275 3300032005 Unclassified 1577
676 Ga0307415_100001525 3300032126 Bacteria 11110
677 Ga0307415_100087669 3300032126 Bacteria 2243
678 Ga0316580_10012483 3300032139 Bacteria 2589
679 Ga0373926_0021960 3300035083 Bacteria 2213
680 Ga0373934_0022660 3300035086 Bacteria 2423
681 Ga0373944_0025428 3300035089 Bacteria 1742
682 Ga0373923_0001887 3300035111 Bacteria 6250
683 Ga0373936_0039651 3300035113 Bacteria 1885
684 Ga0373945_0020967 3300035116 Bacteria 2241
685 Ga0373953_0004046 3300035117 Bacteria 4635
686 Ga0373953_0134942 3300035117 Bacteria 1054
687 Ga0373954_0029877 3300035118 Bacteria 2512
688 Ga0373954_0045276 3300035118 Bacteria 2055
689 Ga0373956_0035695 3300035119 Bacteria 2193
690 Ga0373956_0090797 3300035119 Bacteria 1409
691 Ga0373956_0140489 3300035119 Bacteria 1133
692 Ga0373957_0050449 3300035120 Bacteria 1590
693 Ga0373943_0028812 3300035170 Bacteria 2619
694 Ga0373943_0065306 3300035170 Bacteria 1829
695 Ga0373946_0029589 3300035171 Bacteria 2181
696 Ga0373946_0139510 3300035171 Bacteria 1122
697 Ga0373955_0069459 3300035172 Bacteria 1965
698 Ga0373955_0122088 3300035172 Bacteria 1515
699 Ga0316574_0008699 3300035398 Bacteria 5648
700 Ga0316574_0231361 3300035398 Bacteria 1183
701 Ga0373924_0034191 3300035410 Bacteria 2056
702 Ga0373924_0069981 3300035410 Bacteria 1479
703 Ga0373935_0054301 3300035692 Bacteria 2550
704 Ga0373935_0105404 3300035692 Bacteria 1864
705 Ga0373927_0021090 3300035695 Bacteria 4270
706 Ga0373933_0020614 3300035724 Bacteria 3738
707 Ga0373933_0101208 3300035724 Bacteria 1788
708 Ga0373933_0225655 3300035724 Bacteria 1203
709 Ga0373947_0007437 3300035725 Bacteria 6342
710 Ga0373947_0015049 3300035725 Bacteria 4440
711 Ga0373937_0022393 3300036401 Bacteria 5681
712 Ga0373937_0024846 3300036401 Bacteria 5407
713 Ga0316582_0001521 3300036647 Bacteria 10257
714 Ga0316584_0007945 3300036712 Bacteria 7278
715 Ga0373925_0052073 3300037068 Bacteria 3058
716 Ga0373925_0188313 3300037068 Bacteria 1636
717 Ga0451835_0415084 3300041492 Bacteria 1726
718 Ga0451839_0187655 3300041496 Bacteria 1866
719 Ga0451849_0235764 3300041505 Bacteria 1188
720 Ga0451853_4110621 3300041512 Bacteria 1316
721 Ga0439431_0009468 3300041997 Bacteria 2201
722 Ga0439441_002167 3300042001 Bacteria 2724
723 Ga0439443_000788 3300042003 Bacteria 3138
724 Ga0450920_010731 3300042122 Bacteria 1701
725 Ga0450921_004985 3300042123 Unclassified 990
726 Ga0450923_002143 3300042125 Bacteria 2774
727 Ga0450923_002469 3300042125 Unclassified 2659
728 Ga0450923_006805 3300042125 Bacteria 1910
729 Ga0450894_012969 3300042131 Bacteria 1092
730 Ga0450896_007099 3300042133 Bacteria 1543
731 Ga0439446_0011959 3300042156 Bacteria 2365
732 Ga0450908_003805 3300042184 Bacteria 2921
733 Ga0450908_009783 3300042184 Bacteria 1776
734 Ga0439434_0018924 3300042435 Bacteria 2064
735 Ga0439435_0003569 3300042436 Bacteria 3253
736 Ga0439444_0000470 3300042437 Bacteria 4505
737 Ga0439460_0018015 3300042461 Bacteria 1898
738 Ga0450916_006472 3300042530 Bacteria 1380
739 Ga0450916_021774 3300042530 Bacteria 885
740 Ga0451577_0074025 3300042876 Bacteria 3038
741 Ga0451577_0223359 3300042876 Bacteria 1702
742 Ga0453683_0267674 3300044673 Bacteria 1090
743 Ga0453684_0038752 3300044712 Bacteria 6506
744 Ga0453684_0078214 3300044712 Bacteria 4140
745 Ga0451576_0124578 3300045051 Bacteria 2685
746 Ga0451576_0152462 3300045051 Bacteria 2410
747 Ga0451576_0252978 3300045051 Bacteria 1841
748 Ga0451576_0369481 3300045051 Bacteria 1503
749 Ga0451576_0495449 3300045051 Bacteria 1283
750 Ga0466958_0083951 3300045836 Bacteria 1964
751 Ga0495592_0155456 3300046454 Bacteria 1578
752 Ga0495629_0051508 3300046459 Bacteria 2881
753 Ga0495580_0013205 3300046472 Bacteria 6317
754 Ga0495580_0028562 3300046472 Bacteria 4054
755 Ga0495639_0034852 3300046475 Bacteria 2251
756 Ga0495662_0056511 3300046476 Bacteria 1895
757 Ga0495664_0055457 3300046477 Bacteria 2358
758 Ga0495594_0049798 3300046499 Bacteria 2303
759 Ga0495630_0094643 3300046517 Bacteria 2258
760 Ga0495665_0004127 3300046531 Bacteria 7831
761 Ga0495640_0048466 3300046533 Bacteria 2936
762 Ga0495586_0004535 3300046535 Bacteria 7422
763 Ga0495621_0004535 3300046539 Bacteria 3918
764 Ga0495621_0007655 3300046539 Bacteria 3207
765 Ga0495645_0029848 3300046543 Bacteria 3970
766 Ga0495645_0163142 3300046543 Bacteria 1539
767 Ga0495667_0084333 3300046559 Bacteria 2063
768 Ga0495667_0203949 3300046559 Bacteria 1265
769 Ga0495634_0044052 3300046642 Bacteria 3022
770 Ga0495635_0070908 3300046663 Bacteria 2388
771 Ga0495659_0068201 3300046664 Bacteria 1328
772 Ga0495657_0309684 3300046675 Bacteria 940
773 Ga0495599_0103564 3300046678 Bacteria 1774
774 Ga0495623_0053790 3300046679 Bacteria 2542
775 Ga0495647_0005715 3300046681 Bacteria 4089
776 Ga0495670_0315011 3300046691 Bacteria 840
777 Ga0495604_0107881 3300047317 Bacteria 2035
778 Ga0495674_0245934 3300047319 Bacteria 1473
779 Ga0495684_0007967 3300047471 Bacteria 8187
780 Ga0495684_0144227 3300047471 Bacteria 1784
781 Ga0495593_0094326 3300047673 Bacteria 1539
782 Ga0495614_0023756 3300048089 Bacteria 2646
783 Ga0496101_0067354 3300048904 Bacteria 2614
784 Ga0496101_0130790 3300048904 Bacteria 1906
785 Ga0496101_0283940 3300048904 Bacteria 1294
786 Ga0496101_0369240 3300048904 Bacteria 1128
787 Ga0496101_0403262 3300048904 Bacteria 1077
788 Ga0496102_0003428 3300048905 Bacteria 13442
789 Ga0496102_0084226 3300048905 Bacteria 2934
790 Ga0496103_0024811 3300048906 Bacteria 3619
791 Ga0496103_0187879 3300048906 Bacteria 1328
792 Ga0496104_0022719 3300048907 Bacteria 5761
793 Ga0496104_0292101 3300048907 Bacteria 1542
794 Ga0496104_0390028 3300048907 Bacteria 1305
795 Ga0496105_0002462 3300048908 Bacteria 13400
796 Ga0496105_0004497 3300048908 Bacteria 10496
797 Ga0496105_0378222 3300048908 Bacteria 1127
798 Ga0496106_0041299 3300048909 Bacteria 3456
799 Ga0496106_0063390 3300048909 Bacteria 2809
800 Ga0496106_0152726 3300048909 Bacteria 1822
801 Ga0496106_0479385 3300048909 Bacteria 999
802 Ga0496107_0050601 3300048910 Bacteria 2995
803 Ga0496107_0052403 3300048910 Bacteria 2943
804 Ga0496108_0029077 3300048911 Bacteria 4575
805 Ga0496108_0166049 3300048911 Bacteria 1909
806 Ga0496108_0171966 3300048911 Bacteria 1875
807 Ga0496108_0671792 3300048911 Bacteria 900
808 Ga0496109_0011357 3300048912 Bacteria 7652
809 Ga0496109_0042188 3300048912 Bacteria 4132
810 Ga0496109_0574714 3300048912 Bacteria 1062
811 Ga0496110_0230622 3300048913 Bacteria 1684
812 Ga0496110_0300639 3300048913 Bacteria 1462
813 Ga0496112_0001578 3300048915 Bacteria 17624
814 Ga0496112_0003046 3300048915 Bacteria 13716
815 Ga0496113_0033218 3300048916 Bacteria 3756
816 Ga0496114_0060614 3300048917 Bacteria 3163
817 Ga0496114_0074434 3300048917 Bacteria 2859
818 Ga0496114_0590060 3300048917 Bacteria 980
819 Ga0496115_0038958 3300048918 Bacteria 3774
820 Ga0496115_0191196 3300048918 Bacteria 1691
821 Ga0501031_0050139 3300049568 Bacteria 2720
822 Ga0501031_0188517 3300049568 Bacteria 1347
823 Ga0501032_0072597 3300049569 Bacteria 2294
824 Ga0501036_0004094 3300049572 Bacteria 11735
825 Ga0501036_0412147 3300049572 Bacteria 1127
826 Ga0501038_0081552 3300049574 Bacteria 2725
827 Ga0501039_0010083 3300049575 Bacteria 7198
828 Ga0501039_0311556 3300049575 Bacteria 1237
829 Ga0501040_0085262 3300049576 Bacteria 2192
830 Ga0501040_0096546 3300049576 Bacteria 2058
831 Ga0501040_0125724 3300049576 Bacteria 1801
832 Ga0501041_0128962 3300049577 Bacteria 1575
833 Ga0501042_0335975 3300049578 Bacteria 1092
834 Ga0501042_0438107 3300049578 Bacteria 947
835 Ga0501043_0069312 3300049579 Bacteria 2770
836 Ga0501046_0222958 3300049580 Bacteria 1395
837 Ga0501048_0043892 3300049582 Bacteria 3198
838 Ga0501048_0087933 3300049582 Bacteria 2192
839 Ga0501048_0505887 3300049582 Bacteria 866
840 Ga0501068_0149169 3300049584 Bacteria 1469
841 Ga0501071_0086575 3300049587 Bacteria 2298
842 Ga0501071_0116443 3300049587 Bacteria 1978
843 Ga0501071_0125029 3300049587 Bacteria 1908
844 Ga0501071_0232036 3300049587 Bacteria 1390
845 Ga0501072_0016575 3300049588 Bacteria 5660
846 Ga0501072_0197435 3300049588 Bacteria 1604
847 Ga0501074_0172011 3300049590 Bacteria 1546
848 Ga0501075_0011459 3300049591 Bacteria 6275
849 Ga0501075_0014457 3300049591 Bacteria 5657
850 Ga0501076_0043403 3300049592 Bacteria 3543
851 Ga0501076_0054207 3300049592 Bacteria 3177
852 Ga0501079_0088972 3300049741 Bacteria 2391
853 Ga0501079_0214322 3300049741 Bacteria 1504
854 Ga0501079_0279111 3300049741 Unclassified 1306
855 Ga0501080_0263037 3300049742 Bacteria 1571
856 Ga0501080_0410330 3300049742 Bacteria 1218
857 Ga0501081_0071918 3300049743 Bacteria 2411
858 Ga0501081_0080107 3300049743 Unclassified 2285
859 Ga0501081_0575350 3300049743 Bacteria 842
860 Ga0501035_0099750 3300049822 Bacteria 2549
861 Ga0501035_0688221 3300049822 Bacteria 826
862 Ga0501044_0180693 3300049823 Bacteria 2077
863 Ga0501045_0067108 3300049824 Bacteria 2634
864 Ga0501045_0079481 3300049824 Bacteria 2418
865 Ga0501045_0193611 3300049824 Bacteria 1515
866 nmdc:mga05p37_640621_c1 3300050507 Bacteria 1192
867 nmdc:mga09592_296968_c1 3300050508 Bacteria 1401
868 nmdc:mga06r32_47829_c1 3300050510 Bacteria 4087
869 nmdc:mga0n895_105516_c1 3300050512 Bacteria 2830
870 nmdc:mga0n895_151849_c1 3300050512 Bacteria 2346
871 nmdc:mga0rr50_423107_c1 3300050513 Bacteria 1127
872 Ga0495612_0028286 3300053078 Bacteria 2257
873 Ga0495619_0004965 3300053085 Bacteria 8451
874 Ga0501084_0249868 3300054114 Bacteria 1497
875 Ga0501082_0080058 3300060353 Bacteria 2819
876 Ga0530510_0274501 3300061734 Bacteria 1258

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100001414 Ga0068855_1000014145 219
2 3300005614 Ga0068856_100039254 Ga0068856_1000392544 219
3 3300009093 Ga0105240_10056346 Ga0105240_100563461 219
4 3300009545 Ga0105237_10256046 Ga0105237_102560463 219
5 3300009551 Ga0105238_10058562 Ga0105238_100585623 219
6 3300025924 Ga0207694_10238188 Ga0207694_102381882 219
7 3300025949 Ga0207667_10038657 Ga0207667_100386574 219
8 3300005445 Ga0070708_100000226 Ga0070708_10000022641 222
9 3300035171 Ga0373946_0139510 Ga0373946_0139510_11_733 222
10 3300035398 Ga0316574_0231361 Ga0316574_0231361_44_787 222
11 3300013102 Ga0157371_10156499 Ga0157371_101564992 227
12 3300013105 Ga0157369_10110699 Ga0157369_101106993 227
13 3300013307 Ga0157372_10015144 Ga0157372_100151442 227
14 3300013104 Ga0157370_10235754 Ga0157370_102357542 229
15 3300013307 Ga0157372_10186556 Ga0157372_101865562 229
16 3300014497 Ga0182008_10157950 Ga0182008_101579502 229
17 3300025917 Ga0207660_10132305 Ga0207660_101323052 229
18 3300005719 Ga0068861_100517404 Ga0068861_1005174042 231
19 3300010375 Ga0105239_11186336 Ga0105239_111863361 232
20 3300026118 Ga0207675_100507702 Ga0207675_1005077022 233
21 3300032005 Ga0307411_10187275 Ga0307411_101872752 233
22 3300005329 Ga0070683_100157463 Ga0070683_1001574633 235
23 3300005331 Ga0070670_100049505 Ga0070670_1000495053 235
24 3300005331 Ga0070670_100111365 Ga0070670_1001113652 235
25 3300005344 Ga0070661_100031240 Ga0070661_1000312406 235
26 3300005578 Ga0068854_100016025 Ga0068854_1000160256 235
27 3300005616 Ga0068852_100029101 Ga0068852_1000291016 235
28 3300005834 Ga0068851_10039830 Ga0068851_100398302 235
29 3300025944 Ga0207661_10020887 Ga0207661_100208872 235
30 3300026116 Ga0207674_10068510 Ga0207674_100685103 235
31 3300032002 Ga0307416_100019536 Ga0307416_1000195365 236
32 3300049743 Ga0501081_0080107 Ga0501081_0080107_1562_2272 236
33 3300005327 Ga0070658_10219464 Ga0070658_102194642 237
34 3300005344 Ga0070661_100151788 Ga0070661_1001517882 237
35 3300025893 Ga0207682_10039663 Ga0207682_100396633 237
36 3300025933 Ga0207706_10184127 Ga0207706_101841272 237
37 3300035410 Ga0373924_0069981 Ga0373924_0069981_441_1241 237
38 3300035725 Ga0373947_0007437 Ga0373947_0007437_79_879 237
39 3300037068 Ga0373925_0052073 Ga0373925_0052073_1038_1838 237
40 3300046691 Ga0495670_0315011 Ga0495670_0315011_111_824 237
41 3300049576 Ga0501040_0096546 Ga0501040_0096546_792_1532 237
42 3300053078 Ga0495612_0028286 Ga0495612_0028286_982_1782 237
43 3300005459 Ga0068867_100003602 Ga0068867_10000360211 239
44 3300005546 Ga0070696_100078471 Ga0070696_1000784712 239
45 3300005578 Ga0068854_100255146 Ga0068854_1002551462 239
46 3300005719 Ga0068861_100008052 Ga0068861_1000080523 239
47 3300005840 Ga0068870_10021475 Ga0068870_100214755 239
48 3300006881 Ga0068865_100068642 Ga0068865_1000686424 239
49 3300009094 Ga0111539_10041702 Ga0111539_100417025 239
50 3300009147 Ga0114129_10493286 Ga0114129_104932862 239
51 3300025893 Ga0207682_10090778 Ga0207682_100907782 239
52 3300025899 Ga0207642_10009668 Ga0207642_100096683 239
53 3300025917 Ga0207660_10075921 Ga0207660_100759212 239
54 3300025938 Ga0207704_10091085 Ga0207704_100910852 239
55 3300025940 Ga0207691_10000868 Ga0207691_100008686 239
56 3300025972 Ga0207668_10169583 Ga0207668_101695832 239
57 3300025981 Ga0207640_10099501 Ga0207640_100995012 239
58 3300026075 Ga0207708_10021704 Ga0207708_100217042 239
59 3300026089 Ga0207648_10000165 Ga0207648_1000016539 239
60 3300026118 Ga0207675_100001139 Ga0207675_1000011392 239
61 3300027552 Ga0209982_1001047 Ga0209982_10010474 239
62 3300050508 nmdc:mga09592_296968_c1 nmdc:mga09592_296968_c1_454_1194 239
63 3300042123 Ga0450921_004985 Ga0450921_004985_22_762 240
64 3300009176 Ga0105242_10768953 Ga0105242_107689531 241
65 3300035398 Ga0316574_0008699 Ga0316574_0008699_2541_3266 241
66 3300005295 Ga0065707_10142604 Ga0065707_101426042 242
67 3300005347 Ga0070668_100002086 Ga0070668_1000020866 242
68 3300005441 Ga0070700_100012772 Ga0070700_1000127722 242
69 3300005444 Ga0070694_100149410 Ga0070694_1001494102 242
70 3300005457 Ga0070662_100037518 Ga0070662_1000375183 242
71 3300005536 Ga0070697_100017968 Ga0070697_1000179686 242
72 3300005543 Ga0070672_100015341 Ga0070672_1000153415 242
73 3300005546 Ga0070696_100257180 Ga0070696_1002571802 242
74 3300005549 Ga0070704_100128475 Ga0070704_1001284752 242
75 3300005844 Ga0068862_100013912 Ga0068862_1000139122 242
76 3300025907 Ga0207645_10000197 Ga0207645_1000019738 242
77 3300025910 Ga0207684_10036155 Ga0207684_100361552 242
78 3300025920 Ga0207649_10029099 Ga0207649_100290993 242
79 3300025923 Ga0207681_10018393 Ga0207681_100183934 242
80 3300025933 Ga0207706_10000427 Ga0207706_1000042715 242
81 3300026116 Ga0207674_10212663 Ga0207674_102126631 242
82 3300048911 Ga0496108_0166049 Ga0496108_0166049_99_890 242
83 3300049587 Ga0501071_0116443 Ga0501071_0116443_911_1642 242
84 3300049587 Ga0501071_0125029 Ga0501071_0125029_82_813 242
85 3300049592 Ga0501076_0043403 Ga0501076_0043403_594_1325 242
86 3300049741 Ga0501079_0279111 Ga0501079_0279111_138_869 242
87 3300049824 Ga0501045_0193611 Ga0501045_0193611_469_1200 242
88 3300061734 Ga0530510_0274501 Ga0530510_0274501_365_1096 242
89 3300005331 Ga0070670_100445016 Ga0070670_1004450162 243
90 3300005347 Ga0070668_100047104 Ga0070668_1000471044 243
91 3300005353 Ga0070669_100278533 Ga0070669_1002785332 243
92 3300005354 Ga0070675_100171980 Ga0070675_1001719802 243
93 3300006871 Ga0075434_100279564 Ga0075434_1002795642 243
94 3300007076 Ga0075435_100362083 Ga0075435_1003620832 243
95 3300013102 Ga0157371_10453133 Ga0157371_104531331 243
96 3300025903 Ga0207680_10162479 Ga0207680_101624792 243
97 3300025925 Ga0207650_10025986 Ga0207650_100259862 243
98 3300025926 Ga0207659_10046226 Ga0207659_100462263 243
99 3300025936 Ga0207670_10127527 Ga0207670_101275272 243
100 3300025972 Ga0207668_10001645 Ga0207668_100016455 243
101 3300041997 Ga0439431_0009468 Ga0439431_0009468_834_1565 243
102 3300042001 Ga0439441_002167 Ga0439441_002167_498_1229 243
103 3300042003 Ga0439443_000788 Ga0439443_000788_1856_2587 243
104 3300042125 Ga0450923_002143 Ga0450923_002143_649_1380 243
105 3300042133 Ga0450896_007099 Ga0450896_007099_713_1444 243
106 3300042156 Ga0439446_0011959 Ga0439446_0011959_682_1413 243
107 3300042184 Ga0450908_009783 Ga0450908_009783_269_1000 243
108 3300042435 Ga0439434_0018924 Ga0439434_0018924_427_1158 243
109 3300042436 Ga0439435_0003569 Ga0439435_0003569_1081_1812 243
110 3300042437 Ga0439444_0000470 Ga0439444_0000470_2740_3471 243
111 3300042461 Ga0439460_0018015 Ga0439460_0018015_583_1314 243
112 3300048918 Ga0496115_0191196 Ga0496115_0191196_61_852 243
113 3300050512 nmdc:mga0n895_105516_c1 nmdc:mga0n895_105516_c1_855_1655 243
114 3300005327 Ga0070658_10110098 Ga0070658_101100982 244
115 3300005328 Ga0070676_10086327 Ga0070676_100863273 244
116 3300005328 Ga0070676_10137278 Ga0070676_101372782 244
117 3300005329 Ga0070683_100028011 Ga0070683_1000280114 244
118 3300005331 Ga0070670_100026783 Ga0070670_1000267831 244
119 3300005334 Ga0068869_100071189 Ga0068869_1000711892 244
120 3300005334 Ga0068869_100440178 Ga0068869_1004401782 244
121 3300005335 Ga0070666_10091534 Ga0070666_100915342 244
122 3300005336 Ga0070680_100006224 Ga0070680_1000062245 244
123 3300005336 Ga0070680_100025860 Ga0070680_1000258602 244
124 3300005338 Ga0068868_100091901 Ga0068868_1000919012 244
125 3300005344 Ga0070661_100003414 Ga0070661_10000341411 244
126 3300005344 Ga0070661_100099154 Ga0070661_1000991542 244
127 3300005347 Ga0070668_100060269 Ga0070668_1000602692 244
128 3300005355 Ga0070671_100354965 Ga0070671_1003549652 244
129 3300005356 Ga0070674_100012630 Ga0070674_1000126304 244
130 3300005356 Ga0070674_100117767 Ga0070674_1001177673 244
131 3300005364 Ga0070673_100206106 Ga0070673_1002061062 244
132 3300005364 Ga0070673_100303291 Ga0070673_1003032912 244
133 3300005366 Ga0070659_100019972 Ga0070659_1000199729 244
134 3300005434 Ga0070709_10048079 Ga0070709_100480793 244
135 3300005435 Ga0070714_100007228 Ga0070714_10000722813 244
136 3300005435 Ga0070714_100070272 Ga0070714_1000702722 244
137 3300005436 Ga0070713_100018888 Ga0070713_1000188886 244
138 3300005439 Ga0070711_100165423 Ga0070711_1001654232 244
139 3300005440 Ga0070705_100099259 Ga0070705_1000992591 244
140 3300005444 Ga0070694_100043441 Ga0070694_1000434416 244
141 3300005445 Ga0070708_100102612 Ga0070708_1001026123 244
142 3300005455 Ga0070663_100136139 Ga0070663_1001361392 244
143 3300005455 Ga0070663_100222956 Ga0070663_1002229562 244
144 3300005455 Ga0070663_100265503 Ga0070663_1002655032 244
145 3300005456 Ga0070678_100002693 Ga0070678_1000026937 244
146 3300005457 Ga0070662_100031395 Ga0070662_1000313953 244
147 3300005457 Ga0070662_100132420 Ga0070662_1001324202 244
148 3300005457 Ga0070662_100159063 Ga0070662_1001590632 244
149 3300005458 Ga0070681_10088009 Ga0070681_100880093 244
150 3300005458 Ga0070681_10146322 Ga0070681_101463221 244
151 3300005459 Ga0068867_100374808 Ga0068867_1003748081 244
152 3300005467 Ga0070706_100021806 Ga0070706_1000218064 244
153 3300005468 Ga0070707_100248985 Ga0070707_1002489851 244
154 3300005530 Ga0070679_100025281 Ga0070679_1000252811 244
155 3300005535 Ga0070684_100002779 Ga0070684_10000277916 244
156 3300005535 Ga0070684_100059586 Ga0070684_1000595862 244
157 3300005536 Ga0070697_100010920 Ga0070697_1000109206 244
158 3300005539 Ga0068853_100037114 Ga0068853_1000371143 244
159 3300005543 Ga0070672_100522252 Ga0070672_1005222521 244
160 3300005545 Ga0070695_100013581 Ga0070695_1000135815 244
161 3300005546 Ga0070696_100010800 Ga0070696_1000108004 244
162 3300005547 Ga0070693_100004709 Ga0070693_1000047095 244
163 3300005547 Ga0070693_100009846 Ga0070693_1000098461 244
164 3300005549 Ga0070704_100139697 Ga0070704_1001396972 244
165 3300005563 Ga0068855_100002157 Ga0068855_1000021575 244
166 3300005564 Ga0070664_100001435 Ga0070664_1000014356 244
167 3300005564 Ga0070664_100038600 Ga0070664_1000386002 244
168 3300005577 Ga0068857_100000326 Ga0068857_10000032622 244
169 3300005577 Ga0068857_100265166 Ga0068857_1002651662 244
170 3300005578 Ga0068854_100001495 Ga0068854_10000149518 244
171 3300005578 Ga0068854_100018625 Ga0068854_1000186256 244
172 3300005614 Ga0068856_100009494 Ga0068856_1000094945 244
173 3300005614 Ga0068856_100392434 Ga0068856_1003924341 244
174 3300005615 Ga0070702_100373043 Ga0070702_1003730431 244
175 3300005616 Ga0068852_100183219 Ga0068852_1001832192 244
176 3300005618 Ga0068864_100082545 Ga0068864_1000825452 244
177 3300005718 Ga0068866_10002008 Ga0068866_1000200811 244
178 3300005719 Ga0068861_100146840 Ga0068861_1001468402 244
179 3300005843 Ga0068860_100074296 Ga0068860_1000742962 244
180 3300005843 Ga0068860_100224056 Ga0068860_1002240562 244
181 3300005844 Ga0068862_100112173 Ga0068862_1001121732 244
182 3300006028 Ga0070717_10230702 Ga0070717_102307022 244
183 3300006163 Ga0070715_10015069 Ga0070715_100150693 244
184 3300006173 Ga0070716_100029452 Ga0070716_1000294523 244
185 3300006175 Ga0070712_100134119 Ga0070712_1001341191 244
186 3300006237 Ga0097621_100019709 Ga0097621_1000197094 244
187 3300006358 Ga0068871_100022284 Ga0068871_1000222845 244
188 3300009093 Ga0105240_10015929 Ga0105240_100159295 244
189 3300009098 Ga0105245_10033582 Ga0105245_100335822 244
190 3300009174 Ga0105241_10011819 Ga0105241_100118192 244
191 3300009174 Ga0105241_10089380 Ga0105241_100893803 244
192 3300009174 Ga0105241_10358364 Ga0105241_103583641 244
193 3300009176 Ga0105242_10013861 Ga0105242_100138617 244
194 3300009177 Ga0105248_10221761 Ga0105248_102217612 244
195 3300009545 Ga0105237_10250278 Ga0105237_102502782 244
196 3300009545 Ga0105237_10362532 Ga0105237_103625322 244
197 3300009551 Ga0105238_10000556 Ga0105238_1000055646 244
198 3300012503 Ga0157313_1004244 Ga0157313_10042442 244
199 3300013100 Ga0157373_10054390 Ga0157373_100543903 244
200 3300013102 Ga0157371_10091083 Ga0157371_100910832 244
201 3300013104 Ga0157370_10105890 Ga0157370_101058904 244
202 3300013104 Ga0157370_10214273 Ga0157370_102142732 244
203 3300013105 Ga0157369_10036084 Ga0157369_100360843 244
204 3300013296 Ga0157374_10051984 Ga0157374_100519842 244
205 3300013297 Ga0157378_10017983 Ga0157378_100179837 244
206 3300013306 Ga0163162_10066621 Ga0163162_100666214 244
207 3300013307 Ga0157372_10028920 Ga0157372_100289205 244
208 3300013308 Ga0157375_10307387 Ga0157375_103073872 244
209 3300013308 Ga0157375_10808616 Ga0157375_108086162 244
210 3300014969 Ga0157376_10057257 Ga0157376_100572573 244
211 3300025899 Ga0207642_10002936 Ga0207642_100029364 244
212 3300025906 Ga0207699_10086441 Ga0207699_100864412 244
213 3300025907 Ga0207645_10051958 Ga0207645_100519582 244
214 3300025907 Ga0207645_10157111 Ga0207645_101571112 244
215 3300025909 Ga0207705_10060403 Ga0207705_100604034 244
216 3300025911 Ga0207654_10023310 Ga0207654_100233105 244
217 3300025912 Ga0207707_10221171 Ga0207707_102211712 244
218 3300025913 Ga0207695_10083819 Ga0207695_100838192 244
219 3300025914 Ga0207671_10117016 Ga0207671_101170162 244
220 3300025914 Ga0207671_10206525 Ga0207671_102065252 244
221 3300025915 Ga0207693_10161475 Ga0207693_101614751 244
222 3300025917 Ga0207660_10027395 Ga0207660_100273952 244
223 3300025917 Ga0207660_10163495 Ga0207660_101634952 244
224 3300025919 Ga0207657_10000469 Ga0207657_1000046913 244
225 3300025919 Ga0207657_10041205 Ga0207657_100412052 244
226 3300025919 Ga0207657_10460832 Ga0207657_104608321 244
227 3300025920 Ga0207649_10003824 Ga0207649_100038245 244
228 3300025920 Ga0207649_10055632 Ga0207649_100556322 244
229 3300025921 Ga0207652_10388398 Ga0207652_103883982 244
230 3300025922 Ga0207646_10311560 Ga0207646_103115602 244
231 3300025923 Ga0207681_10027055 Ga0207681_100270552 244
232 3300025924 Ga0207694_10034063 Ga0207694_100340632 244
233 3300025924 Ga0207694_10037959 Ga0207694_100379596 244
234 3300025925 Ga0207650_10127211 Ga0207650_101272111 244
235 3300025926 Ga0207659_10130426 Ga0207659_101304263 244
236 3300025927 Ga0207687_10019080 Ga0207687_100190805 244
237 3300025929 Ga0207664_10011014 Ga0207664_100110146 244
238 3300025931 Ga0207644_10014446 Ga0207644_100144463 244
239 3300025932 Ga0207690_10041382 Ga0207690_100413823 244
240 3300025933 Ga0207706_10002869 Ga0207706_100028696 244
241 3300025933 Ga0207706_10059942 Ga0207706_100599423 244
242 3300025934 Ga0207686_10001274 Ga0207686_1000127416 244
243 3300025937 Ga0207669_10005862 Ga0207669_100058625 244
244 3300025937 Ga0207669_10134348 Ga0207669_101343483 244
245 3300025939 Ga0207665_10043258 Ga0207665_100432582 244
246 3300025942 Ga0207689_10042935 Ga0207689_100429354 244
247 3300025944 Ga0207661_10474602 Ga0207661_104746022 244
248 3300025945 Ga0207679_10007632 Ga0207679_100076324 244
249 3300025949 Ga0207667_10021483 Ga0207667_100214834 244
250 3300025960 Ga0207651_10089953 Ga0207651_100899533 244
251 3300026023 Ga0207677_10012812 Ga0207677_100128125 244
252 3300026041 Ga0207639_10102145 Ga0207639_101021452 244
253 3300026041 Ga0207639_10232296 Ga0207639_102322962 244
254 3300026067 Ga0207678_10192795 Ga0207678_101927952 244
255 3300026078 Ga0207702_10021245 Ga0207702_100212455 244
256 3300026078 Ga0207702_10191223 Ga0207702_101912233 244
257 3300026078 Ga0207702_10620753 Ga0207702_106207531 244
258 3300026089 Ga0207648_10195307 Ga0207648_101953071 244
259 3300026116 Ga0207674_10000180 Ga0207674_1000018019 244
260 3300026116 Ga0207674_10005309 Ga0207674_1000530918 244
261 3300026118 Ga0207675_100028041 Ga0207675_1000280413 244
262 3300026142 Ga0207698_10014775 Ga0207698_100147759 244
263 3300028379 Ga0268266_10397398 Ga0268266_103973982 244
264 3300028380 Ga0268265_10051717 Ga0268265_100517173 244
265 3300028381 Ga0268264_10042725 Ga0268264_100427257 244
266 3300028381 Ga0268264_10221446 Ga0268264_102214462 244
267 3300035083 Ga0373926_0021960 Ga0373926_0021960_516_1313 244
268 3300035089 Ga0373944_0025428 Ga0373944_0025428_868_1665 244
269 3300035118 Ga0373954_0045276 Ga0373954_0045276_721_1518 244
270 3300035119 Ga0373956_0140489 Ga0373956_0140489_306_1103 244
271 3300035170 Ga0373943_0065306 Ga0373943_0065306_549_1346 244
272 3300035171 Ga0373946_0029589 Ga0373946_0029589_1214_2011 244
273 3300035172 Ga0373955_0122088 Ga0373955_0122088_412_1209 244
274 3300035410 Ga0373924_0034191 Ga0373924_0034191_598_1395 244
275 3300035692 Ga0373935_0105404 Ga0373935_0105404_991_1788 244
276 3300035695 Ga0373927_0021090 Ga0373927_0021090_3016_3813 244
277 3300035724 Ga0373933_0225655 Ga0373933_0225655_338_1135 244
278 3300036401 Ga0373937_0022393 Ga0373937_0022393_4550_5347 244
279 3300037068 Ga0373925_0188313 Ga0373925_0188313_637_1434 244
280 3300041496 Ga0451839_0187655 Ga0451839_0187655_732_1529 244
281 3300041505 Ga0451849_0235764 Ga0451849_0235764_242_1039 244
282 3300046459 Ga0495629_0051508 Ga0495629_0051508_1449_2246 244
283 3300046472 Ga0495580_0013205 Ga0495580_0013205_1805_2602 244
284 3300046475 Ga0495639_0034852 Ga0495639_0034852_744_1541 244
285 3300046476 Ga0495662_0056511 Ga0495662_0056511_912_1709 244
286 3300046477 Ga0495664_0055457 Ga0495664_0055457_1313_2110 244
287 3300046499 Ga0495594_0049798 Ga0495594_0049798_912_1709 244
288 3300046517 Ga0495630_0094643 Ga0495630_0094643_980_1777 244
289 3300046531 Ga0495665_0004127 Ga0495665_0004127_1698_2495 244
290 3300046539 Ga0495621_0004535 Ga0495621_0004535_1792_2589 244
291 3300046543 Ga0495645_0029848 Ga0495645_0029848_238_1035 244
292 3300046559 Ga0495667_0084333 Ga0495667_0084333_857_1654 244
293 3300046642 Ga0495634_0044052 Ga0495634_0044052_1608_2405 244
294 3300046663 Ga0495635_0070908 Ga0495635_0070908_714_1511 244
295 3300046664 Ga0495659_0068201 Ga0495659_0068201_33_830 244
296 3300046675 Ga0495657_0309684 Ga0495657_0309684_100_897 244
297 3300046681 Ga0495647_0005715 Ga0495647_0005715_2380_3177 244
298 3300047319 Ga0495674_0245934 Ga0495674_0245934_448_1245 244
299 3300047471 Ga0495684_0007967 Ga0495684_0007967_6549_7346 244
300 3300047673 Ga0495593_0094326 Ga0495593_0094326_119_916 244
301 3300048089 Ga0495614_0023756 Ga0495614_0023756_1392_2189 244
302 3300048904 Ga0496101_0369240 Ga0496101_0369240_12_806 244
303 3300048904 Ga0496101_0403262 Ga0496101_0403262_179_976 244
304 3300048905 Ga0496102_0003428 Ga0496102_0003428_5913_6707 244
305 3300048905 Ga0496102_0084226 Ga0496102_0084226_648_1445 244
306 3300048906 Ga0496103_0187879 Ga0496103_0187879_323_1120 244
307 3300048910 Ga0496107_0050601 Ga0496107_0050601_1044_1838 244
308 3300048910 Ga0496107_0052403 Ga0496107_0052403_2084_2881 244
309 3300048915 Ga0496112_0001578 Ga0496112_0001578_11833_12633 244
310 3300048916 Ga0496113_0033218 Ga0496113_0033218_2409_3209 244
311 3300053085 Ga0495619_0004965 Ga0495619_0004965_740_1537 244
312 3300001991 JGI24743J22301_10000670 JGI24743J22301_100006703 245
313 3300005290 Ga0065712_10002008 Ga0065712_100020084 245
314 3300005293 Ga0065715_10001695 Ga0065715_100016952 245
315 3300005293 Ga0065715_10016770 Ga0065715_100167702 245
316 3300005328 Ga0070676_10000209 Ga0070676_1000020924 245
317 3300005328 Ga0070676_10000253 Ga0070676_100002532 245
318 3300005328 Ga0070676_10054820 Ga0070676_100548202 245
319 3300005328 Ga0070676_10501395 Ga0070676_105013951 245
320 3300005329 Ga0070683_100229543 Ga0070683_1002295431 245
321 3300005330 Ga0070690_100019760 Ga0070690_1000197602 245
322 3300005330 Ga0070690_100175169 Ga0070690_1001751692 245
323 3300005331 Ga0070670_100040265 Ga0070670_1000402652 245
324 3300005331 Ga0070670_100058515 Ga0070670_1000585152 245
325 3300005331 Ga0070670_100493933 Ga0070670_1004939331 245
326 3300005333 Ga0070677_10000328 Ga0070677_100003286 245
327 3300005333 Ga0070677_10035804 Ga0070677_100358042 245
328 3300005334 Ga0068869_100000066 Ga0068869_10000006615 245
329 3300005334 Ga0068869_100015982 Ga0068869_1000159824 245
330 3300005334 Ga0068869_100041944 Ga0068869_1000419442 245
331 3300005334 Ga0068869_100125751 Ga0068869_1001257512 245
332 3300005335 Ga0070666_10016139 Ga0070666_100161392 245
333 3300005335 Ga0070666_10028634 Ga0070666_100286342 245
334 3300005338 Ga0068868_100024910 Ga0068868_1000249106 245
335 3300005338 Ga0068868_100026954 Ga0068868_1000269543 245
336 3300005338 Ga0068868_100048068 Ga0068868_1000480681 245
337 3300005338 Ga0068868_100086487 Ga0068868_1000864873 245
338 3300005338 Ga0068868_100121103 Ga0068868_1001211032 245
339 3300005339 Ga0070660_100152343 Ga0070660_1001523431 245
340 3300005340 Ga0070689_100003075 Ga0070689_1000030757 245
341 3300005340 Ga0070689_100144075 Ga0070689_1001440752 245
342 3300005343 Ga0070687_100017773 Ga0070687_1000177732 245
343 3300005345 Ga0070692_10051933 Ga0070692_100519332 245
344 3300005347 Ga0070668_100000817 Ga0070668_1000008172 245
345 3300005347 Ga0070668_100005793 Ga0070668_1000057934 245
346 3300005347 Ga0070668_100008912 Ga0070668_1000089123 245
347 3300005347 Ga0070668_100043437 Ga0070668_1000434372 245
348 3300005347 Ga0070668_100504260 Ga0070668_1005042601 245
349 3300005353 Ga0070669_100012967 Ga0070669_1000129675 245
350 3300005353 Ga0070669_100017596 Ga0070669_1000175966 245
351 3300005353 Ga0070669_100173853 Ga0070669_1001738531 245
352 3300005353 Ga0070669_100216942 Ga0070669_1002169422 245
353 3300005354 Ga0070675_100000831 Ga0070675_10000083114 245
354 3300005354 Ga0070675_100033312 Ga0070675_1000333126 245
355 3300005354 Ga0070675_100114564 Ga0070675_1001145642 245
356 3300005355 Ga0070671_100005474 Ga0070671_10000547411 245
357 3300005355 Ga0070671_100028879 Ga0070671_1000288793 245
358 3300005355 Ga0070671_100059696 Ga0070671_1000596961 245
359 3300005355 Ga0070671_100233563 Ga0070671_1002335632 245
360 3300005356 Ga0070674_100016927 Ga0070674_1000169272 245
361 3300005356 Ga0070674_100246006 Ga0070674_1002460062 245
362 3300005356 Ga0070674_100271509 Ga0070674_1002715092 245
363 3300005364 Ga0070673_100000413 Ga0070673_10000041315 245
364 3300005364 Ga0070673_100010128 Ga0070673_1000101282 245
365 3300005364 Ga0070673_100055309 Ga0070673_1000553094 245
366 3300005364 Ga0070673_100416057 Ga0070673_1004160571 245
367 3300005365 Ga0070688_100161482 Ga0070688_1001614822 245
368 3300005365 Ga0070688_100170794 Ga0070688_1001707942 245
369 3300005367 Ga0070667_100002478 Ga0070667_10000247821 245
370 3300005367 Ga0070667_100045307 Ga0070667_1000453074 245
371 3300005367 Ga0070667_100077085 Ga0070667_1000770852 245
372 3300005367 Ga0070667_100378482 Ga0070667_1003784822 245
373 3300005441 Ga0070700_100012956 Ga0070700_1000129567 245
374 3300005455 Ga0070663_100036009 Ga0070663_1000360094 245
375 3300005455 Ga0070663_100157130 Ga0070663_1001571301 245
376 3300005456 Ga0070678_100002430 Ga0070678_10000243012 245
377 3300005456 Ga0070678_100003724 Ga0070678_1000037245 245
378 3300005457 Ga0070662_100286871 Ga0070662_1002868712 245
379 3300005459 Ga0068867_100001614 Ga0068867_10000161415 245
380 3300005459 Ga0068867_100010593 Ga0068867_1000105934 245
381 3300005459 Ga0068867_100015427 Ga0068867_1000154272 245
382 3300005466 Ga0070685_10004436 Ga0070685_100044361 245
383 3300005535 Ga0070684_100048448 Ga0070684_1000484482 245
384 3300005539 Ga0068853_100016993 Ga0068853_1000169937 245
385 3300005539 Ga0068853_100352951 Ga0068853_1003529512 245
386 3300005539 Ga0068853_100407324 Ga0068853_1004073242 245
387 3300005543 Ga0070672_100001217 Ga0070672_10000121710 245
388 3300005543 Ga0070672_100002335 Ga0070672_10000233513 245
389 3300005544 Ga0070686_100051635 Ga0070686_1000516352 245
390 3300005545 Ga0070695_100281063 Ga0070695_1002810632 245
391 3300005548 Ga0070665_100008510 Ga0070665_10000851012 245
392 3300005564 Ga0070664_100061713 Ga0070664_1000617132 245
393 3300005577 Ga0068857_100003154 Ga0068857_1000031542 245
394 3300005577 Ga0068857_100020455 Ga0068857_1000204556 245
395 3300005578 Ga0068854_100013835 Ga0068854_1000138351 245
396 3300005614 Ga0068856_100067794 Ga0068856_1000677943 245
397 3300005615 Ga0070702_100017084 Ga0070702_1000170842 245
398 3300005616 Ga0068852_100002200 Ga0068852_10000220014 245
399 3300005616 Ga0068852_100013233 Ga0068852_1000132337 245
400 3300005616 Ga0068852_100344394 Ga0068852_1003443942 245
401 3300005617 Ga0068859_100001650 Ga0068859_10000165015 245
402 3300005617 Ga0068859_100011314 Ga0068859_1000113142 245
403 3300005618 Ga0068864_100007124 Ga0068864_1000071242 245
404 3300005618 Ga0068864_100013967 Ga0068864_1000139677 245
405 3300005719 Ga0068861_100024048 Ga0068861_1000240486 245
406 3300005719 Ga0068861_100036158 Ga0068861_1000361582 245
407 3300005719 Ga0068861_100042928 Ga0068861_1000429286 245
408 3300005719 Ga0068861_100269395 Ga0068861_1002693952 245
409 3300005719 Ga0068861_100317382 Ga0068861_1003173822 245
410 3300005834 Ga0068851_10000383 Ga0068851_1000038320 245
411 3300005834 Ga0068851_10062316 Ga0068851_100623161 245
412 3300005840 Ga0068870_10006811 Ga0068870_100068116 245
413 3300005840 Ga0068870_10010159 Ga0068870_100101591 245
414 3300005840 Ga0068870_10061781 Ga0068870_100617812 245
415 3300005840 Ga0068870_10064707 Ga0068870_100647072 245
416 3300005841 Ga0068863_100001407 Ga0068863_1000014074 245
417 3300005841 Ga0068863_100013405 Ga0068863_10001340510 245
418 3300005841 Ga0068863_100054046 Ga0068863_1000540466 245
419 3300005841 Ga0068863_100218344 Ga0068863_1002183442 245
420 3300005841 Ga0068863_100534934 Ga0068863_1005349342 245
421 3300005841 Ga0068863_100550993 Ga0068863_1005509932 245
422 3300005842 Ga0068858_100000615 Ga0068858_10000061532 245
423 3300005842 Ga0068858_100036643 Ga0068858_1000366432 245
424 3300005842 Ga0068858_100122012 Ga0068858_1001220121 245
425 3300005842 Ga0068858_100141655 Ga0068858_1001416552 245
426 3300005842 Ga0068858_100334884 Ga0068858_1003348841 245
427 3300005842 Ga0068858_100345992 Ga0068858_1003459922 245
428 3300005843 Ga0068860_100031322 Ga0068860_1000313223 245
429 3300005843 Ga0068860_100035908 Ga0068860_1000359087 245
430 3300005843 Ga0068860_100087976 Ga0068860_1000879761 245
431 3300005844 Ga0068862_100008666 Ga0068862_1000086665 245
432 3300005844 Ga0068862_100065631 Ga0068862_1000656316 245
433 3300005844 Ga0068862_100150051 Ga0068862_1001500512 245
434 3300005844 Ga0068862_100193012 Ga0068862_1001930122 245
435 3300006237 Ga0097621_100003826 Ga0097621_10000382612 245
436 3300006237 Ga0097621_100005074 Ga0097621_1000050747 245
437 3300006237 Ga0097621_100049676 Ga0097621_1000496765 245
438 3300006237 Ga0097621_100174127 Ga0097621_1001741272 245
439 3300006358 Ga0068871_100020561 Ga0068871_1000205612 245
440 3300006358 Ga0068871_100035062 Ga0068871_1000350627 245
441 3300006358 Ga0068871_100588179 Ga0068871_1005881791 245
442 3300006881 Ga0068865_100014955 Ga0068865_1000149554 245
443 3300006881 Ga0068865_100126138 Ga0068865_1001261383 245
444 3300006931 Ga0097620_100001650 Ga0097620_10000165015 245
445 3300006931 Ga0097620_100011314 Ga0097620_1000113142 245
446 3300009011 Ga0105251_10164455 Ga0105251_101644552 245
447 3300009094 Ga0111539_10012267 Ga0111539_100122674 245
448 3300009094 Ga0111539_10798034 Ga0111539_107980342 245
449 3300009101 Ga0105247_10065316 Ga0105247_100653163 245
450 3300009176 Ga0105242_10126433 Ga0105242_101264332 245
451 3300009177 Ga0105248_10003381 Ga0105248_100033815 245
452 3300009177 Ga0105248_10024842 Ga0105248_1002484210 245
453 3300009177 Ga0105248_10159694 Ga0105248_101596942 245
454 3300009553 Ga0105249_10075642 Ga0105249_100756423 245
455 3300009553 Ga0105249_10236167 Ga0105249_102361672 245
456 3300013104 Ga0157370_10060029 Ga0157370_100600292 245
457 3300013296 Ga0157374_10000652 Ga0157374_1000065231 245
458 3300013296 Ga0157374_10007334 Ga0157374_100073343 245
459 3300013296 Ga0157374_10044664 Ga0157374_100446642 245
460 3300013297 Ga0157378_10075050 Ga0157378_100750504 245
461 3300013297 Ga0157378_10280144 Ga0157378_102801441 245
462 3300013297 Ga0157378_10293937 Ga0157378_102939372 245
463 3300013306 Ga0163162_10015881 Ga0163162_100158812 245
464 3300013306 Ga0163162_10240711 Ga0163162_102407112 245
465 3300013308 Ga0157375_10000922 Ga0157375_1000092220 245
466 3300013308 Ga0157375_10024378 Ga0157375_100243787 245
467 3300013308 Ga0157375_10808022 Ga0157375_108080222 245
468 3300014325 Ga0163163_10102090 Ga0163163_101020902 245
469 3300014326 Ga0157380_10185317 Ga0157380_101853173 245
470 3300014326 Ga0157380_10335601 Ga0157380_103356011 245
471 3300014326 Ga0157380_10356854 Ga0157380_103568542 245
472 3300014968 Ga0157379_10001318 Ga0157379_1000131822 245
473 3300014968 Ga0157379_10003993 Ga0157379_1000399315 245
474 3300014968 Ga0157379_10036140 Ga0157379_100361402 245
475 3300014969 Ga0157376_10044611 Ga0157376_100446112 245
476 3300014969 Ga0157376_10163303 Ga0157376_101633032 245
477 3300014969 Ga0157376_10193816 Ga0157376_101938161 245
478 3300017792 Ga0163161_10012517 Ga0163161_100125177 245
479 3300025315 Ga0207697_10010060 Ga0207697_100100602 245
480 3300025315 Ga0207697_10034268 Ga0207697_100342682 245
481 3300025321 Ga0207656_10128849 Ga0207656_101288492 245
482 3300025893 Ga0207682_10001544 Ga0207682_1000154414 245
483 3300025893 Ga0207682_10002336 Ga0207682_1000233610 245
484 3300025899 Ga0207642_10029981 Ga0207642_100299811 245
485 3300025900 Ga0207710_10049544 Ga0207710_100495442 245
486 3300025901 Ga0207688_10018407 Ga0207688_100184072 245
487 3300025901 Ga0207688_10081412 Ga0207688_100814121 245
488 3300025903 Ga0207680_10008165 Ga0207680_100081658 245
489 3300025903 Ga0207680_10053415 Ga0207680_100534152 245
490 3300025907 Ga0207645_10000209 Ga0207645_1000020912 245
491 3300025907 Ga0207645_10000283 Ga0207645_1000028324 245
492 3300025907 Ga0207645_10006292 Ga0207645_100062923 245
493 3300025907 Ga0207645_10258553 Ga0207645_102585532 245
494 3300025908 Ga0207643_10003271 Ga0207643_100032716 245
495 3300025908 Ga0207643_10033446 Ga0207643_100334462 245
496 3300025908 Ga0207643_10117100 Ga0207643_101171002 245
497 3300025918 Ga0207662_10005532 Ga0207662_100055326 245
498 3300025919 Ga0207657_10021361 Ga0207657_100213612 245
499 3300025923 Ga0207681_10009719 Ga0207681_100097193 245
500 3300025923 Ga0207681_10013116 Ga0207681_100131162 245
501 3300025923 Ga0207681_10031234 Ga0207681_100312341 245
502 3300025923 Ga0207681_10407575 Ga0207681_104075752 245
503 3300025925 Ga0207650_10011697 Ga0207650_100116974 245
504 3300025925 Ga0207650_10041629 Ga0207650_100416294 245
505 3300025925 Ga0207650_10049418 Ga0207650_100494182 245
506 3300025925 Ga0207650_10209229 Ga0207650_102092292 245
507 3300025925 Ga0207650_10338306 Ga0207650_103383062 245
508 3300025926 Ga0207659_10006299 Ga0207659_100062999 245
509 3300025926 Ga0207659_10026654 Ga0207659_100266542 245
510 3300025926 Ga0207659_10047274 Ga0207659_100472744 245
511 3300025927 Ga0207687_10098812 Ga0207687_100988121 245
512 3300025931 Ga0207644_10002553 Ga0207644_1000255311 245
513 3300025931 Ga0207644_10061645 Ga0207644_100616453 245
514 3300025931 Ga0207644_10085018 Ga0207644_100850182 245
515 3300025931 Ga0207644_10326948 Ga0207644_103269481 245
516 3300025931 Ga0207644_10374705 Ga0207644_103747052 245
517 3300025933 Ga0207706_10004812 Ga0207706_1000481215 245
518 3300025934 Ga0207686_10090782 Ga0207686_100907822 245
519 3300025935 Ga0207709_10132541 Ga0207709_101325412 245
520 3300025936 Ga0207670_10100518 Ga0207670_101005182 245
521 3300025937 Ga0207669_10004815 Ga0207669_100048155 245
522 3300025937 Ga0207669_10009402 Ga0207669_100094028 245
523 3300025938 Ga0207704_10016388 Ga0207704_100163887 245
524 3300025938 Ga0207704_10153551 Ga0207704_101535512 245
525 3300025939 Ga0207665_10497834 Ga0207665_104978342 245
526 3300025940 Ga0207691_10000153 Ga0207691_1000015364 245
527 3300025940 Ga0207691_10000546 Ga0207691_1000054633 245
528 3300025940 Ga0207691_10011464 Ga0207691_100114644 245
529 3300025940 Ga0207691_10043897 Ga0207691_100438973 245
530 3300025940 Ga0207691_10127993 Ga0207691_101279932 245
531 3300025941 Ga0207711_10050593 Ga0207711_100505932 245
532 3300025941 Ga0207711_10052020 Ga0207711_100520201 245
533 3300025942 Ga0207689_10000952 Ga0207689_1000095215 245
534 3300025942 Ga0207689_10001219 Ga0207689_1000121926 245
535 3300025942 Ga0207689_10115984 Ga0207689_101159843 245
536 3300025945 Ga0207679_10124919 Ga0207679_101249192 245
537 3300025949 Ga0207667_10539569 Ga0207667_105395691 245
538 3300025960 Ga0207651_10001263 Ga0207651_100012638 245
539 3300025960 Ga0207651_10014138 Ga0207651_100141382 245
540 3300025972 Ga0207668_10005674 Ga0207668_100056743 245
541 3300025972 Ga0207668_10023963 Ga0207668_100239634 245
542 3300025972 Ga0207668_10024247 Ga0207668_100242472 245
543 3300025972 Ga0207668_10247323 Ga0207668_102473232 245
544 3300025972 Ga0207668_10310750 Ga0207668_103107502 245
545 3300025986 Ga0207658_10006807 Ga0207658_1000680711 245
546 3300025986 Ga0207658_10013941 Ga0207658_100139414 245
547 3300025986 Ga0207658_10016683 Ga0207658_100166833 245
548 3300025986 Ga0207658_10021208 Ga0207658_100212083 245
549 3300025986 Ga0207658_10151891 Ga0207658_101518912 245
550 3300025986 Ga0207658_10361904 Ga0207658_103619042 245
551 3300026023 Ga0207677_10036718 Ga0207677_100367181 245
552 3300026023 Ga0207677_10049777 Ga0207677_100497772 245
553 3300026023 Ga0207677_10087399 Ga0207677_100873992 245
554 3300026035 Ga0207703_10001381 Ga0207703_1000138121 245
555 3300026035 Ga0207703_10031384 Ga0207703_100313847 245
556 3300026041 Ga0207639_10058769 Ga0207639_100587691 245
557 3300026067 Ga0207678_10001649 Ga0207678_1000164917 245
558 3300026067 Ga0207678_10063510 Ga0207678_100635102 245
559 3300026067 Ga0207678_10156186 Ga0207678_101561862 245
560 3300026075 Ga0207708_10075859 Ga0207708_100758592 245
561 3300026088 Ga0207641_10002346 Ga0207641_1000234620 245
562 3300026088 Ga0207641_10031156 Ga0207641_100311566 245
563 3300026088 Ga0207641_10314310 Ga0207641_103143102 245
564 3300026088 Ga0207641_10362715 Ga0207641_103627152 245
565 3300026089 Ga0207648_10000564 Ga0207648_1000056433 245
566 3300026089 Ga0207648_10006558 Ga0207648_100065582 245
567 3300026089 Ga0207648_10011183 Ga0207648_100111834 245
568 3300026089 Ga0207648_10315325 Ga0207648_103153252 245
569 3300026095 Ga0207676_10003043 Ga0207676_1000304313 245
570 3300026095 Ga0207676_10016044 Ga0207676_100160446 245
571 3300026095 Ga0207676_10017861 Ga0207676_100178613 245
572 3300026095 Ga0207676_10092131 Ga0207676_100921312 245
573 3300026116 Ga0207674_10010649 Ga0207674_1001064910 245
574 3300026116 Ga0207674_10026146 Ga0207674_1002614611 245
575 3300026118 Ga0207675_100010670 Ga0207675_10001067010 245
576 3300026118 Ga0207675_100041207 Ga0207675_1000412076 245
577 3300026118 Ga0207675_100229770 Ga0207675_1002297703 245
578 3300026121 Ga0207683_10000140 Ga0207683_1000014018 245
579 3300026121 Ga0207683_10000424 Ga0207683_1000042423 245
580 3300026121 Ga0207683_10019340 Ga0207683_100193404 245
581 3300026142 Ga0207698_10028625 Ga0207698_100286255 245
582 3300026142 Ga0207698_10052008 Ga0207698_100520081 245
583 3300026142 Ga0207698_10090781 Ga0207698_100907812 245
584 3300027717 Ga0209998_10033926 Ga0209998_100339262 245
585 3300027907 Ga0207428_10032798 Ga0207428_100327983 245
586 3300028379 Ga0268266_10014198 Ga0268266_100141985 245
587 3300028379 Ga0268266_10212777 Ga0268266_102127772 245
588 3300028379 Ga0268266_10444989 Ga0268266_104449892 245
589 3300028380 Ga0268265_10011281 Ga0268265_100112816 245
590 3300028380 Ga0268265_10063872 Ga0268265_100638726 245
591 3300028380 Ga0268265_10139772 Ga0268265_101397722 245
592 3300028380 Ga0268265_10237666 Ga0268265_102376662 245
593 3300028381 Ga0268264_10016725 Ga0268264_100167253 245
594 3300028381 Ga0268264_10085573 Ga0268264_100855734 245
595 3300028381 Ga0268264_10091094 Ga0268264_100910942 245
596 3300028381 Ga0268264_10115040 Ga0268264_101150402 245
597 3300028381 Ga0268264_10769563 Ga0268264_107695631 245
598 3300031548 Ga0307408_100037433 Ga0307408_1000374334 245
599 3300031548 Ga0307408_100067534 Ga0307408_1000675343 245
600 3300031731 Ga0307405_10026034 Ga0307405_100260343 245
601 3300031852 Ga0307410_10117281 Ga0307410_101172812 245
602 3300031901 Ga0307406_10278024 Ga0307406_102780242 245
603 3300031911 Ga0307412_10056231 Ga0307412_100562312 245
604 3300031911 Ga0307412_10270832 Ga0307412_102708322 245
605 3300031995 Ga0307409_100675557 Ga0307409_1006755572 245
606 3300041492 Ga0451835_0415084 Ga0451835_0415084_848_1645 245
607 3300041512 Ga0451853_4110621 Ga0451853_4110621_425_1222 245
608 3300042122 Ga0450920_010731 Ga0450920_010731_520_1260 245
609 3300042530 Ga0450916_006472 Ga0450916_006472_497_1237 245
610 3300042530 Ga0450916_021774 Ga0450916_021774_81_821 245
611 3300045051 Ga0451576_0369481 Ga0451576_0369481_217_1023 245
612 3300045836 Ga0466958_0083951 Ga0466958_0083951_160_960 245
613 3300046539 Ga0495621_0007655 Ga0495621_0007655_990_1787 245
614 3300048904 Ga0496101_0067354 Ga0496101_0067354_986_1783 245
615 3300048904 Ga0496101_0283940 Ga0496101_0283940_96_905 245
616 3300048906 Ga0496103_0024811 Ga0496103_0024811_1083_1889 245
617 3300048907 Ga0496104_0292101 Ga0496104_0292101_387_1184 245
618 3300048907 Ga0496104_0390028 Ga0496104_0390028_75_884 245
619 3300048908 Ga0496105_0004497 Ga0496105_0004497_8966_9763 245
620 3300048908 Ga0496105_0378222 Ga0496105_0378222_37_846 245
621 3300048909 Ga0496106_0063390 Ga0496106_0063390_637_1434 245
622 3300048911 Ga0496108_0029077 Ga0496108_0029077_1601_2398 245
623 3300048911 Ga0496108_0171966 Ga0496108_0171966_80_886 245
624 3300048911 Ga0496108_0671792 Ga0496108_0671792_74_880 245
625 3300048912 Ga0496109_0011357 Ga0496109_0011357_6267_7064 245
626 3300048912 Ga0496109_0042188 Ga0496109_0042188_973_1779 245
627 3300048912 Ga0496109_0574714 Ga0496109_0574714_226_1032 245
628 3300048913 Ga0496110_0230622 Ga0496110_0230622_332_1138 245
629 3300048913 Ga0496110_0300639 Ga0496110_0300639_207_1007 245
630 3300048917 Ga0496114_0060614 Ga0496114_0060614_379_1185 245
631 3300048917 Ga0496114_0590060 Ga0496114_0590060_72_869 245
632 3300049568 Ga0501031_0050139 Ga0501031_0050139_1697_2437 245
633 3300049569 Ga0501032_0072597 Ga0501032_0072597_1266_2006 245
634 3300049572 Ga0501036_0004094 Ga0501036_0004094_7967_8707 245
635 3300049574 Ga0501038_0081552 Ga0501038_0081552_289_1029 245
636 3300049575 Ga0501039_0010083 Ga0501039_0010083_5069_5809 245
637 3300049576 Ga0501040_0085262 Ga0501040_0085262_1379_2119 245
638 3300049576 Ga0501040_0125724 Ga0501040_0125724_957_1697 245
639 3300049577 Ga0501041_0128962 Ga0501041_0128962_278_1018 245
640 3300049578 Ga0501042_0438107 Ga0501042_0438107_43_783 245
641 3300049579 Ga0501043_0069312 Ga0501043_0069312_1961_2701 245
642 3300049582 Ga0501048_0043892 Ga0501048_0043892_1333_2073 245
643 3300049582 Ga0501048_0505887 Ga0501048_0505887_43_783 245
644 3300049584 Ga0501068_0149169 Ga0501068_0149169_435_1175 245
645 3300049587 Ga0501071_0086575 Ga0501071_0086575_146_886 245
646 3300049588 Ga0501072_0016575 Ga0501072_0016575_3534_4274 245
647 3300049590 Ga0501074_0172011 Ga0501074_0172011_643_1383 245
648 3300049591 Ga0501075_0011459 Ga0501075_0011459_2190_2930 245
649 3300049592 Ga0501076_0054207 Ga0501076_0054207_1395_2135 245
650 3300049741 Ga0501079_0214322 Ga0501079_0214322_444_1184 245
651 3300049742 Ga0501080_0263037 Ga0501080_0263037_786_1526 245
652 3300049743 Ga0501081_0071918 Ga0501081_0071918_1383_2123 245
653 3300049822 Ga0501035_0099750 Ga0501035_0099750_1410_2150 245
654 3300049822 Ga0501035_0688221 Ga0501035_0688221_17_757 245
655 3300049823 Ga0501044_0180693 Ga0501044_0180693_14_754 245
656 3300049824 Ga0501045_0079481 Ga0501045_0079481_823_1563 245
657 3300050507 nmdc:mga05p37_640621_c1 nmdc:mga05p37_640621_c1_371_1171 245
658 3300005293 Ga0065715_10233042 Ga0065715_102330422 246
659 3300005330 Ga0070690_100003569 Ga0070690_10000356911 246
660 3300005331 Ga0070670_100053429 Ga0070670_1000534292 246
661 3300005335 Ga0070666_10005215 Ga0070666_100052154 246
662 3300005335 Ga0070666_10011040 Ga0070666_100110402 246
663 3300005338 Ga0068868_100009045 Ga0068868_1000090456 246
664 3300005340 Ga0070689_100046367 Ga0070689_1000463673 246
665 3300005341 Ga0070691_10079199 Ga0070691_100791992 246
666 3300005343 Ga0070687_100022003 Ga0070687_1000220032 246
667 3300005353 Ga0070669_100145976 Ga0070669_1001459762 246
668 3300005354 Ga0070675_100081135 Ga0070675_1000811353 246
669 3300005354 Ga0070675_100120696 Ga0070675_1001206962 246
670 3300005355 Ga0070671_100053436 Ga0070671_1000534363 246
671 3300005355 Ga0070671_100315787 Ga0070671_1003157872 246
672 3300005364 Ga0070673_100012723 Ga0070673_1000127236 246
673 3300005364 Ga0070673_100536363 Ga0070673_1005363632 246
674 3300005365 Ga0070688_100001381 Ga0070688_1000013816 246
675 3300005367 Ga0070667_100007387 Ga0070667_10000738711 246
676 3300005367 Ga0070667_100105466 Ga0070667_1001054662 246
677 3300005436 Ga0070713_100006522 Ga0070713_1000065221 246
678 3300005437 Ga0070710_10047733 Ga0070710_100477332 246
679 3300005439 Ga0070711_100042907 Ga0070711_1000429072 246
680 3300005456 Ga0070678_100008098 Ga0070678_1000080985 246
681 3300005456 Ga0070678_100817332 Ga0070678_1008173321 246
682 3300005466 Ga0070685_10007773 Ga0070685_100077733 246
683 3300005535 Ga0070684_100152946 Ga0070684_1001529462 246
684 3300005543 Ga0070672_100142996 Ga0070672_1001429962 246
685 3300005544 Ga0070686_100069118 Ga0070686_1000691182 246
686 3300005548 Ga0070665_100001378 Ga0070665_10000137830 246
687 3300005548 Ga0070665_100017516 Ga0070665_10001751611 246
688 3300005616 Ga0068852_100280594 Ga0068852_1002805941 246
689 3300005617 Ga0068859_100000398 Ga0068859_1000003985 246
690 3300005617 Ga0068859_100026072 Ga0068859_1000260724 246
691 3300005618 Ga0068864_100002525 Ga0068864_10000252513 246
692 3300005841 Ga0068863_100000366 Ga0068863_10000036642 246
693 3300005842 Ga0068858_100000781 Ga0068858_10000078136 246
694 3300006175 Ga0070712_100009734 Ga0070712_1000097342 246
695 3300006237 Ga0097621_100232233 Ga0097621_1002322332 246
696 3300006844 Ga0075428_100009793 Ga0075428_1000097935 246
697 3300006846 Ga0075430_100394080 Ga0075430_1003940802 246
698 3300006847 Ga0075431_100017650 Ga0075431_1000176508 246
699 3300006881 Ga0068865_100154050 Ga0068865_1001540502 246
700 3300006931 Ga0097620_100000398 Ga0097620_1000003985 246
701 3300006931 Ga0097620_100026072 Ga0097620_1000260724 246
702 3300007076 Ga0075435_100505501 Ga0075435_1005055012 246
703 3300009098 Ga0105245_10096955 Ga0105245_100969552 246
704 3300009101 Ga0105247_10012621 Ga0105247_100126215 246
705 3300009147 Ga0114129_10659995 Ga0114129_106599952 246
706 3300009174 Ga0105241_10715616 Ga0105241_107156161 246
707 3300009177 Ga0105248_10057815 Ga0105248_100578152 246
708 3300013296 Ga0157374_10000460 Ga0157374_100004604 246
709 3300013296 Ga0157374_10151285 Ga0157374_101512852 246
710 3300013297 Ga0157378_10302991 Ga0157378_103029912 246
711 3300013306 Ga0163162_10057423 Ga0163162_100574232 246
712 3300013307 Ga0157372_10059945 Ga0157372_100599452 246
713 3300013308 Ga0157375_10008960 Ga0157375_1000896011 246
714 3300013308 Ga0157375_10127459 Ga0157375_101274593 246
715 3300014325 Ga0163163_10012877 Ga0163163_100128776 246
716 3300014326 Ga0157380_10182686 Ga0157380_101826862 246
717 3300014745 Ga0157377_10089189 Ga0157377_100891892 246
718 3300014968 Ga0157379_10003843 Ga0157379_1000384314 246
719 3300014969 Ga0157376_10030581 Ga0157376_100305814 246
720 3300014969 Ga0157376_10175518 Ga0157376_101755182 246
721 3300025898 Ga0207692_10076306 Ga0207692_100763062 246
722 3300025903 Ga0207680_10001232 Ga0207680_1000123211 246
723 3300025903 Ga0207680_10005392 Ga0207680_100053926 246
724 3300025907 Ga0207645_10256083 Ga0207645_102560832 246
725 3300025908 Ga0207643_10072236 Ga0207643_100722362 246
726 3300025915 Ga0207693_10000364 Ga0207693_1000036425 246
727 3300025916 Ga0207663_10033753 Ga0207663_100337532 246
728 3300025916 Ga0207663_10073440 Ga0207663_100734402 246
729 3300025918 Ga0207662_10022887 Ga0207662_100228873 246
730 3300025925 Ga0207650_10421244 Ga0207650_104212441 246
731 3300025926 Ga0207659_10060647 Ga0207659_100606472 246
732 3300025927 Ga0207687_10011521 Ga0207687_100115215 246
733 3300025928 Ga0207700_10046327 Ga0207700_100463273 246
734 3300025929 Ga0207664_10246055 Ga0207664_102460552 246
735 3300025931 Ga0207644_10018086 Ga0207644_100180866 246
736 3300025936 Ga0207670_10009367 Ga0207670_100093673 246
737 3300025936 Ga0207670_10097717 Ga0207670_100977172 246
738 3300025940 Ga0207691_10092480 Ga0207691_100924802 246
739 3300025941 Ga0207711_10000185 Ga0207711_1000018520 246
740 3300025942 Ga0207689_10158122 Ga0207689_101581222 246
741 3300025960 Ga0207651_10048053 Ga0207651_100480534 246
742 3300025960 Ga0207651_10206070 Ga0207651_102060702 246
743 3300025972 Ga0207668_10079774 Ga0207668_100797743 246
744 3300025986 Ga0207658_10036639 Ga0207658_100366395 246
745 3300025986 Ga0207658_10053547 Ga0207658_100535472 246
746 3300026023 Ga0207677_10000148 Ga0207677_100001487 246
747 3300026035 Ga0207703_10001265 Ga0207703_1000126514 246
748 3300026078 Ga0207702_10096171 Ga0207702_100961712 246
749 3300026095 Ga0207676_10000516 Ga0207676_1000051634 246
750 3300026118 Ga0207675_100578947 Ga0207675_1005789472 246
751 3300026121 Ga0207683_10001594 Ga0207683_1000159410 246
752 3300027395 Ga0209996_1010164 Ga0209996_10101642 246
753 3300027617 Ga0210002_1002629 Ga0210002_10026292 246
754 3300027665 Ga0209983_1004485 Ga0209983_10044854 246
755 3300027717 Ga0209998_10000997 Ga0209998_100009975 246
756 3300027876 Ga0209974_10000131 Ga0209974_1000013123 246
757 3300028379 Ga0268266_10011410 Ga0268266_100114102 246
758 3300028379 Ga0268266_10023660 Ga0268266_100236606 246
759 3300028381 Ga0268264_10023422 Ga0268264_100234225 246
760 3300031665 Ga0316575_10007155 Ga0316575_100071552 246
761 3300031727 Ga0316576_10001231 Ga0316576_1000123116 246
762 3300031728 Ga0316578_10136017 Ga0316578_101360172 246
763 3300031733 Ga0316577_10024660 Ga0316577_100246603 246
764 3300032139 Ga0316580_10012483 Ga0316580_100124832 246
765 3300035086 Ga0373934_0022660 Ga0373934_0022660_344_1147 246
766 3300035111 Ga0373923_0001887 Ga0373923_0001887_4576_5379 246
767 3300035113 Ga0373936_0039651 Ga0373936_0039651_151_954 246
768 3300035116 Ga0373945_0020967 Ga0373945_0020967_893_1696 246
769 3300035117 Ga0373953_0004046 Ga0373953_0004046_1592_2395 246
770 3300035118 Ga0373954_0029877 Ga0373954_0029877_675_1478 246
771 3300035119 Ga0373956_0035695 Ga0373956_0035695_726_1529 246
772 3300035120 Ga0373957_0050449 Ga0373957_0050449_358_1161 246
773 3300035170 Ga0373943_0028812 Ga0373943_0028812_338_1141 246
774 3300035172 Ga0373955_0069459 Ga0373955_0069459_576_1379 246
775 3300035692 Ga0373935_0054301 Ga0373935_0054301_208_1011 246
776 3300035724 Ga0373933_0020614 Ga0373933_0020614_1268_2071 246
777 3300035725 Ga0373947_0015049 Ga0373947_0015049_2312_3115 246
778 3300036401 Ga0373937_0024846 Ga0373937_0024846_4459_5262 246
779 3300036647 Ga0316582_0001521 Ga0316582_0001521_8792_9532 246
780 3300036712 Ga0316584_0007945 Ga0316584_0007945_231_971 246
781 3300042125 Ga0450923_002469 Ga0450923_002469_17_760 246
782 3300042125 Ga0450923_006805 Ga0450923_006805_273_1016 246
783 3300042131 Ga0450894_012969 Ga0450894_012969_258_1001 246
784 3300042184 Ga0450908_003805 Ga0450908_003805_909_1652 246
785 3300045051 Ga0451576_0124578 Ga0451576_0124578_178_981 246
786 3300046454 Ga0495592_0155456 Ga0495592_0155456_586_1389 246
787 3300046472 Ga0495580_0028562 Ga0495580_0028562_2876_3679 246
788 3300046533 Ga0495640_0048466 Ga0495640_0048466_858_1661 246
789 3300046543 Ga0495645_0163142 Ga0495645_0163142_272_1075 246
790 3300046559 Ga0495667_0203949 Ga0495667_0203949_400_1203 246
791 3300046678 Ga0495599_0103564 Ga0495599_0103564_955_1758 246
792 3300046679 Ga0495623_0053790 Ga0495623_0053790_437_1240 246
793 3300047317 Ga0495604_0107881 Ga0495604_0107881_740_1543 246
794 3300047471 Ga0495684_0144227 Ga0495684_0144227_332_1135 246
795 3300048904 Ga0496101_0130790 Ga0496101_0130790_800_1603 246
796 3300048907 Ga0496104_0022719 Ga0496104_0022719_3926_4729 246
797 3300048908 Ga0496105_0002462 Ga0496105_0002462_9802_10605 246
798 3300048909 Ga0496106_0041299 Ga0496106_0041299_2619_3422 246
799 3300048909 Ga0496106_0152726 Ga0496106_0152726_944_1795 246
800 3300048909 Ga0496106_0479385 Ga0496106_0479385_19_822 246
801 3300048915 Ga0496112_0003046 Ga0496112_0003046_1334_2137 246
802 3300048917 Ga0496114_0074434 Ga0496114_0074434_1225_2028 246
803 3300048918 Ga0496115_0038958 Ga0496115_0038958_114_917 246
804 3300049568 Ga0501031_0188517 Ga0501031_0188517_522_1262 246
805 3300049572 Ga0501036_0412147 Ga0501036_0412147_374_1114 246
806 3300049575 Ga0501039_0311556 Ga0501039_0311556_429_1169 246
807 3300049578 Ga0501042_0335975 Ga0501042_0335975_252_995 246
808 3300049580 Ga0501046_0222958 Ga0501046_0222958_45_785 246
809 3300049582 Ga0501048_0087933 Ga0501048_0087933_480_1220 246
810 3300049587 Ga0501071_0232036 Ga0501071_0232036_167_907 246
811 3300049588 Ga0501072_0197435 Ga0501072_0197435_668_1408 246
812 3300049591 Ga0501075_0014457 Ga0501075_0014457_3660_4400 246
813 3300049741 Ga0501079_0088972 Ga0501079_0088972_488_1228 246
814 3300049742 Ga0501080_0410330 Ga0501080_0410330_331_1074 246
815 3300049743 Ga0501081_0575350 Ga0501081_0575350_18_758 246
816 3300049824 Ga0501045_0067108 Ga0501045_0067108_1310_2050 246
817 3300050510 nmdc:mga06r32_47829_c1 nmdc:mga06r32_47829_c1_455_1195 246
818 3300050512 nmdc:mga0n895_151849_c1 nmdc:mga0n895_151849_c1_369_1172 246
819 3300050513 nmdc:mga0rr50_423107_c1 nmdc:mga0rr50_423107_c1_179_982 246
820 3300054114 Ga0501084_0249868 Ga0501084_0249868_291_1031 246
821 3300060353 Ga0501082_0080058 Ga0501082_0080058_1547_2290 246
822 3300005339 Ga0070660_100010354 Ga0070660_1000103545 247
823 3300005344 Ga0070661_100004272 Ga0070661_1000042727 247
824 3300005345 Ga0070692_10188557 Ga0070692_101885572 247
825 3300005355 Ga0070671_100013306 Ga0070671_1000133066 247
826 3300005366 Ga0070659_100001024 Ga0070659_10000102417 247
827 3300005367 Ga0070667_100389000 Ga0070667_1003890002 247
828 3300005455 Ga0070663_100007890 Ga0070663_1000078903 247
829 3300005457 Ga0070662_100000907 Ga0070662_10000090714 247
830 3300005458 Ga0070681_10050336 Ga0070681_100503362 247
831 3300005530 Ga0070679_100258544 Ga0070679_1002585442 247
832 3300005539 Ga0068853_100033484 Ga0068853_1000334842 247
833 3300005545 Ga0070695_100307653 Ga0070695_1003076532 247
834 3300005563 Ga0068855_100000852 Ga0068855_10000085211 247
835 3300005564 Ga0070664_100007701 Ga0070664_10000770111 247
836 3300005614 Ga0068856_100000664 Ga0068856_10000066411 247
837 3300005616 Ga0068852_100200000 Ga0068852_1002000002 247
838 3300005834 Ga0068851_10099266 Ga0068851_100992662 247
839 3300013100 Ga0157373_10005158 Ga0157373_1000515811 247
840 3300013102 Ga0157371_10001509 Ga0157371_1000150922 247
841 3300013105 Ga0157369_10068515 Ga0157369_100685152 247
842 3300014969 Ga0157376_10288006 Ga0157376_102880062 247
843 3300025912 Ga0207707_10116986 Ga0207707_101169862 247
844 3300025926 Ga0207659_10494344 Ga0207659_104943441 247
845 3300025942 Ga0207689_10183018 Ga0207689_101830182 247
846 3300025986 Ga0207658_10095051 Ga0207658_100950512 247
847 3300027682 Ga0209971_1011008 Ga0209971_10110082 247
848 3300027876 Ga0209974_10014844 Ga0209974_100148443 247
849 3300031548 Ga0307408_100092217 Ga0307408_1000922172 247
850 3300031731 Ga0307405_10060768 Ga0307405_100607682 247
851 3300031852 Ga0307410_10003221 Ga0307410_100032215 247
852 3300031901 Ga0307406_10139376 Ga0307406_101393762 247
853 3300031903 Ga0307407_10002261 Ga0307407_100022619 247
854 3300031995 Ga0307409_100202424 Ga0307409_1002024242 247
855 3300032002 Ga0307416_100004746 Ga0307416_1000047467 247
856 3300032004 Ga0307414_10069926 Ga0307414_100699262 247
857 3300032005 Ga0307411_10004725 Ga0307411_100047259 247
858 3300032126 Ga0307415_100001525 Ga0307415_10000152515 247
859 3300035117 Ga0373953_0134942 Ga0373953_0134942_36_863 247
860 3300035119 Ga0373956_0090797 Ga0373956_0090797_522_1349 247
861 3300035724 Ga0373933_0101208 Ga0373933_0101208_113_940 247
862 3300042876 Ga0451577_0074025 Ga0451577_0074025_848_1594 248
863 3300044673 Ga0453683_0267674 Ga0453683_0267674_29_775 248
864 3300044712 Ga0453684_0038752 Ga0453684_0038752_1520_2266 248
865 3300045051 Ga0451576_0152462 Ga0451576_0152462_1478_2224 248
866 3300046535 Ga0495586_0004535 Ga0495586_0004535_3156_3911 249
867 3300005293 Ga0065715_10446636 Ga0065715_104466361 251
868 3300031852 Ga0307410_10119550 Ga0307410_101195501 251
869 3300032002 Ga0307416_100532369 Ga0307416_1005323692 251
870 3300032126 Ga0307415_100087669 Ga0307415_1000876692 251
871 3300042876 Ga0451577_0223359 Ga0451577_0223359_731_1492 251
872 3300044712 Ga0453684_0078214 Ga0453684_0078214_1847_2608 251
873 3300045051 Ga0451576_0252978 Ga0451576_0252978_80_841 251
874 3300045051 Ga0451576_0495449 Ga0451576_0495449_112_873 251
875 2162886007 SwRhRL2b_contig_2542722 SwRhRL2b_0004.00001520 252
876 3300005289 Ga0065704_10003802 Ga0065704_100038022 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02167

Cytochrom_C1

Cytochrome C1 family

225

282

0.92

PF02167

Cytochrom_C1

Cytochrome C1 family

49

220

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8snh-assembly1.cif.gz_M cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8075 32 248
8snh-assembly1.cif.gz_M cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.7931 32 248
8snh-assembly1.cif.gz_J cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.7475 32 248
8snh-assembly1.cif.gz_J cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.7003 32 248
2yiu-assembly1.cif.gz_E x-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution 0.6629 41 252
ID Description Score Start End Superfamily
af_A0A1D8PNS7_2_227_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6859 168 189 2.130.10.10
2ex3K05 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 5 0.5987 166 192 4.10.80.20
af_D3ZZ42_329_426_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.5799 165 184 2.110.10.10
2ex3K05 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 5 0.5719 166 192 4.10.80.20
af_A4HRF4_4_304_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5686 165 192 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3D3T4F5-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9104 52 137 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A3D3T4F5-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9007 52 137 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A2A5A6F7-F1-model_v4 Cytochrome C 0.8454 23 252 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A2A5A6F7-F1-model_v4 Cytochrome C 0.83 23 252 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A7X5SBL7-F1-model_v4 Cytochrome c1 0.8263 26 169 GO:0009055
GO:0016020
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
78 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map