F484308

General Info

Members Datasets Scaffolds Average Seq Length
874 373 858 149

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0029615|Ga0495611_0029615_990_1508
Length 172
Sequence MDTFHPGPAQVASRQRCCIRYAGAMLADIAIRLKRLPHGQGLPLPAYATAHAAGMDVVAAEALTLAPGARHAVATGFAIAIPEGYEVQVRPRSGLALKHGVTCLNTPGTIDADYRGEVKVILANLGSEPFVIARGERIAQLVPAAVQRARFEEVELLDETVRGEGGFGSTGR

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
9 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
10 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
11 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
12 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
13 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
14 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
15 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
22 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
235 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
236 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
306 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
307 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
326 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
327 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
328 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
329 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
330 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
331 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
332 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
333 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
334 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
335 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
338 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
339 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
340 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
345 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
361 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
362 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
363 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.46
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0.11
Rhizoplane 1.95
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 5.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005081 3300001979 Bacteria 5587
2 JGI24739J22299_10000986 3300001989 Bacteria 10619
3 JGI24739J22299_10007198 3300001989 Bacteria 4186
4 JGI24739J22299_10074953 3300001989 Bacteria 1047
5 JGI24737J22298_10000178 3300001990 Bacteria 20564
6 JGI24737J22298_10002030 3300001990 Bacteria 7240
7 JGI24735J21928_10105427 3300002067 Bacteria 810
8 JGI24750J21931_1070073 3300002070 Bacteria 572
9 JGI24745J21846_1012602 3300002073 Bacteria 971
10 JGI24738J21930_10000035 3300002075 Bacteria 25714
11 JGI24738J21930_10010010 3300002075 Bacteria 2120
12 JGI24749J21850_1000469 3300002076 Bacteria 5983
13 JGI24744J21845_10040748 3300002077 Bacteria 869
14 JGI24751J29686_10022773 3300002459 Bacteria 1299
15 JGI24751J29686_10110404 3300002459 Bacteria 576
16 rootH1_10116051 3300003316 Bacteria 1495
17 rootH1_10189427 3300003323 Unclassified 2493
18 Ga0055532_1015105 3300003758 Bacteria 857
19 Ga0065715_10431933 3300005293 Bacteria 846
20 Ga0065707_10314600 3300005295 Bacteria 978
21 Ga0070658_10000950 3300005327 Bacteria 24773
22 Ga0070658_10672602 3300005327 Bacteria 898
23 Ga0070658_10879731 3300005327 Bacteria 779
24 Ga0070658_10959707 3300005327 Bacteria 743
25 Ga0070676_10216327 3300005328 Bacteria 1263
26 Ga0070683_100001317 3300005329 Bacteria 18886
27 Ga0070683_100148591 3300005329 Bacteria 2221
28 Ga0070683_100251900 3300005329 Bacteria 1679
29 Ga0070683_100540705 3300005329 Bacteria 1114
30 Ga0070690_100021166 3300005330 Bacteria 3968
31 Ga0070690_100461119 3300005330 Bacteria 944
32 Ga0070670_100027055 3300005331 Bacteria 4933
33 Ga0070670_100083372 3300005331 Bacteria 2747
34 Ga0070670_100086486 3300005331 Bacteria 2693
35 Ga0070670_100139668 3300005331 Bacteria 2095
36 Ga0070670_100160167 3300005331 Bacteria 1950
37 Ga0070670_100949249 3300005331 Bacteria 781
38 Ga0070677_10012789 3300005333 Bacteria 2920
39 Ga0068869_100060475 3300005334 Bacteria 2776
40 Ga0068869_100843939 3300005334 Bacteria 790
41 Ga0070666_10002265 3300005335 Bacteria 11628
42 Ga0070666_10019253 3300005335 Bacteria 4403
43 Ga0070666_10027841 3300005335 Bacteria 3705
44 Ga0070666_10030176 3300005335 Bacteria 3570
45 Ga0070666_10123373 3300005335 Bacteria 1797
46 Ga0070680_100294773 3300005336 Bacteria 1375
47 Ga0070682_100282228 3300005337 Bacteria 1211
48 Ga0070660_100000260 3300005339 Bacteria 34947
49 Ga0070660_100037179 3300005339 Bacteria 3691
50 Ga0070660_100289081 3300005339 Bacteria 1342
51 Ga0070660_100293830 3300005339 Bacteria 1331
52 Ga0070689_100136046 3300005340 Bacteria 1973
53 Ga0070661_100000246 3300005344 Bacteria 44536
54 Ga0070661_100035625 3300005344 Bacteria 3615
55 Ga0070661_100181818 3300005344 Bacteria 1600
56 Ga0070661_100744837 3300005344 Bacteria 801
57 Ga0070692_10716495 3300005345 Bacteria 675
58 Ga0070668_100000028 3300005347 Bacteria 89707
59 Ga0070668_100000064 3300005347 Bacteria 65793
60 Ga0070668_100000468 3300005347 Bacteria 26737
61 Ga0070668_100004618 3300005347 Bacteria 10202
62 Ga0070668_100025986 3300005347 Bacteria 4440
63 Ga0070669_100001504 3300005353 Bacteria 16853
64 Ga0070669_100003371 3300005353 Bacteria 11487
65 Ga0070669_100182914 3300005353 Bacteria 1641
66 Ga0070669_100501148 3300005353 Bacteria 1007
67 Ga0070675_100019838 3300005354 Bacteria 5363
68 Ga0070675_100124634 3300005354 Bacteria 2191
69 Ga0070671_100000829 3300005355 Bacteria 22442
70 Ga0070671_100001575 3300005355 Bacteria 17171
71 Ga0070671_100005874 3300005355 Bacteria 9778
72 Ga0070671_100040285 3300005355 Bacteria 3880
73 Ga0070671_100187231 3300005355 Bacteria 1754
74 Ga0070671_100480140 3300005355 Bacteria 1068
75 Ga0070673_100004134 3300005364 Bacteria 9142
76 Ga0070673_100514552 3300005364 Bacteria 1084
77 Ga0070659_100000195 3300005366 Bacteria 46642
78 Ga0070659_100095743 3300005366 Bacteria 2384
79 Ga0070659_100261312 3300005366 Bacteria 1436
80 Ga0070659_100470982 3300005366 Bacteria 1068
81 Ga0070659_100531552 3300005366 Bacteria 1005
82 Ga0070659_100871826 3300005366 Bacteria 786
83 Ga0070659_101632690 3300005366 Bacteria 576
84 Ga0070667_100000003 3300005367 Bacteria 447715
85 Ga0070667_100000016 3300005367 Bacteria 237028
86 Ga0070667_100003644 3300005367 Bacteria 13107
87 Ga0070667_100004495 3300005367 Bacteria 11767
88 Ga0070667_100009905 3300005367 Bacteria 7901
89 Ga0070667_100012716 3300005367 Bacteria 6958
90 Ga0070714_100746496 3300005435 Bacteria 946
91 Ga0070713_100151733 3300005436 Bacteria 2062
92 Ga0070663_100002814 3300005455 Bacteria 9876
93 Ga0070678_100607394 3300005456 Bacteria 977
94 Ga0070662_100000047 3300005457 Bacteria 66967
95 Ga0070662_100002369 3300005457 Bacteria 11577
96 Ga0070681_10455323 3300005458 Bacteria 1192
97 Ga0068867_100016487 3300005459 Bacteria 5245
98 Ga0070685_10168672 3300005466 Bacteria 1401
99 Ga0070707_100482005 3300005468 Bacteria 1202
100 Ga0070679_100138866 3300005530 Bacteria 2411
101 Ga0070679_100386071 3300005530 Bacteria 1347
102 Ga0070679_101202095 3300005530 Bacteria 703
103 Ga0070684_100042567 3300005535 Bacteria 3921
104 Ga0070684_100126214 3300005535 Bacteria 2305
105 Ga0070684_100186503 3300005535 Bacteria 1886
106 Ga0070684_100611468 3300005535 Bacteria 1013
107 Ga0070684_100709370 3300005535 Bacteria 938
108 Ga0070684_101562541 3300005535 Bacteria 622
109 Ga0068853_100000033 3300005539 Bacteria 113700
110 Ga0068853_100129978 3300005539 Bacteria 2254
111 Ga0068853_100133526 3300005539 Bacteria 2223
112 Ga0068853_100209934 3300005539 Bacteria 1774
113 Ga0068853_101315307 3300005539 Bacteria 699
114 Ga0068853_101674325 3300005539 Bacteria 617
115 Ga0070672_100089311 3300005543 Bacteria 2483
116 Ga0070686_100000235 3300005544 Bacteria 37581
117 Ga0070686_100261290 3300005544 Bacteria 1269
118 Ga0070693_100010785 3300005547 Bacteria 4585
119 Ga0070665_100000038 3300005548 Bacteria 309230
120 Ga0070665_100000070 3300005548 Bacteria 200681
121 Ga0070665_100002115 3300005548 Bacteria 22199
122 Ga0070665_100032833 3300005548 Bacteria 5223
123 Ga0068855_100000531 3300005563 Bacteria 46681
124 Ga0068855_100001755 3300005563 Bacteria 27069
125 Ga0068855_100079313 3300005563 Bacteria 3808
126 Ga0068855_100781375 3300005563 Bacteria 1016
127 Ga0068855_101505804 3300005563 Bacteria 691
128 Ga0070664_100000242 3300005564 Bacteria 39241
129 Ga0070664_100041826 3300005564 Bacteria 3868
130 Ga0070664_100149870 3300005564 Bacteria 2059
131 Ga0068857_100001908 3300005577 Bacteria 16796
132 Ga0068857_100053309 3300005577 Bacteria 3588
133 Ga0068857_100123472 3300005577 Bacteria 2333
134 Ga0068857_100124422 3300005577 Bacteria 2323
135 Ga0068857_100209124 3300005577 Bacteria 1780
136 Ga0068854_100006502 3300005578 Bacteria 7437
137 Ga0068854_100010181 3300005578 Bacteria 6094
138 Ga0068854_100033722 3300005578 Bacteria 3570
139 Ga0068854_100126047 3300005578 Bacteria 1950
140 Ga0068854_100698189 3300005578 Bacteria 875
141 Ga0068854_101903278 3300005578 Bacteria 547
142 Ga0068856_100000162 3300005614 Bacteria 69640
143 Ga0068856_100920639 3300005614 Bacteria 893
144 Ga0068856_101178185 3300005614 Bacteria 783
145 Ga0070702_100184049 3300005615 Bacteria 1369
146 Ga0068852_100000471 3300005616 Bacteria 26414
147 Ga0068852_100003956 3300005616 Bacteria 10413
148 Ga0068852_100143413 3300005616 Bacteria 2213
149 Ga0068852_100280612 3300005616 Bacteria 1606
150 Ga0068852_100532334 3300005616 Bacteria 1173
151 Ga0068852_100921900 3300005616 Bacteria 891
152 Ga0068859_100045654 3300005617 Bacteria 4401
153 Ga0068859_100163402 3300005617 Bacteria 2306
154 Ga0068859_100216750 3300005617 Bacteria 2002
155 Ga0068859_100228159 3300005617 Bacteria 1950
156 Ga0068859_100270285 3300005617 Bacteria 1792
157 Ga0068859_100471064 3300005617 Bacteria 1351
158 Ga0068859_100521586 3300005617 Bacteria 1283
159 Ga0068859_101543891 3300005617 Bacteria 733
160 Ga0068859_101549848 3300005617 Bacteria 732
161 Ga0068859_101842040 3300005617 Bacteria 668
162 Ga0068859_102528791 3300005617 Bacteria 565
163 Ga0068864_100015986 3300005618 Bacteria 6244
164 Ga0068864_100032381 3300005618 Bacteria 4442
165 Ga0068864_100056815 3300005618 Bacteria 3381
166 Ga0068861_100029338 3300005719 Bacteria 4025
167 Ga0068861_100116342 3300005719 Bacteria 2150
168 Ga0068851_10031330 3300005834 Bacteria 2641
169 Ga0068851_10415195 3300005834 Bacteria 794
170 Ga0068863_100000052 3300005841 Bacteria 125430
171 Ga0068863_100000092 3300005841 Bacteria 97076
172 Ga0068863_100000727 3300005841 Bacteria 33031
173 Ga0068863_100002981 3300005841 Bacteria 16743
174 Ga0068863_100062680 3300005841 Bacteria 3516
175 Ga0068863_100066588 3300005841 Bacteria 3407
176 Ga0068863_100100169 3300005841 Bacteria 2754
177 Ga0068863_100177476 3300005841 Bacteria 2044
178 Ga0068858_100000892 3300005842 Bacteria 30965
179 Ga0068858_100009735 3300005842 Bacteria 9154
180 Ga0068858_100015627 3300005842 Bacteria 7139
181 Ga0068858_100133549 3300005842 Bacteria 2328
182 Ga0068858_100415136 3300005842 Bacteria 1294
183 Ga0068860_100000007 3300005843 Bacteria 429329
184 Ga0068860_100000045 3300005843 Bacteria 223252
185 Ga0068860_100000196 3300005843 Bacteria 97096
186 Ga0068860_100006131 3300005843 Bacteria 12091
187 Ga0068860_100010108 3300005843 Bacteria 9349
188 Ga0068860_100076639 3300005843 Bacteria 3180
189 Ga0068860_100167035 3300005843 Bacteria 2124
190 Ga0068860_100595112 3300005843 Bacteria 1111
191 Ga0068860_101474580 3300005843 Bacteria 702
192 Ga0068862_100000385 3300005844 Bacteria 47562
193 Ga0068862_100000877 3300005844 Bacteria 29301
194 Ga0068862_100007339 3300005844 Bacteria 9155
195 Ga0068862_100011387 3300005844 Bacteria 7341
196 Ga0068862_100039746 3300005844 Bacteria 3997
197 Ga0068862_100103090 3300005844 Bacteria 2498
198 Ga0068862_100132959 3300005844 Bacteria 2202
199 Ga0068862_100152714 3300005844 Bacteria 2056
200 Ga0081455_10061870 3300005937 Bacteria 3148
201 Ga0075368_10000152 3300006042 Bacteria 18566
202 Ga0075363_100002645 3300006048 Bacteria 7386
203 Ga0075363_100050909 3300006048 Bacteria 2207
204 Ga0075364_10087542 3300006051 Bacteria 2064
205 Ga0075364_10658184 3300006051 Bacteria 715
206 Ga0075362_10042057 3300006177 Bacteria 2018
207 Ga0075362_10137077 3300006177 Bacteria 1168
208 Ga0075367_10000134 3300006178 Bacteria 22041
209 Ga0075367_10075854 3300006178 Bacteria 2028
210 Ga0075369_10003510 3300006186 Bacteria 5708
211 Ga0075366_10071053 3300006195 Bacteria 2074
212 Ga0075366_10130440 3300006195 Bacteria 1517
213 Ga0075366_10262904 3300006195 Bacteria 1053
214 Ga0075366_10303107 3300006195 Bacteria 977
215 Ga0097621_100039279 3300006237 Bacteria 3801
216 Ga0097621_100171752 3300006237 Bacteria 1869
217 Ga0097621_100934274 3300006237 Bacteria 809
218 Ga0075370_10057671 3300006353 Bacteria 2207
219 Ga0075370_10203751 3300006353 Bacteria 1167
220 Ga0075370_10622442 3300006353 Bacteria 654
221 Ga0068871_100108292 3300006358 Bacteria 2335
222 Ga0068871_100145109 3300006358 Bacteria 2020
223 Ga0075430_100210608 3300006846 Bacteria 1613
224 Ga0075434_100100221 3300006871 Bacteria 2903
225 Ga0075434_100627907 3300006871 Bacteria 1093
226 Ga0075434_102457447 3300006871 Bacteria 523
227 Ga0068865_100087005 3300006881 Bacteria 2257
228 Ga0075436_100714259 3300006914 Bacteria 743
229 Ga0097620_100020395 3300006931 Bacteria 6653
230 Ga0097620_100045653 3300006931 Bacteria 4401
231 Ga0097620_100163398 3300006931 Bacteria 2306
232 Ga0097620_100216746 3300006931 Bacteria 2002
233 Ga0097620_100228162 3300006931 Bacteria 1950
234 Ga0097620_100270299 3300006931 Bacteria 1792
235 Ga0097620_100471065 3300006931 Bacteria 1351
236 Ga0097620_100521583 3300006931 Bacteria 1283
237 Ga0097620_101543352 3300006931 Bacteria 733
238 Ga0097620_101549883 3300006931 Bacteria 732
239 Ga0097620_101842897 3300006931 Bacteria 668
240 Ga0097620_102530419 3300006931 Bacteria 565
241 Ga0105251_10005582 3300009011 Bacteria 8183
242 Ga0105240_10066895 3300009093 Bacteria 4456
243 Ga0105240_10087616 3300009093 Bacteria 3812
244 Ga0105240_10150868 3300009093 Bacteria 2768
245 Ga0105240_10684580 3300009093 Bacteria 1121
246 Ga0105245_10000285 3300009098 Bacteria 48237
247 Ga0105245_10169598 3300009098 Bacteria 2078
248 Ga0105247_10051194 3300009101 Bacteria 2542
249 Ga0105247_10160341 3300009101 Bacteria 1489
250 Ga0105247_10238002 3300009101 Bacteria 1239
251 Ga0105243_10038024 3300009148 Bacteria 3746
252 Ga0105241_10245403 3300009174 Bacteria 1516
253 Ga0105241_12231835 3300009174 Bacteria 543
254 Ga0105248_10000659 3300009177 Bacteria 39245
255 Ga0105248_10011429 3300009177 Bacteria 9784
256 Ga0105248_10161443 3300009177 Bacteria 2528
257 Ga0105248_10225459 3300009177 Bacteria 2109
258 Ga0105248_11980827 3300009177 Bacteria 662
259 Ga0105248_13001525 3300009177 Bacteria 537
260 Ga0105237_10710107 3300009545 Bacteria 1012
261 Ga0105238_10008171 3300009551 Bacteria 10468
262 Ga0105238_10038975 3300009551 Bacteria 4822
263 Ga0105238_10253224 3300009551 Bacteria 1739
264 Ga0105238_10672731 3300009551 Bacteria 1046
265 Ga0105238_12135921 3300009551 Bacteria 594
266 Ga0105249_10000574 3300009553 Bacteria 33721
267 Ga0105249_10056713 3300009553 Bacteria 3587
268 Ga0105249_10088658 3300009553 Bacteria 2890
269 Ga0105249_10854049 3300009553 Bacteria 976
270 Ga0105239_10011926 3300010375 Bacteria 9695
271 Ga0105239_10130902 3300010375 Bacteria 2791
272 Ga0105239_10580364 3300010375 Bacteria 1278
273 Ga0105239_11365987 3300010375 Bacteria 818
274 Ga0105246_10184144 3300011119 Bacteria 1611
275 Ga0157373_10022263 3300013100 Bacteria 4599
276 Ga0157373_10050159 3300013100 Bacteria 2973
277 Ga0157373_10068400 3300013100 Bacteria 2510
278 Ga0157373_10155580 3300013100 Bacteria 1608
279 Ga0157373_10299862 3300013100 Bacteria 1140
280 Ga0157373_10723507 3300013100 Bacteria 730
281 Ga0157373_10918408 3300013100 Bacteria 650
282 Ga0157371_10014963 3300013102 Bacteria 5836
283 Ga0157371_10079335 3300013102 Bacteria 2325
284 Ga0157371_10091128 3300013102 Bacteria 2159
285 Ga0157371_10180439 3300013102 Bacteria 1510
286 Ga0157371_10313661 3300013102 Bacteria 1137
287 Ga0157371_10356052 3300013102 Bacteria 1066
288 Ga0157370_10036970 3300013104 Bacteria 4736
289 Ga0157370_10334480 3300013104 Bacteria 1396
290 Ga0157370_10384626 3300013104 Bacteria 1292
291 Ga0157369_10017738 3300013105 Bacteria 7995
292 Ga0157369_10022100 3300013105 Bacteria 7106
293 Ga0157369_10101220 3300013105 Bacteria 3071
294 Ga0157369_10126550 3300013105 Bacteria 2708
295 Ga0157369_10419918 3300013105 Bacteria 1386
296 Ga0157369_10427958 3300013105 Bacteria 1372
297 Ga0157369_10996038 3300013105 Bacteria 858
298 Ga0157374_10922535 3300013296 Bacteria 891
299 Ga0157378_10028389 3300013297 Bacteria 4936
300 Ga0157378_10029855 3300013297 Bacteria 4814
301 Ga0163162_10000077 3300013306 Viruses 90095
302 Ga0163162_10020508 3300013306 Bacteria 6495
303 Ga0163162_10392518 3300013306 Bacteria 1520
304 Ga0157372_10005572 3300013307 Bacteria 13383
305 Ga0157372_10047838 3300013307 Bacteria 4753
306 Ga0157372_10354969 3300013307 Bacteria 1708
307 Ga0157372_10361528 3300013307 Bacteria 1691
308 Ga0157372_10472375 3300013307 Bacteria 1462
309 Ga0157375_11138896 3300013308 Bacteria 914
310 Ga0157375_11821260 3300013308 Bacteria 722
311 Ga0163163_10000273 3300014325 Bacteria 51622
312 Ga0157380_10003514 3300014326 Bacteria 10769
313 Ga0157380_10726996 3300014326 Bacteria 1001
314 Ga0157377_10597970 3300014745 Bacteria 786
315 Ga0157379_10099121 3300014968 Bacteria 2616
316 Ga0157376_12087936 3300014969 Bacteria 605
317 Ga0206356_10192360 3300020070 Bacteria 2814
318 Ga0206354_10727992 3300020081 Bacteria 8937
319 Ga0206353_11090631 3300020082 Bacteria 8670
320 Ga0213873_10000009 3300021358 Bacteria 237102
321 Ga0213876_10000004 3300021384 Bacteria 943822
322 Ga0213876_10008570 3300021384 Bacteria 5535
323 Ga0209147_100921 3300025229 Bacteria 13170
324 Ga0207697_10000881 3300025315 Bacteria 16992
325 Ga0207697_10083317 3300025315 Bacteria 1349
326 Ga0207656_10004743 3300025321 Bacteria 4768
327 Ga0207656_10560469 3300025321 Bacteria 582
328 Ga0207713_1002734 3300025735 Bacteria 12572
329 Ga0207710_10138298 3300025900 Bacteria 1174
330 Ga0207688_10000317 3300025901 Bacteria 22230
331 Ga0207680_10001920 3300025903 Bacteria 9744
332 Ga0207680_10018954 3300025903 Bacteria 3672
333 Ga0207680_10026804 3300025903 Bacteria 3199
334 Ga0207680_10140136 3300025903 Bacteria 1603
335 Ga0207680_10140625 3300025903 Bacteria 1600
336 Ga0207647_10000253 3300025904 Bacteria 43758
337 Ga0207647_10006748 3300025904 Bacteria 8332
338 Ga0207647_10050706 3300025904 Bacteria 2568
339 Ga0207647_10076958 3300025904 Bacteria 2006
340 Ga0207647_10153480 3300025904 Bacteria 1345
341 Ga0207705_10000062 3300025909 Bacteria 149432
342 Ga0207705_10034240 3300025909 Bacteria 3631
343 Ga0207705_10050994 3300025909 Bacteria 2979
344 Ga0207654_10092434 3300025911 Bacteria 1847
345 Ga0207654_10199835 3300025911 Bacteria 1316
346 Ga0207654_10298773 3300025911 Bacteria 1094
347 Ga0207707_10096206 3300025912 Bacteria 2588
348 Ga0207707_10450058 3300025912 Bacteria 1102
349 Ga0207707_10901100 3300025912 Bacteria 731
350 Ga0207695_10013403 3300025913 Bacteria 9779
351 Ga0207695_10271142 3300025913 Bacteria 1593
352 Ga0207695_10614868 3300025913 Bacteria 968
353 Ga0207660_10041658 3300025917 Bacteria 3219
354 Ga0207660_11032129 3300025917 Bacteria 670
355 Ga0207657_10000403 3300025919 Bacteria 45863
356 Ga0207657_10000946 3300025919 Bacteria 30768
357 Ga0207657_10005971 3300025919 Bacteria 12670
358 Ga0207657_10013271 3300025919 Bacteria 8083
359 Ga0207657_10119775 3300025919 Bacteria 2166
360 Ga0207657_10139818 3300025919 Bacteria 1979
361 Ga0207657_10201408 3300025919 Bacteria 1601
362 Ga0207657_10430477 3300025919 Bacteria 1036
363 Ga0207649_10000230 3300025920 Bacteria 45560
364 Ga0207649_10057862 3300025920 Bacteria 2425
365 Ga0207649_10154061 3300025920 Bacteria 1586
366 Ga0207649_10391836 3300025920 Bacteria 1037
367 Ga0207649_10812423 3300025920 Bacteria 730
368 Ga0207652_10628159 3300025921 Bacteria 962
369 Ga0207681_10003582 3300025923 Bacteria 9670
370 Ga0207681_10003999 3300025923 Bacteria 9150
371 Ga0207681_10135485 3300025923 Bacteria 1827
372 Ga0207681_10190801 3300025923 Bacteria 1568
373 Ga0207694_10001776 3300025924 Bacteria 18021
374 Ga0207694_10004075 3300025924 Bacteria 11490
375 Ga0207694_10474597 3300025924 Bacteria 1046
376 Ga0207650_10020484 3300025925 Bacteria 4665
377 Ga0207650_10062456 3300025925 Bacteria 2783
378 Ga0207650_10081795 3300025925 Bacteria 2450
379 Ga0207659_10035708 3300025926 Bacteria 3438
380 Ga0207659_10265706 3300025926 Bacteria 1398
381 Ga0207687_10007641 3300025927 Bacteria 7107
382 Ga0207664_11031449 3300025929 Bacteria 737
383 Ga0207644_10000125 3300025931 Bacteria 56447
384 Ga0207644_10000569 3300025931 Bacteria 23672
385 Ga0207644_10020991 3300025931 Bacteria 4446
386 Ga0207644_10032656 3300025931 Bacteria 3633
387 Ga0207644_10035130 3300025931 Bacteria 3510
388 Ga0207644_10292079 3300025931 Bacteria 1311
389 Ga0207644_10430088 3300025931 Bacteria 1082
390 Ga0207690_10000155 3300025932 Bacteria 53735
391 Ga0207690_10080730 3300025932 Bacteria 2270
392 Ga0207690_10084474 3300025932 Bacteria 2225
393 Ga0207690_10781949 3300025932 Bacteria 788
394 Ga0207706_10000342 3300025933 Bacteria 50517
395 Ga0207706_10000643 3300025933 Bacteria 37034
396 Ga0207670_10113087 3300025936 Bacteria 1960
397 Ga0207704_10029226 3300025938 Bacteria 3070
398 Ga0207691_10000848 3300025940 Bacteria 30357
399 Ga0207691_10108497 3300025940 Bacteria 2470
400 Ga0207711_10006705 3300025941 Bacteria 9690
401 Ga0207711_10014364 3300025941 Bacteria 6576
402 Ga0207711_10016073 3300025941 Bacteria 6210
403 Ga0207711_10292234 3300025941 Bacteria 1502
404 Ga0207689_10000017 3300025942 Bacteria 117159
405 Ga0207689_10153331 3300025942 Bacteria 1899
406 Ga0207661_10000947 3300025944 Bacteria 19105
407 Ga0207661_10012302 3300025944 Bacteria 6215
408 Ga0207661_10436692 3300025944 Bacteria 1191
409 Ga0207679_10000213 3300025945 Bacteria 45916
410 Ga0207679_10049081 3300025945 Bacteria 3077
411 Ga0207667_10001300 3300025949 Bacteria 31316
412 Ga0207667_10001543 3300025949 Bacteria 28962
413 Ga0207667_10180783 3300025949 Bacteria 2166
414 Ga0207667_10485200 3300025949 Bacteria 1254
415 Ga0207667_11151997 3300025949 Bacteria 757
416 Ga0207651_10002101 3300025960 Bacteria 9407
417 Ga0207712_10000476 3300025961 Bacteria 33733
418 Ga0207712_10057347 3300025961 Bacteria 2748
419 Ga0207712_10159561 3300025961 Bacteria 1751
420 Ga0207712_10314157 3300025961 Bacteria 1290
421 Ga0207668_10000030 3300025972 Bacteria 122797
422 Ga0207668_10000076 3300025972 Bacteria 75056
423 Ga0207668_10001049 3300025972 Bacteria 16486
424 Ga0207668_10003547 3300025972 Bacteria 9173
425 Ga0207668_10034211 3300025972 Bacteria 3373
426 Ga0207668_10113134 3300025972 Bacteria 2040
427 Ga0207668_10158411 3300025972 Bacteria 1761
428 Ga0207640_10013642 3300025981 Bacteria 4663
429 Ga0207640_10015320 3300025981 Bacteria 4435
430 Ga0207640_10068231 3300025981 Bacteria 2382
431 Ga0207640_10164718 3300025981 Bacteria 1645
432 Ga0207640_10915216 3300025981 Bacteria 767
433 Ga0207640_11775412 3300025981 Bacteria 557
434 Ga0207658_10000002 3300025986 Bacteria 1364188
435 Ga0207658_10000075 3300025986 Bacteria 109004
436 Ga0207658_10005000 3300025986 Bacteria 9134
437 Ga0207658_10005408 3300025986 Bacteria 8761
438 Ga0207658_10029070 3300025986 Bacteria 3898
439 Ga0207658_10060416 3300025986 Bacteria 2828
440 Ga0207658_10075950 3300025986 Bacteria 2558
441 Ga0207658_10878567 3300025986 Bacteria 816
442 Ga0207677_11214999 3300026023 Bacteria 690
443 Ga0207703_10000358 3300026035 Bacteria 49140
444 Ga0207703_10077833 3300026035 Bacteria 2754
445 Ga0207703_10108548 3300026035 Bacteria 2364
446 Ga0207703_10271113 3300026035 Bacteria 1537
447 Ga0207639_10000199 3300026041 Bacteria 45241
448 Ga0207639_10000347 3300026041 Bacteria 32007
449 Ga0207639_10094150 3300026041 Bacteria 2404
450 Ga0207639_10159640 3300026041 Bacteria 1898
451 Ga0207639_10175880 3300026041 Bacteria 1817
452 Ga0207639_10384484 3300026041 Bacteria 1261
453 Ga0207639_10739372 3300026041 Bacteria 914
454 Ga0207639_10979968 3300026041 Bacteria 791
455 Ga0207678_10137305 3300026067 Bacteria 2086
456 Ga0207678_10431540 3300026067 Bacteria 1143
457 Ga0207708_10375209 3300026075 Bacteria 1172
458 Ga0207702_10000496 3300026078 Bacteria 44248
459 Ga0207702_10098715 3300026078 Bacteria 2573
460 Ga0207702_10355059 3300026078 Bacteria 1404
461 Ga0207702_10617275 3300026078 Bacteria 1065
462 Ga0207702_11267867 3300026078 Bacteria 731
463 Ga0207702_11297307 3300026078 Bacteria 722
464 Ga0207641_10000004 3300026088 Bacteria 481088
465 Ga0207641_10000042 3300026088 Bacteria 186384
466 Ga0207641_10000720 3300026088 Bacteria 35557
467 Ga0207641_10000959 3300026088 Bacteria 29576
468 Ga0207641_10004191 3300026088 Bacteria 12564
469 Ga0207641_10043172 3300026088 Bacteria 3785
470 Ga0207641_10080673 3300026088 Bacteria 2823
471 Ga0207641_10253550 3300026088 Bacteria 1644
472 Ga0207641_10572491 3300026088 Bacteria 1103
473 Ga0207641_10935034 3300026088 Bacteria 862
474 Ga0207648_10001216 3300026089 Bacteria 28854
475 Ga0207676_10001237 3300026095 Bacteria 19005
476 Ga0207676_10019321 3300026095 Bacteria 4969
477 Ga0207676_10026624 3300026095 Bacteria 4300
478 Ga0207676_10802081 3300026095 Bacteria 918
479 Ga0207674_10000945 3300026116 Bacteria 37959
480 Ga0207674_10005054 3300026116 Bacteria 15745
481 Ga0207674_10006327 3300026116 Bacteria 13948
482 Ga0207674_10013895 3300026116 Bacteria 8909
483 Ga0207674_10099138 3300026116 Bacteria 2896
484 Ga0207674_10171056 3300026116 Bacteria 2126
485 Ga0207674_10193815 3300026116 Bacteria 1982
486 Ga0207674_10268205 3300026116 Bacteria 1654
487 Ga0207675_100046539 3300026118 Bacteria 4053
488 Ga0207675_100056638 3300026118 Bacteria 3656
489 Ga0207698_10000427 3300026142 Bacteria 24235
490 Ga0207698_10015214 3300026142 Bacteria 5148
491 Ga0207698_10334046 3300026142 Bacteria 1425
492 Ga0207698_10673859 3300026142 Bacteria 1027
493 Ga0207698_10720843 3300026142 Bacteria 994
494 Ga0209813_10000017 3300027866 Bacteria 75687
495 Ga0209813_10000082 3300027866 Bacteria 34870
496 Ga0209974_10034832 3300027876 Bacteria 1672
497 Ga0268266_10000118 3300028379 Bacteria 163466
498 Ga0268266_10000309 3300028379 Bacteria 77336
499 Ga0268266_10002431 3300028379 Bacteria 20016
500 Ga0268266_10005364 3300028379 Bacteria 11980
501 Ga0268266_10122751 3300028379 Bacteria 2313
502 Ga0268265_10000424 3300028380 Bacteria 45348
503 Ga0268265_10000469 3300028380 Bacteria 42727
504 Ga0268265_10028122 3300028380 Bacteria 4022
505 Ga0268265_10084403 3300028380 Bacteria 2517
506 Ga0268265_10108110 3300028380 Bacteria 2263
507 Ga0268265_10149817 3300028380 Bacteria 1966
508 Ga0268265_10219792 3300028380 Bacteria 1661
509 Ga0268265_10501821 3300028380 Bacteria 1143
510 Ga0268265_10937659 3300028380 Bacteria 852
511 Ga0268264_10000087 3300028381 Bacteria 236696
512 Ga0268264_10000091 3300028381 Bacteria 233338
513 Ga0268264_10000101 3300028381 Bacteria 225109
514 Ga0268264_10000134 3300028381 Bacteria 179475
515 Ga0268264_10011832 3300028381 Bacteria 7193
516 Ga0268264_10053504 3300028381 Bacteria 3368
517 Ga0268264_10153593 3300028381 Bacteria 2066
518 Ga0307517_10187486 3300028786 Bacteria 1321
519 Ga0265338_10199094 3300028800 Bacteria 1512
520 Ga0265331_10059525 3300031250 Bacteria 1806
521 Ga0265327_10047419 3300031251 Bacteria 2268
522 Ga0307513_10109817 3300031456 Bacteria 2755
523 Ga0307408_100010852 3300031548 Bacteria 6011
524 Ga0307408_100105234 3300031548 Bacteria 2157
525 Ga0307408_100492285 3300031548 Bacteria 1072
526 Ga0307408_100916674 3300031548 Bacteria 803
527 Ga0307408_101114027 3300031548 Bacteria 733
528 Ga0265313_10255408 3300031595 Bacteria 714
529 Ga0316575_10001316 3300031665 Bacteria 7930
530 Ga0316575_10439230 3300031665 Bacteria 562
531 Ga0265314_10015740 3300031711 Bacteria 5992
532 Ga0307516_10152207 3300031730 Bacteria 2072
533 Ga0307405_10029770 3300031731 Bacteria 3194
534 Ga0307405_10145134 3300031731 Bacteria 1661
535 Ga0307405_11099492 3300031731 Bacteria 683
536 Ga0307413_10105216 3300031824 Bacteria 1875
537 Ga0307413_10818549 3300031824 Bacteria 784
538 Ga0307413_10985474 3300031824 Bacteria 721
539 Ga0307410_10014693 3300031852 Bacteria 4618
540 Ga0307406_10118407 3300031901 Bacteria 1836
541 Ga0307406_10431377 3300031901 Bacteria 1053
542 Ga0307406_10728889 3300031901 Bacteria 830
543 Ga0307406_11020277 3300031901 Bacteria 711
544 Ga0307407_10286441 3300031903 Bacteria 1143
545 Ga0307407_10822272 3300031903 Bacteria 708
546 Ga0307412_10160407 3300031911 Bacteria 1670
547 Ga0307412_10245213 3300031911 Bacteria 1388
548 Ga0307412_10471254 3300031911 Bacteria 1039
549 Ga0307412_11388979 3300031911 Bacteria 635
550 Ga0307409_100018325 3300031995 Bacteria 4703
551 Ga0307409_100065368 3300031995 Bacteria 2862
552 Ga0307409_100600216 3300031995 Bacteria 1088
553 Ga0307409_101338017 3300031995 Bacteria 742
554 Ga0307416_100016385 3300032002 Bacteria 5151
555 Ga0307416_100061652 3300032002 Bacteria 3062
556 Ga0307416_100824235 3300032002 Bacteria 1025
557 Ga0307414_10005500 3300032004 Bacteria 6982
558 Ga0307414_10084360 3300032004 Bacteria 2336
559 Ga0307414_10370744 3300032004 Bacteria 1235
560 Ga0307414_10393213 3300032004 Bacteria 1202
561 Ga0307414_10475099 3300032004 Bacteria 1101
562 Ga0307414_11192195 3300032004 Bacteria 705
563 Ga0307411_10010117 3300032005 Bacteria 5007
564 Ga0307411_10434007 3300032005 Bacteria 1094
565 Ga0307415_100418905 3300032126 Bacteria 1149
566 Ga0316583_10012845 3300032133 Bacteria 3022
567 Ga0373959_0015955 3300034820 Bacteria 1386
568 Ga0373938_0064894 3300034957 Bacteria 861
569 Ga0373934_0303686 3300035086 Bacteria 662
570 Ga0373923_0004387 3300035111 Bacteria 4675
571 Ga0373923_0106023 3300035111 Bacteria 1244
572 Ga0373956_0010017 3300035119 Bacteria 3868
573 Ga0373957_0017656 3300035120 Bacteria 2489
574 Ga0373960_0015422 3300035121 Bacteria 1951
575 Ga0373955_0002366 3300035172 Bacteria 8205
576 Ga0373942_0048300 3300035207 Bacteria 1185
577 Ga0373962_0096931 3300035242 Bacteria 915
578 Ga0373931_0047725 3300035691 Bacteria 2267
579 Ga0373935_0547913 3300035692 Bacteria 843
580 Ga0373933_0086952 3300035724 Bacteria 1924
581 Ga0373937_0006632 3300036401 Bacteria 9994
582 Ga0316582_0224828 3300036647 Bacteria 1284
583 Ga0316582_0889782 3300036647 Unclassified 609
584 Ga0316584_0024034 3300036712 Bacteria 4456
585 Ga0373925_0256850 3300037068 Bacteria 1403
586 Ga0395899_0037881 3300037312 Bacteria 3614
587 Ga0395899_0046407 3300037312 Bacteria 3236
588 Ga0395899_0076741 3300037312 Bacteria 2438
589 Ga0395899_0076776 3300037312 Bacteria 2438
590 Ga0395899_0110916 3300037312 Bacteria 1972
591 Ga0395899_0388300 3300037312 Bacteria 926
592 Ga0395899_0396896 3300037312 Bacteria 913
593 Ga0395900_0000209 3300037418 Bacteria 91678
594 Ga0395900_0052961 3300037418 Bacteria 4177
595 Ga0395900_0084617 3300037418 Bacteria 3259
596 Ga0395900_0139753 3300037418 Bacteria 2480
597 Ga0395900_0167894 3300037418 Bacteria 2235
598 Ga0395900_0242926 3300037418 Bacteria 1805
599 Ga0395900_0348972 3300037418 Bacteria 1453
600 Ga0395900_0367241 3300037418 Bacteria 1409
601 Ga0395900_0727841 3300037418 Bacteria 924
602 Ga0395900_0833971 3300037418 Bacteria 848
603 Ga0395900_0972316 3300037418 Bacteria 770
604 Ga0395898_0004531 3300037466 Bacteria 15168
605 Ga0395898_0038647 3300037466 Bacteria 4728
606 Ga0395898_0230714 3300037466 Bacteria 1765
607 Ga0395898_0244719 3300037466 Bacteria 1710
608 Ga0395898_0369396 3300037466 Bacteria 1368
609 Ga0395898_0591404 3300037466 Bacteria 1052
610 Ga0395898_1363132 3300037466 Bacteria 637
611 Ga0395905_0008172 3300037471 Bacteria 10331
612 Ga0395905_0025304 3300037471 Bacteria 5597
613 Ga0395905_0050182 3300037471 Bacteria 3910
614 Ga0395905_0096517 3300037471 Bacteria 2775
615 Ga0395905_0103309 3300037471 Bacteria 2675
616 Ga0395905_0208157 3300037471 Bacteria 1833
617 Ga0395905_0306413 3300037471 Bacteria 1476
618 Ga0395905_0439178 3300037471 Bacteria 1202
619 Ga0395905_0864200 3300037471 Bacteria 807
620 Ga0395905_1373346 3300037471 Bacteria 610
621 Ga0395905_1492281 3300037471 Bacteria 580
622 Ga0395905_1747883 3300037471 Bacteria 527
623 Ga0436364_0619037 3300037853 Bacteria 1986
624 Ga0395901_0008144 3300038443 Bacteria 10588
625 Ga0395901_0134144 3300038443 Bacteria 2602
626 Ga0395901_0282727 3300038443 Bacteria 1723
627 Ga0395901_0288212 3300038443 Bacteria 1704
628 Ga0395901_0330994 3300038443 Bacteria 1574
629 Ga0395901_0511359 3300038443 Bacteria 1221
630 Ga0395901_0611927 3300038443 Bacteria 1097
631 Ga0395901_0967425 3300038443 Bacteria 829
632 Ga0395901_1103085 3300038443 Bacteria 764
633 Ga0436365_0192103 3300039437 Bacteria 182879
634 Ga0436365_0410983 3300039437 Bacteria 18944
635 Ga0436363_0930037 3300039450 Bacteria 682
636 Ga0436362_0383697 3300039453 Bacteria 74416
637 Ga0439447_000009 3300041407 Unclassified 90162
638 Ga0439453_0005321 3300041408 Bacteria 1955
639 Ga0439466_0009170 3300041411 Viruses 3707
640 Ga0451791_1678702 3300041451 Bacteria 622
641 Ga0451800_1418878 3300041459 Bacteria 551
642 Ga0451853_3208052 3300041512 Bacteria 606
643 Ga0439446_0146374 3300042156 Unclassified 774
644 Ga0439434_0109128 3300042435 Bacteria 895
645 Ga0451577_0003514 3300042876 Bacteria 17371
646 Ga0466969_0108133 3300044656 Bacteria 1304
647 Ga0466963_0085421 3300044694 Bacteria 2142
648 Ga0466957_0085985 3300044842 Bacteria 1965
649 Ga0466959_0104571 3300045049 Bacteria 2025
650 Ga0451576_0008302 3300045051 Bacteria 12207
651 Ga0451576_0264872 3300045051 Bacteria 1796
652 Ga0495617_074497 3300046452 Bacteria 1114
653 Ga0495627_000570 3300046453 Bacteria 29747
654 Ga0495627_001851 3300046453 Bacteria 11213
655 Ga0495638_0123113 3300046460 Bacteria 1531
656 Ga0495638_0165833 3300046460 Bacteria 1271
657 Ga0495650_0145666 3300046471 Bacteria 854
658 Ga0495650_0201405 3300046471 Bacteria 692
659 Ga0495584_0005846 3300046491 Bacteria 6482
660 Ga0495596_0000008 3300046500 Bacteria 150860
661 Ga0495583_0000577 3300046506 Bacteria 50418
662 Ga0495606_0003324 3300046507 Bacteria 17167
663 Ga0495606_0139796 3300046507 Bacteria 1431
664 Ga0495610_0000268 3300046512 Bacteria 54316
665 Ga0495616_0348458 3300046513 Bacteria 617
666 Ga0495631_0106470 3300046518 Bacteria 1206
667 Ga0495632_0000075 3300046519 Bacteria 102051
668 Ga0495632_0060944 3300046519 Bacteria 1832
669 Ga0495637_0000123 3300046520 Bacteria 57717
670 Ga0495637_0000890 3300046520 Bacteria 19264
671 Ga0495643_0000009 3300046522 Bacteria 344767
672 Ga0495643_0015079 3300046522 Bacteria 4579
673 Ga0495648_0002760 3300046524 Bacteria 15853
674 Ga0495663_0000003 3300046525 Bacteria 362694
675 Ga0495642_0073523 3300046528 Bacteria 1432
676 Ga0495654_0192564 3300046530 Bacteria 877
677 Ga0495621_0009525 3300046539 Bacteria 2953
678 Ga0495621_0020629 3300046539 Bacteria 2165
679 Ga0495633_0000173 3300046558 Bacteria 84576
680 Ga0495633_0000834 3300046558 Bacteria 27197
681 Ga0495656_0000023 3300046615 Unclassified 88819
682 Ga0495668_0358132 3300046616 Bacteria 801
683 Ga0495611_0029615 3300046648 Bacteria 2401
684 Ga0495625_0037398 3300046660 Bacteria 3562
685 Ga0495625_0165371 3300046660 Bacteria 1479
686 Ga0495625_0680309 3300046660 Bacteria 610
687 Ga0495659_0000192 3300046664 Bacteria 26727
688 Ga0495661_0191590 3300046665 Bacteria 1076
689 Ga0495623_0012520 3300046679 Bacteria 5488
690 Ga0495670_0046480 3300046691 Bacteria 2168
691 Ga0495670_0072476 3300046691 Bacteria 1745
692 Ga0495671_0000013 3300046692 Bacteria 344767
693 Ga0495671_0068061 3300046692 Bacteria 1751
694 Ga0495671_0080367 3300046692 Bacteria 1597
695 Ga0495672_0109202 3300047320 Bacteria 1487
696 Ga0495687_182929 3300047443 Bacteria 682
697 Ga0495681_0000059 3300047470 Bacteria 102400
698 Ga0495681_0001690 3300047470 Bacteria 16347
699 Ga0495681_0095122 3300047470 Bacteria 1310
700 Ga0495686_0000430 3300047472 Bacteria 65300
701 Ga0495686_0001136 3300047472 Bacteria 31452
702 Ga0495686_0001320 3300047472 Bacteria 27790
703 Ga0495686_0001775 3300047472 Bacteria 21986
704 Ga0495686_0026479 3300047472 Bacteria 3793
705 Ga0495686_0167029 3300047472 Bacteria 1282
706 Ga0496101_0066545 3300048904 Bacteria 2629
707 Ga0496102_0007382 3300048905 Bacteria 9389
708 Ga0496102_0008608 3300048905 Viruses 8755
709 Ga0496102_0662149 3300048905 Bacteria 967
710 Ga0496103_0003095 3300048906 Bacteria 10222
711 Ga0496103_0710718 3300048906 Bacteria 637
712 Ga0496104_0010352 3300048907 Bacteria 8329
713 Ga0496105_0007301 3300048908 Bacteria 8537
714 Ga0496106_0726706 3300048909 Bacteria 790
715 Ga0496109_0178434 3300048912 Bacteria 1994
716 Ga0496109_0415352 3300048912 Bacteria 1271
717 Ga0496110_0169877 3300048913 Bacteria 1978
718 Ga0496110_0186659 3300048913 Bacteria 1883
719 Ga0496111_0616798 3300048914 Bacteria 793
720 Ga0496114_0000131 3300048917 Bacteria 54315
721 Ga0496116_0000089 3300048919 Bacteria 213129
722 Ga0496116_0020569 3300048919 Bacteria 5009
723 Ga0496117_0003608 3300048920 Bacteria 17829
724 Ga0496117_0014014 3300048920 Bacteria 6938
725 Ga0496117_0024513 3300048920 Bacteria 4768
726 Ga0496117_0052042 3300048920 Bacteria 2888
727 Ga0496117_0083593 3300048920 Bacteria 2086
728 Ga0496117_0093819 3300048920 Bacteria 1923
729 Ga0496118_0004303 3300048921 Bacteria 17009
730 Ga0496118_0010761 3300048921 Bacteria 9017
731 Ga0496118_0023122 3300048921 Bacteria 5410
732 Ga0496118_0039935 3300048921 Bacteria 3738
733 Ga0496118_0281397 3300048921 Bacteria 925
734 Ga0496119_0102841 3300048922 Bacteria 1601
735 Ga0496119_0260541 3300048922 Bacteria 870
736 Ga0496120_0058204 3300048923 Bacteria 2172
737 Ga0496120_0133236 3300048923 Bacteria 1270
738 Ga0496121_0000196 3300048924 Bacteria 135812
739 Ga0496121_0006803 3300048924 Bacteria 14006
740 Ga0496122_0001736 3300048925 Bacteria 33820
741 Ga0496123_0000590 3300048926 Bacteria 61951
742 Ga0496123_0147502 3300048926 Bacteria 1275
743 Ga0496124_0008334 3300048927 Bacteria 10854
744 Ga0496124_0032443 3300048927 Bacteria 4611
745 Ga0496124_0122778 3300048927 Bacteria 2073
746 Ga0496124_0424727 3300048927 Bacteria 914
747 Ga0496124_0546701 3300048927 Bacteria 765
748 Ga0496125_0049512 3300048928 Bacteria 3491
749 Ga0496125_0403189 3300048928 Bacteria 798
750 Ga0496126_0039078 3300048929 Bacteria 4407
751 Ga0496126_0319523 3300048929 Bacteria 1276
752 Ga0501307_041291 3300049162 Bacteria 671
753 Ga0495678_054039 3300049459 Bacteria 1539
754 Ga0495682_0002949 3300049460 Bacteria 7781
755 Ga0501290_000159 3300049513 Bacteria 10830
756 Ga0501292_000020 3300049515 Bacteria 54099
757 Ga0501294_000244 3300049517 Bacteria 6757
758 Ga0501031_0197420 3300049568 Bacteria 1313
759 Ga0501032_0028908 3300049569 Bacteria 3807
760 Ga0501032_0406198 3300049569 Bacteria 875
761 Ga0501033_0389042 3300049570 Bacteria 974
762 Ga0501034_0054204 3300049571 Bacteria 4037
763 Ga0501034_0057262 3300049571 Bacteria 3919
764 Ga0501034_0545075 3300049571 Bacteria 1070
765 Ga0501037_0117007 3300049573 Bacteria 1918
766 Ga0501039_0269984 3300049575 Bacteria 1337
767 Ga0501039_1071627 3300049575 Bacteria 625
768 Ga0501040_0750192 3300049576 Bacteria 706
769 Ga0501041_0549636 3300049577 Bacteria 736
770 Ga0501042_0270174 3300049578 Bacteria 1228
771 Ga0501043_0079703 3300049579 Bacteria 2573
772 Ga0501046_0056977 3300049580 Bacteria 3066
773 Ga0501047_0002116 3300049581 Bacteria 18997
774 Ga0501047_0274117 3300049581 Bacteria 1533
775 Ga0501047_0903470 3300049581 Bacteria 696
776 Ga0501047_0911445 3300049581 Bacteria 692
777 Ga0501048_0074973 3300049582 Bacteria 2387
778 Ga0501067_0003583 3300049583 Bacteria 8552
779 Ga0501068_0242824 3300049584 Bacteria 1146
780 Ga0501072_0679489 3300049588 Bacteria 810
781 Ga0501074_0891450 3300049590 Bacteria 626
782 Ga0501206_000401 3300049653 Bacteria 5161
783 Ga0501222_000648 3300049662 Bacteria 5093
784 Ga0501223_005698 3300049663 Bacteria 2605
785 Ga0501224_000328 3300049664 Bacteria 5557
786 Ga0501235_011202 3300049669 Bacteria 1964
787 Ga0501249_001014 3300049679 Bacteria 6031
788 Ga0501257_000031 3300049686 Bacteria 40822
789 Ga0501259_000367 3300049688 Bacteria 7092
790 Ga0501261_001824 3300049690 Bacteria 2621
791 Ga0501225_0009052 3300049705 Bacteria 2845
792 Ga0501245_000196 3300049708 Bacteria 6766
793 Ga0501079_0197723 3300049741 Bacteria 1570
794 Ga0501079_0629603 3300049741 Bacteria 844
795 Ga0501279_000022 3300049775 Bacteria 54370
796 Ga0501280_000353 3300049776 Bacteria 11455
797 Ga0501280_003906 3300049776 Bacteria 2239
798 Ga0501281_00259 3300049777 Bacteria 5634
799 Ga0501282_000191 3300049778 Bacteria 7523
800 Ga0501035_0122135 3300049822 Bacteria 2276
801 Ga0501035_0358936 3300049822 Bacteria 1218
802 Ga0501035_0386940 3300049822 Bacteria 1166
803 Ga0501044_0077021 3300049823 Bacteria 3383
804 Ga0501044_0086482 3300049823 Bacteria 3167
805 Ga0501045_0887699 3300049824 Bacteria 655
806 Ga0501204_009184 3300049850 Bacteria 1138
807 nmdc:mga03683_259403_c1 3300050489 Bacteria 809
808 nmdc:mga03683_3517_c1 3300050489 Bacteria 5070
809 nmdc:mga03n38_40422_c1 3300050490 Bacteria 2027
810 nmdc:mga03n38_47793_c1 3300050490 Bacteria 1896
811 nmdc:mga03n38_75671_c1 3300050490 Bacteria 1569
812 nmdc:mga00v17_51062_c1 3300050491 Bacteria 2515
813 nmdc:mga00v17_5310_c1 3300050491 Bacteria 6788
814 nmdc:mga00v17_581703_c1 3300050491 Bacteria 723
815 nmdc:mga0yw44_108049_c1 3300050492 Bacteria 1780
816 nmdc:mga0yw44_204872_c1 3300050492 Bacteria 1304
817 nmdc:mga0k408_121012_c1 3300050493 Bacteria 1550
818 nmdc:mga0k408_221074_c1 3300050493 Bacteria 1131
819 nmdc:mga0k408_3840_c1 3300050493 Bacteria 7966
820 nmdc:mga0k408_61685_c1 3300050493 Bacteria 2180
821 nmdc:mga06z11_20_c1 3300050494 Bacteria 75712
822 nmdc:mga06z11_770_c1 3300050494 Bacteria 11686
823 nmdc:mga04h51_108_c1 3300050495 Bacteria 24818
824 nmdc:mga04h51_339_c1 3300050495 Bacteria 11749
825 nmdc:mga07m45_35_c1 3300050496 Bacteria 74486
826 nmdc:mga0qj67_112215_c1 3300050509 Bacteria 2201
827 nmdc:mga0n895_1306955_c1 3300050512 Bacteria 696
828 nmdc:mga0n895_1625131_c1 3300050512 Bacteria 610
829 nmdc:mga0n895_92167_c1 3300050512 Bacteria 3033
830 nmdc:mga0rr50_316682_c1 3300050513 Bacteria 1307
831 nmdc:mga0sz30_41_c1 3300050516 Bacteria 46173
832 nmdc:mga0sz30_79563_c1 3300050516 Bacteria 1418
833 Ga0495612_0107420 3300053078 Bacteria 1192
834 Ga0495595_0468711 3300053084 Bacteria 641
835 Ga0500643_000195 3300053087 Bacteria 57960
836 Ga0500643_012652 3300053087 Bacteria 3014
837 Ga0500643_024520 3300053087 Bacteria 1914
838 Ga0500643_038746 3300053087 Bacteria 1411
839 Ga0500643_070216 3300053087 Bacteria 972
840 Ga0500555_000645 3300053103 Bacteria 13442
841 Ga0500556_0000054 3300053104 Bacteria 115949
842 Ga0500562_002192 3300053108 Bacteria 4884
843 Ga0500562_007791 3300053108 Bacteria 2702
844 Ga0500592_001661 3300053116 Bacteria 3608
845 Ga0500592_022803 3300053116 Bacteria 1009
846 Ga0500593_065595 3300053117 Bacteria 1587
847 Ga0500595_000379 3300053119 Bacteria 28661
848 Ga0500595_011903 3300053119 Bacteria 3386
849 Ga0500618_152347 3300053125 Bacteria 528
850 Ga0500559_0209779 3300053136 Bacteria 919
851 Ga0500604_0038426 3300053151 Bacteria 1436
852 Ga0500616_0043163 3300053153 Bacteria 2411
853 Ga0500622_0000119 3300053156 Bacteria 82219
854 Ga0500637_0003430 3300053178 Bacteria 7324
855 Ga0501084_0331746 3300054114 Bacteria 1285
856 Ga0501084_0364019 3300054114 Bacteria 1222
857 Ga0501084_1856662 3300054114 Bacteria 503
858 Ga0466962_0410849 3300061719 Bacteria 678

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0889782 Ga0316582_0889782_173_535 118
2 3300036712 Ga0316584_0024034 Ga0316584_0024034_2840_3202 118
3 3300049588 Ga0501072_0679489 Ga0501072_0679489_26_430 130
4 3300013297 Ga0157378_10029855 Ga0157378_100298552 131
5 3300045051 Ga0451576_0264872 Ga0451576_0264872_789_1238 132
6 3300005578 Ga0068854_100010181 Ga0068854_1000101813 133
7 3300003323 rootH1_10189427 rootH1_101894273 135
8 3300049162 Ga0501307_041291 Ga0501307_041291_154_603 135
9 3300049679 Ga0501249_001014 Ga0501249_001014_4479_4928 135
10 3300049850 Ga0501204_009184 Ga0501204_009184_439_888 135
11 3300006914 Ga0075436_100714259 Ga0075436_1007142592 136
12 3300009093 Ga0105240_10066895 Ga0105240_100668951 137
13 3300037418 Ga0395900_0972316 Ga0395900_0972316_173_625 138
14 3300050513 nmdc:mga0rr50_316682_c1 nmdc:mga0rr50_316682_c1_126_578 138
15 3300053116 Ga0500592_022803 Ga0500592_022803_225_695 138
16 3300053117 Ga0500593_065595 Ga0500593_065595_687_1157 138
17 3300013306 Ga0163162_10000077 Ga0163162_10000077132 139
18 3300031730 Ga0307516_10152207 Ga0307516_101522073 139
19 3300041407 Ga0439447_000009 Ga0439447_000009_26339_26770 139
20 3300041411 Ga0439466_0009170 Ga0439466_0009170_1031_1462 139
21 3300042156 Ga0439446_0146374 Ga0439446_0146374_104_535 139
22 3300046615 Ga0495656_0000023 Ga0495656_0000023_31250_31681 139
23 3300048905 Ga0496102_0008608 Ga0496102_0008608_4744_5175 139
24 3300049570 Ga0501033_0389042 Ga0501033_0389042_239_772 139
25 3300049581 Ga0501047_0274117 Ga0501047_0274117_916_1386 139
26 3300049581 Ga0501047_0903470 Ga0501047_0903470_44_592 139
27 3300049822 Ga0501035_0358936 Ga0501035_0358936_109_642 139
28 3300049571 Ga0501034_0057262 Ga0501034_0057262_1278_1730 140
29 3300005844 Ga0068862_100152714 Ga0068862_1001527142 141
30 3300006051 Ga0075364_10658184 Ga0075364_106581842 141
31 3300006177 Ga0075362_10137077 Ga0075362_101370772 141
32 3300028380 Ga0268265_10149817 Ga0268265_101498173 141
33 3300046460 Ga0495638_0123113 Ga0495638_0123113_156_599 141
34 3300046500 Ga0495596_0000008 Ga0495596_0000008_17097_17540 141
35 3300046519 Ga0495632_0060944 Ga0495632_0060944_164_607 141
36 3300046522 Ga0495643_0015079 Ga0495643_0015079_1813_2256 141
37 3300046616 Ga0495668_0358132 Ga0495668_0358132_285_728 141
38 3300046660 Ga0495625_0165371 Ga0495625_0165371_109_552 141
39 3300046692 Ga0495671_0068061 Ga0495671_0068061_1269_1712 141
40 3300047470 Ga0495681_0095122 Ga0495681_0095122_454_897 141
41 3300050493 nmdc:mga0k408_221074_c1 nmdc:mga0k408_221074_c1_530_973 141
42 3300048912 Ga0496109_0178434 Ga0496109_0178434_52_486 142
43 3300048927 Ga0496124_0008334 Ga0496124_0008334_7090_7524 142
44 3300054114 Ga0501084_0331746 Ga0501084_0331746_711_1196 142
45 iso_pu_bacteria 2896429255 2896430600 142
46 3300005334 Ga0068869_100843939 Ga0068869_1008439392 143
47 3300025942 Ga0207689_10153331 Ga0207689_101533312 143
48 3300037312 Ga0395899_0076776 Ga0395899_0076776_1941_2399 143
49 3300037418 Ga0395900_0000209 Ga0395900_0000209_35285_35743 143
50 3300037466 Ga0395898_0004531 Ga0395898_0004531_7976_8434 143
51 3300037471 Ga0395905_0008172 Ga0395905_0008172_6183_6641 143
52 3300038443 Ga0395901_0967425 Ga0395901_0967425_331_789 143
53 3300046539 Ga0495621_0020629 Ga0495621_0020629_264_710 143
54 3300046664 Ga0495659_0000192 Ga0495659_0000192_7776_8222 143
55 3300048919 Ga0496116_0000089 Ga0496116_0000089_76539_77006 143
56 3300048920 Ga0496117_0003608 Ga0496117_0003608_4467_4934 143
57 3300048927 Ga0496124_0122778 Ga0496124_0122778_658_1125 143
58 3300053178 Ga0500637_0003430 Ga0500637_0003430_5469_5924 143
59 3300037068 Ga0373925_0256850 Ga0373925_0256850_789_1247 144
60 3300037418 Ga0395900_0833971 Ga0395900_0833971_103_552 144
61 3300042876 Ga0451577_0003514 Ga0451577_0003514_8077_8526 144
62 3300045051 Ga0451576_0008302 Ga0451576_0008302_403_858 144
63 3300049569 Ga0501032_0406198 Ga0501032_0406198_11_445 144
64 3300049576 Ga0501040_0750192 Ga0501040_0750192_143_616 144
65 3300049590 Ga0501074_0891450 Ga0501074_0891450_11_484 144
66 3300049741 Ga0501079_0197723 Ga0501079_0197723_171_644 144
67 3300054114 Ga0501084_0364019 Ga0501084_0364019_248_721 144
68 iso_pu_bacteria 2830075706 2830078753 144
69 3300001979 JGI24740J21852_10005081 JGI24740J21852_100050815 145
70 3300001989 JGI24739J22299_10000986 JGI24739J22299_100009868 145
71 3300001989 JGI24739J22299_10007198 JGI24739J22299_100071984 145
72 3300001989 JGI24739J22299_10074953 JGI24739J22299_100749532 145
73 3300001990 JGI24737J22298_10000178 JGI24737J22298_100001785 145
74 3300001990 JGI24737J22298_10002030 JGI24737J22298_100020302 145
75 3300002067 JGI24735J21928_10105427 JGI24735J21928_101054271 145
76 3300002070 JGI24750J21931_1070073 JGI24750J21931_10700732 145
77 3300002073 JGI24745J21846_1012602 JGI24745J21846_10126022 145
78 3300002075 JGI24738J21930_10000035 JGI24738J21930_1000003523 145
79 3300002075 JGI24738J21930_10010010 JGI24738J21930_100100103 145
80 3300002076 JGI24749J21850_1000469 JGI24749J21850_10004693 145
81 3300002077 JGI24744J21845_10040748 JGI24744J21845_100407482 145
82 3300002459 JGI24751J29686_10022773 JGI24751J29686_100227732 145
83 3300002459 JGI24751J29686_10110404 JGI24751J29686_101104041 145
84 3300003316 rootH1_10116051 rootH1_101160512 145
85 3300003758 Ga0055532_1015105 Ga0055532_10151051 145
86 3300005293 Ga0065715_10431933 Ga0065715_104319332 145
87 3300005295 Ga0065707_10314600 Ga0065707_103146002 145
88 3300005327 Ga0070658_10000950 Ga0070658_1000095012 145
89 3300005327 Ga0070658_10672602 Ga0070658_106726022 145
90 3300005327 Ga0070658_10879731 Ga0070658_108797312 145
91 3300005327 Ga0070658_10959707 Ga0070658_109597072 145
92 3300005328 Ga0070676_10216327 Ga0070676_102163272 145
93 3300005329 Ga0070683_100001317 Ga0070683_1000013173 145
94 3300005329 Ga0070683_100148591 Ga0070683_1001485912 145
95 3300005329 Ga0070683_100251900 Ga0070683_1002519003 145
96 3300005329 Ga0070683_100540705 Ga0070683_1005407052 145
97 3300005330 Ga0070690_100021166 Ga0070690_1000211662 145
98 3300005330 Ga0070690_100461119 Ga0070690_1004611192 145
99 3300005331 Ga0070670_100027055 Ga0070670_1000270556 145
100 3300005331 Ga0070670_100083372 Ga0070670_1000833722 145
101 3300005331 Ga0070670_100086486 Ga0070670_1000864863 145
102 3300005331 Ga0070670_100139668 Ga0070670_1001396682 145
103 3300005331 Ga0070670_100160167 Ga0070670_1001601672 145
104 3300005331 Ga0070670_100949249 Ga0070670_1009492492 145
105 3300005333 Ga0070677_10012789 Ga0070677_100127892 145
106 3300005334 Ga0068869_100060475 Ga0068869_1000604753 145
107 3300005335 Ga0070666_10002265 Ga0070666_1000226511 145
108 3300005335 Ga0070666_10019253 Ga0070666_100192532 145
109 3300005335 Ga0070666_10027841 Ga0070666_100278413 145
110 3300005335 Ga0070666_10030176 Ga0070666_100301761 145
111 3300005335 Ga0070666_10123373 Ga0070666_101233733 145
112 3300005336 Ga0070680_100294773 Ga0070680_1002947732 145
113 3300005337 Ga0070682_100282228 Ga0070682_1002822282 145
114 3300005339 Ga0070660_100000260 Ga0070660_10000026022 145
115 3300005339 Ga0070660_100037179 Ga0070660_1000371792 145
116 3300005339 Ga0070660_100289081 Ga0070660_1002890812 145
117 3300005339 Ga0070660_100293830 Ga0070660_1002938302 145
118 3300005340 Ga0070689_100136046 Ga0070689_1001360462 145
119 3300005344 Ga0070661_100000246 Ga0070661_10000024630 145
120 3300005344 Ga0070661_100035625 Ga0070661_1000356253 145
121 3300005344 Ga0070661_100181818 Ga0070661_1001818182 145
122 3300005344 Ga0070661_100744837 Ga0070661_1007448372 145
123 3300005345 Ga0070692_10716495 Ga0070692_107164951 145
124 3300005347 Ga0070668_100000028 Ga0070668_10000002872 145
125 3300005347 Ga0070668_100000064 Ga0070668_10000006433 145
126 3300005347 Ga0070668_100000468 Ga0070668_1000004689 145
127 3300005347 Ga0070668_100004618 Ga0070668_1000046182 145
128 3300005347 Ga0070668_100025986 Ga0070668_1000259863 145
129 3300005353 Ga0070669_100001504 Ga0070669_1000015048 145
130 3300005353 Ga0070669_100003371 Ga0070669_1000033715 145
131 3300005353 Ga0070669_100182914 Ga0070669_1001829141 145
132 3300005353 Ga0070669_100501148 Ga0070669_1005011482 145
133 3300005354 Ga0070675_100019838 Ga0070675_1000198382 145
134 3300005354 Ga0070675_100124634 Ga0070675_1001246342 145
135 3300005355 Ga0070671_100000829 Ga0070671_1000008298 145
136 3300005355 Ga0070671_100001575 Ga0070671_1000015756 145
137 3300005355 Ga0070671_100005874 Ga0070671_10000587410 145
138 3300005355 Ga0070671_100040285 Ga0070671_1000402852 145
139 3300005355 Ga0070671_100187231 Ga0070671_1001872312 145
140 3300005355 Ga0070671_100480140 Ga0070671_1004801402 145
141 3300005364 Ga0070673_100004134 Ga0070673_1000041348 145
142 3300005364 Ga0070673_100514552 Ga0070673_1005145522 145
143 3300005366 Ga0070659_100000195 Ga0070659_10000019533 145
144 3300005366 Ga0070659_100095743 Ga0070659_1000957431 145
145 3300005366 Ga0070659_100261312 Ga0070659_1002613122 145
146 3300005366 Ga0070659_100470982 Ga0070659_1004709822 145
147 3300005366 Ga0070659_100531552 Ga0070659_1005315522 145
148 3300005366 Ga0070659_100871826 Ga0070659_1008718262 145
149 3300005366 Ga0070659_101632690 Ga0070659_1016326901 145
150 3300005367 Ga0070667_100000003 Ga0070667_100000003296 145
151 3300005367 Ga0070667_100000016 Ga0070667_100000016116 145
152 3300005367 Ga0070667_100003644 Ga0070667_1000036449 145
153 3300005367 Ga0070667_100004495 Ga0070667_1000044957 145
154 3300005367 Ga0070667_100009905 Ga0070667_1000099055 145
155 3300005367 Ga0070667_100012716 Ga0070667_1000127165 145
156 3300005435 Ga0070714_100746496 Ga0070714_1007464961 145
157 3300005436 Ga0070713_100151733 Ga0070713_1001517332 145
158 3300005455 Ga0070663_100002814 Ga0070663_1000028142 145
159 3300005456 Ga0070678_100607394 Ga0070678_1006073942 145
160 3300005457 Ga0070662_100000047 Ga0070662_10000004733 145
161 3300005457 Ga0070662_100002369 Ga0070662_1000023696 145
162 3300005458 Ga0070681_10455323 Ga0070681_104553232 145
163 3300005459 Ga0068867_100016487 Ga0068867_1000164873 145
164 3300005466 Ga0070685_10168672 Ga0070685_101686722 145
165 3300005468 Ga0070707_100482005 Ga0070707_1004820052 145
166 3300005530 Ga0070679_100138866 Ga0070679_1001388662 145
167 3300005530 Ga0070679_100386071 Ga0070679_1003860712 145
168 3300005530 Ga0070679_101202095 Ga0070679_1012020952 145
169 3300005535 Ga0070684_100042567 Ga0070684_1000425675 145
170 3300005535 Ga0070684_100126214 Ga0070684_1001262142 145
171 3300005535 Ga0070684_100186503 Ga0070684_1001865032 145
172 3300005535 Ga0070684_100611468 Ga0070684_1006114682 145
173 3300005535 Ga0070684_100709370 Ga0070684_1007093702 145
174 3300005535 Ga0070684_101562541 Ga0070684_1015625412 145
175 3300005539 Ga0068853_100000033 Ga0068853_10000003384 145
176 3300005539 Ga0068853_100129978 Ga0068853_1001299783 145
177 3300005539 Ga0068853_100133526 Ga0068853_1001335262 145
178 3300005539 Ga0068853_100209934 Ga0068853_1002099342 145
179 3300005539 Ga0068853_101315307 Ga0068853_1013153071 145
180 3300005539 Ga0068853_101674325 Ga0068853_1016743251 145
181 3300005543 Ga0070672_100089311 Ga0070672_1000893112 145
182 3300005544 Ga0070686_100000235 Ga0070686_10000023540 145
183 3300005544 Ga0070686_100261290 Ga0070686_1002612902 145
184 3300005547 Ga0070693_100010785 Ga0070693_1000107852 145
185 3300005548 Ga0070665_100000038 Ga0070665_10000003889 145
186 3300005548 Ga0070665_100000070 Ga0070665_100000070122 145
187 3300005548 Ga0070665_100002115 Ga0070665_1000021154 145
188 3300005548 Ga0070665_100032833 Ga0070665_1000328336 145
189 3300005563 Ga0068855_100000531 Ga0068855_10000053133 145
190 3300005563 Ga0068855_100001755 Ga0068855_1000017552 145
191 3300005563 Ga0068855_100079313 Ga0068855_1000793132 145
192 3300005563 Ga0068855_100781375 Ga0068855_1007813752 145
193 3300005563 Ga0068855_101505804 Ga0068855_1015058042 145
194 3300005564 Ga0070664_100000242 Ga0070664_10000024238 145
195 3300005564 Ga0070664_100041826 Ga0070664_1000418262 145
196 3300005564 Ga0070664_100149870 Ga0070664_1001498702 145
197 3300005577 Ga0068857_100001908 Ga0068857_1000019086 145
198 3300005577 Ga0068857_100053309 Ga0068857_1000533096 145
199 3300005577 Ga0068857_100123472 Ga0068857_1001234722 145
200 3300005577 Ga0068857_100124422 Ga0068857_1001244222 145
201 3300005577 Ga0068857_100209124 Ga0068857_1002091243 145
202 3300005578 Ga0068854_100006502 Ga0068854_1000065026 145
203 3300005578 Ga0068854_100033722 Ga0068854_1000337225 145
204 3300005578 Ga0068854_100126047 Ga0068854_1001260473 145
205 3300005578 Ga0068854_100698189 Ga0068854_1006981892 145
206 3300005578 Ga0068854_101903278 Ga0068854_1019032781 145
207 3300005614 Ga0068856_100000162 Ga0068856_10000016232 145
208 3300005614 Ga0068856_100920639 Ga0068856_1009206392 145
209 3300005614 Ga0068856_101178185 Ga0068856_1011781852 145
210 3300005615 Ga0070702_100184049 Ga0070702_1001840492 145
211 3300005616 Ga0068852_100000471 Ga0068852_10000047119 145
212 3300005616 Ga0068852_100003956 Ga0068852_1000039569 145
213 3300005616 Ga0068852_100143413 Ga0068852_1001434132 145
214 3300005616 Ga0068852_100280612 Ga0068852_1002806122 145
215 3300005616 Ga0068852_100532334 Ga0068852_1005323342 145
216 3300005616 Ga0068852_100921900 Ga0068852_1009219002 145
217 3300005617 Ga0068859_100045654 Ga0068859_1000456542 145
218 3300005617 Ga0068859_100163402 Ga0068859_1001634022 145
219 3300005617 Ga0068859_100216750 Ga0068859_1002167503 145
220 3300005617 Ga0068859_100228159 Ga0068859_1002281593 145
221 3300005617 Ga0068859_100270285 Ga0068859_1002702852 145
222 3300005617 Ga0068859_100471064 Ga0068859_1004710642 145
223 3300005617 Ga0068859_100521586 Ga0068859_1005215862 145
224 3300005617 Ga0068859_101543891 Ga0068859_1015438912 145
225 3300005617 Ga0068859_101549848 Ga0068859_1015498482 145
226 3300005617 Ga0068859_101842040 Ga0068859_1018420401 145
227 3300005617 Ga0068859_102528791 Ga0068859_1025287911 145
228 3300005618 Ga0068864_100015986 Ga0068864_1000159865 145
229 3300005618 Ga0068864_100032381 Ga0068864_1000323813 145
230 3300005618 Ga0068864_100056815 Ga0068864_1000568152 145
231 3300005719 Ga0068861_100029338 Ga0068861_1000293382 145
232 3300005719 Ga0068861_100116342 Ga0068861_1001163423 145
233 3300005834 Ga0068851_10031330 Ga0068851_100313302 145
234 3300005834 Ga0068851_10415195 Ga0068851_104151952 145
235 3300005841 Ga0068863_100000052 Ga0068863_10000005267 145
236 3300005841 Ga0068863_100000092 Ga0068863_10000009240 145
237 3300005841 Ga0068863_100000727 Ga0068863_10000072729 145
238 3300005841 Ga0068863_100002981 Ga0068863_1000029816 145
239 3300005841 Ga0068863_100062680 Ga0068863_1000626803 145
240 3300005841 Ga0068863_100066588 Ga0068863_1000665882 145
241 3300005841 Ga0068863_100100169 Ga0068863_1001001693 145
242 3300005841 Ga0068863_100177476 Ga0068863_1001774762 145
243 3300005842 Ga0068858_100000892 Ga0068858_10000089216 145
244 3300005842 Ga0068858_100009735 Ga0068858_1000097353 145
245 3300005842 Ga0068858_100015627 Ga0068858_1000156271 145
246 3300005842 Ga0068858_100133549 Ga0068858_1001335492 145
247 3300005842 Ga0068858_100415136 Ga0068858_1004151362 145
248 3300005843 Ga0068860_100000007 Ga0068860_100000007350 145
249 3300005843 Ga0068860_100000045 Ga0068860_10000004565 145
250 3300005843 Ga0068860_100000196 Ga0068860_10000019657 145
251 3300005843 Ga0068860_100006131 Ga0068860_1000061315 145
252 3300005843 Ga0068860_100010108 Ga0068860_1000101082 145
253 3300005843 Ga0068860_100076639 Ga0068860_1000766393 145
254 3300005843 Ga0068860_100167035 Ga0068860_1001670352 145
255 3300005843 Ga0068860_100595112 Ga0068860_1005951122 145
256 3300005843 Ga0068860_101474580 Ga0068860_1014745801 145
257 3300005844 Ga0068862_100000385 Ga0068862_10000038533 145
258 3300005844 Ga0068862_100000877 Ga0068862_10000087720 145
259 3300005844 Ga0068862_100007339 Ga0068862_1000073394 145
260 3300005844 Ga0068862_100011387 Ga0068862_1000113875 145
261 3300005844 Ga0068862_100039746 Ga0068862_1000397462 145
262 3300005844 Ga0068862_100103090 Ga0068862_1001030903 145
263 3300005844 Ga0068862_100132959 Ga0068862_1001329592 145
264 3300005937 Ga0081455_10061870 Ga0081455_100618702 145
265 3300006042 Ga0075368_10000152 Ga0075368_100001527 145
266 3300006048 Ga0075363_100002645 Ga0075363_1000026453 145
267 3300006048 Ga0075363_100050909 Ga0075363_1000509093 145
268 3300006051 Ga0075364_10087542 Ga0075364_100875423 145
269 3300006177 Ga0075362_10042057 Ga0075362_100420573 145
270 3300006178 Ga0075367_10000134 Ga0075367_1000013423 145
271 3300006178 Ga0075367_10075854 Ga0075367_100758541 145
272 3300006186 Ga0075369_10003510 Ga0075369_100035103 145
273 3300006195 Ga0075366_10071053 Ga0075366_100710533 145
274 3300006195 Ga0075366_10130440 Ga0075366_101304402 145
275 3300006195 Ga0075366_10262904 Ga0075366_102629042 145
276 3300006195 Ga0075366_10303107 Ga0075366_103031072 145
277 3300006237 Ga0097621_100039279 Ga0097621_1000392792 145
278 3300006237 Ga0097621_100171752 Ga0097621_1001717523 145
279 3300006237 Ga0097621_100934274 Ga0097621_1009342742 145
280 3300006353 Ga0075370_10057671 Ga0075370_100576714 145
281 3300006353 Ga0075370_10203751 Ga0075370_102037512 145
282 3300006353 Ga0075370_10622442 Ga0075370_106224421 145
283 3300006358 Ga0068871_100108292 Ga0068871_1001082924 145
284 3300006358 Ga0068871_100145109 Ga0068871_1001451092 145
285 3300006846 Ga0075430_100210608 Ga0075430_1002106082 145
286 3300006871 Ga0075434_100100221 Ga0075434_1001002212 145
287 3300006871 Ga0075434_100627907 Ga0075434_1006279072 145
288 3300006871 Ga0075434_102457447 Ga0075434_1024574471 145
289 3300006881 Ga0068865_100087005 Ga0068865_1000870052 145
290 3300006931 Ga0097620_100020395 Ga0097620_1000203952 145
291 3300006931 Ga0097620_100045653 Ga0097620_1000456532 145
292 3300006931 Ga0097620_100163398 Ga0097620_1001633982 145
293 3300006931 Ga0097620_100216746 Ga0097620_1002167462 145
294 3300006931 Ga0097620_100228162 Ga0097620_1002281622 145
295 3300006931 Ga0097620_100270299 Ga0097620_1002702992 145
296 3300006931 Ga0097620_100471065 Ga0097620_1004710652 145
297 3300006931 Ga0097620_100521583 Ga0097620_1005215832 145
298 3300006931 Ga0097620_101543352 Ga0097620_1015433522 145
299 3300006931 Ga0097620_101549883 Ga0097620_1015498831 145
300 3300006931 Ga0097620_101842897 Ga0097620_1018428971 145
301 3300006931 Ga0097620_102530419 Ga0097620_1025304191 145
302 3300009011 Ga0105251_10005582 Ga0105251_100055828 145
303 3300009093 Ga0105240_10087616 Ga0105240_100876163 145
304 3300009093 Ga0105240_10150868 Ga0105240_101508683 145
305 3300009093 Ga0105240_10684580 Ga0105240_106845802 145
306 3300009098 Ga0105245_10000285 Ga0105245_1000028517 145
307 3300009098 Ga0105245_10169598 Ga0105245_101695982 145
308 3300009101 Ga0105247_10051194 Ga0105247_100511942 145
309 3300009101 Ga0105247_10160341 Ga0105247_101603412 145
310 3300009101 Ga0105247_10238002 Ga0105247_102380022 145
311 3300009148 Ga0105243_10038024 Ga0105243_100380242 145
312 3300009174 Ga0105241_10245403 Ga0105241_102454032 145
313 3300009174 Ga0105241_12231835 Ga0105241_122318351 145
314 3300009177 Ga0105248_10000659 Ga0105248_100006598 145
315 3300009177 Ga0105248_10011429 Ga0105248_100114292 145
316 3300009177 Ga0105248_10161443 Ga0105248_101614434 145
317 3300009177 Ga0105248_10225459 Ga0105248_102254593 145
318 3300009177 Ga0105248_11980827 Ga0105248_119808272 145
319 3300009177 Ga0105248_13001525 Ga0105248_130015251 145
320 3300009545 Ga0105237_10710107 Ga0105237_107101072 145
321 3300009551 Ga0105238_10008171 Ga0105238_100081712 145
322 3300009551 Ga0105238_10038975 Ga0105238_100389753 145
323 3300009551 Ga0105238_10253224 Ga0105238_102532242 145
324 3300009551 Ga0105238_10672731 Ga0105238_106727312 145
325 3300009551 Ga0105238_12135921 Ga0105238_121359212 145
326 3300009553 Ga0105249_10000574 Ga0105249_1000057422 145
327 3300009553 Ga0105249_10056713 Ga0105249_100567134 145
328 3300009553 Ga0105249_10088658 Ga0105249_100886582 145
329 3300009553 Ga0105249_10854049 Ga0105249_108540492 145
330 3300010375 Ga0105239_10011926 Ga0105239_100119261 145
331 3300010375 Ga0105239_10130902 Ga0105239_101309022 145
332 3300010375 Ga0105239_10580364 Ga0105239_105803641 145
333 3300010375 Ga0105239_11365987 Ga0105239_113659872 145
334 3300011119 Ga0105246_10184144 Ga0105246_101841442 145
335 3300013100 Ga0157373_10022263 Ga0157373_100222634 145
336 3300013100 Ga0157373_10050159 Ga0157373_100501594 145
337 3300013100 Ga0157373_10068400 Ga0157373_100684004 145
338 3300013100 Ga0157373_10155580 Ga0157373_101555802 145
339 3300013100 Ga0157373_10299862 Ga0157373_102998622 145
340 3300013100 Ga0157373_10723507 Ga0157373_107235072 145
341 3300013100 Ga0157373_10918408 Ga0157373_109184082 145
342 3300013102 Ga0157371_10014963 Ga0157371_100149632 145
343 3300013102 Ga0157371_10079335 Ga0157371_100793354 145
344 3300013102 Ga0157371_10091128 Ga0157371_100911282 145
345 3300013102 Ga0157371_10180439 Ga0157371_101804392 145
346 3300013102 Ga0157371_10313661 Ga0157371_103136612 145
347 3300013102 Ga0157371_10356052 Ga0157371_103560522 145
348 3300013104 Ga0157370_10036970 Ga0157370_100369702 145
349 3300013104 Ga0157370_10334480 Ga0157370_103344802 145
350 3300013104 Ga0157370_10384626 Ga0157370_103846262 145
351 3300013105 Ga0157369_10017738 Ga0157369_100177382 145
352 3300013105 Ga0157369_10022100 Ga0157369_100221002 145
353 3300013105 Ga0157369_10101220 Ga0157369_101012202 145
354 3300013105 Ga0157369_10126550 Ga0157369_101265504 145
355 3300013105 Ga0157369_10419918 Ga0157369_104199181 145
356 3300013105 Ga0157369_10427958 Ga0157369_104279582 145
357 3300013105 Ga0157369_10996038 Ga0157369_109960382 145
358 3300013296 Ga0157374_10922535 Ga0157374_109225352 145
359 3300013297 Ga0157378_10028389 Ga0157378_100283895 145
360 3300013306 Ga0163162_10020508 Ga0163162_100205082 145
361 3300013306 Ga0163162_10392518 Ga0163162_103925182 145
362 3300013307 Ga0157372_10005572 Ga0157372_100055727 145
363 3300013307 Ga0157372_10047838 Ga0157372_100478382 145
364 3300013307 Ga0157372_10354969 Ga0157372_103549692 145
365 3300013307 Ga0157372_10361528 Ga0157372_103615282 145
366 3300013307 Ga0157372_10472375 Ga0157372_104723752 145
367 3300013308 Ga0157375_11138896 Ga0157375_111388962 145
368 3300013308 Ga0157375_11821260 Ga0157375_118212602 145
369 3300014325 Ga0163163_10000273 Ga0163163_1000027340 145
370 3300014326 Ga0157380_10003514 Ga0157380_100035148 145
371 3300014326 Ga0157380_10726996 Ga0157380_107269961 145
372 3300014745 Ga0157377_10597970 Ga0157377_105979702 145
373 3300014968 Ga0157379_10099121 Ga0157379_100991212 145
374 3300014969 Ga0157376_12087936 Ga0157376_120879361 145
375 3300020070 Ga0206356_10192360 Ga0206356_101923603 145
376 3300020081 Ga0206354_10727992 Ga0206354_107279923 145
377 3300020082 Ga0206353_11090631 Ga0206353_110906315 145
378 3300021358 Ga0213873_10000009 Ga0213873_10000009157 145
379 3300021384 Ga0213876_10000004 Ga0213876_10000004160 145
380 3300021384 Ga0213876_10008570 Ga0213876_100085702 145
381 3300025229 Ga0209147_100921 Ga0209147_10092110 145
382 3300025315 Ga0207697_10000881 Ga0207697_100008816 145
383 3300025315 Ga0207697_10083317 Ga0207697_100833171 145
384 3300025321 Ga0207656_10004743 Ga0207656_100047432 145
385 3300025321 Ga0207656_10560469 Ga0207656_105604692 145
386 3300025735 Ga0207713_1002734 Ga0207713_10027342 145
387 3300025900 Ga0207710_10138298 Ga0207710_101382982 145
388 3300025901 Ga0207688_10000317 Ga0207688_1000031717 145
389 3300025903 Ga0207680_10001920 Ga0207680_100019202 145
390 3300025903 Ga0207680_10018954 Ga0207680_100189544 145
391 3300025903 Ga0207680_10026804 Ga0207680_100268042 145
392 3300025903 Ga0207680_10140136 Ga0207680_101401362 145
393 3300025903 Ga0207680_10140625 Ga0207680_101406252 145
394 3300025904 Ga0207647_10000253 Ga0207647_1000025337 145
395 3300025904 Ga0207647_10006748 Ga0207647_100067486 145
396 3300025904 Ga0207647_10050706 Ga0207647_100507062 145
397 3300025904 Ga0207647_10076958 Ga0207647_100769582 145
398 3300025904 Ga0207647_10153480 Ga0207647_101534802 145
399 3300025909 Ga0207705_10000062 Ga0207705_10000062129 145
400 3300025909 Ga0207705_10034240 Ga0207705_100342402 145
401 3300025909 Ga0207705_10050994 Ga0207705_100509942 145
402 3300025911 Ga0207654_10092434 Ga0207654_100924342 145
403 3300025911 Ga0207654_10199835 Ga0207654_101998352 145
404 3300025911 Ga0207654_10298773 Ga0207654_102987732 145
405 3300025912 Ga0207707_10096206 Ga0207707_100962064 145
406 3300025912 Ga0207707_10450058 Ga0207707_104500582 145
407 3300025912 Ga0207707_10901100 Ga0207707_109011001 145
408 3300025913 Ga0207695_10013403 Ga0207695_100134032 145
409 3300025913 Ga0207695_10271142 Ga0207695_102711423 145
410 3300025913 Ga0207695_10614868 Ga0207695_106148682 145
411 3300025917 Ga0207660_10041658 Ga0207660_100416582 145
412 3300025917 Ga0207660_11032129 Ga0207660_110321292 145
413 3300025919 Ga0207657_10000403 Ga0207657_1000040317 145
414 3300025919 Ga0207657_10000946 Ga0207657_1000094634 145
415 3300025919 Ga0207657_10005971 Ga0207657_100059713 145
416 3300025919 Ga0207657_10013271 Ga0207657_100132712 145
417 3300025919 Ga0207657_10119775 Ga0207657_101197754 145
418 3300025919 Ga0207657_10139818 Ga0207657_101398182 145
419 3300025919 Ga0207657_10201408 Ga0207657_102014082 145
420 3300025919 Ga0207657_10430477 Ga0207657_104304771 145
421 3300025920 Ga0207649_10000230 Ga0207649_1000023031 145
422 3300025920 Ga0207649_10057862 Ga0207649_100578622 145
423 3300025920 Ga0207649_10154061 Ga0207649_101540612 145
424 3300025920 Ga0207649_10391836 Ga0207649_103918362 145
425 3300025920 Ga0207649_10812423 Ga0207649_108124232 145
426 3300025921 Ga0207652_10628159 Ga0207652_106281592 145
427 3300025923 Ga0207681_10003582 Ga0207681_100035827 145
428 3300025923 Ga0207681_10003999 Ga0207681_100039993 145
429 3300025923 Ga0207681_10135485 Ga0207681_101354853 145
430 3300025923 Ga0207681_10190801 Ga0207681_101908012 145
431 3300025924 Ga0207694_10001776 Ga0207694_100017765 145
432 3300025924 Ga0207694_10004075 Ga0207694_100040753 145
433 3300025924 Ga0207694_10474597 Ga0207694_104745972 145
434 3300025925 Ga0207650_10020484 Ga0207650_100204843 145
435 3300025925 Ga0207650_10062456 Ga0207650_100624562 145
436 3300025925 Ga0207650_10081795 Ga0207650_100817954 145
437 3300025926 Ga0207659_10035708 Ga0207659_100357084 145
438 3300025926 Ga0207659_10265706 Ga0207659_102657062 145
439 3300025927 Ga0207687_10007641 Ga0207687_100076416 145
440 3300025929 Ga0207664_11031449 Ga0207664_110314492 145
441 3300025931 Ga0207644_10000125 Ga0207644_1000012559 145
442 3300025931 Ga0207644_10000569 Ga0207644_1000056921 145
443 3300025931 Ga0207644_10020991 Ga0207644_100209912 145
444 3300025931 Ga0207644_10032656 Ga0207644_100326562 145
445 3300025931 Ga0207644_10035130 Ga0207644_100351303 145
446 3300025931 Ga0207644_10292079 Ga0207644_102920792 145
447 3300025931 Ga0207644_10430088 Ga0207644_104300882 145
448 3300025932 Ga0207690_10000155 Ga0207690_1000015544 145
449 3300025932 Ga0207690_10080730 Ga0207690_100807302 145
450 3300025932 Ga0207690_10084474 Ga0207690_100844742 145
451 3300025932 Ga0207690_10781949 Ga0207690_107819492 145
452 3300025933 Ga0207706_10000342 Ga0207706_1000034221 145
453 3300025933 Ga0207706_10000643 Ga0207706_1000064313 145
454 3300025936 Ga0207670_10113087 Ga0207670_101130872 145
455 3300025938 Ga0207704_10029226 Ga0207704_100292262 145
456 3300025940 Ga0207691_10000848 Ga0207691_1000084822 145
457 3300025940 Ga0207691_10108497 Ga0207691_101084972 145
458 3300025941 Ga0207711_10006705 Ga0207711_1000670510 145
459 3300025941 Ga0207711_10014364 Ga0207711_100143643 145
460 3300025941 Ga0207711_10016073 Ga0207711_100160734 145
461 3300025941 Ga0207711_10292234 Ga0207711_102922342 145
462 3300025942 Ga0207689_10000017 Ga0207689_1000001719 145
463 3300025944 Ga0207661_10000947 Ga0207661_100009477 145
464 3300025944 Ga0207661_10012302 Ga0207661_100123022 145
465 3300025944 Ga0207661_10436692 Ga0207661_104366922 145
466 3300025945 Ga0207679_10000213 Ga0207679_1000021318 145
467 3300025945 Ga0207679_10049081 Ga0207679_100490812 145
468 3300025949 Ga0207667_10001300 Ga0207667_1000130017 145
469 3300025949 Ga0207667_10001543 Ga0207667_1000154321 145
470 3300025949 Ga0207667_10180783 Ga0207667_101807832 145
471 3300025949 Ga0207667_10485200 Ga0207667_104852001 145
472 3300025949 Ga0207667_11151997 Ga0207667_111519971 145
473 3300025960 Ga0207651_10002101 Ga0207651_100021016 145
474 3300025961 Ga0207712_10000476 Ga0207712_1000047615 145
475 3300025961 Ga0207712_10057347 Ga0207712_100573473 145
476 3300025961 Ga0207712_10159561 Ga0207712_101595612 145
477 3300025961 Ga0207712_10314157 Ga0207712_103141572 145
478 3300025972 Ga0207668_10000030 Ga0207668_1000003085 145
479 3300025972 Ga0207668_10000076 Ga0207668_1000007644 145
480 3300025972 Ga0207668_10001049 Ga0207668_1000104918 145
481 3300025972 Ga0207668_10003547 Ga0207668_100035479 145
482 3300025972 Ga0207668_10034211 Ga0207668_100342114 145
483 3300025972 Ga0207668_10113134 Ga0207668_101131342 145
484 3300025972 Ga0207668_10158411 Ga0207668_101584112 145
485 3300025981 Ga0207640_10013642 Ga0207640_100136426 145
486 3300025981 Ga0207640_10015320 Ga0207640_100153205 145
487 3300025981 Ga0207640_10068231 Ga0207640_100682314 145
488 3300025981 Ga0207640_10164718 Ga0207640_101647183 145
489 3300025981 Ga0207640_10915216 Ga0207640_109152162 145
490 3300025981 Ga0207640_11775412 Ga0207640_117754121 145
491 3300025986 Ga0207658_10000002 Ga0207658_100000021197 145
492 3300025986 Ga0207658_10000075 Ga0207658_1000007532 145
493 3300025986 Ga0207658_10005000 Ga0207658_100050008 145
494 3300025986 Ga0207658_10005408 Ga0207658_100054087 145
495 3300025986 Ga0207658_10029070 Ga0207658_100290702 145
496 3300025986 Ga0207658_10060416 Ga0207658_100604162 145
497 3300025986 Ga0207658_10075950 Ga0207658_100759502 145
498 3300025986 Ga0207658_10878567 Ga0207658_108785672 145
499 3300026023 Ga0207677_11214999 Ga0207677_112149991 145
500 3300026035 Ga0207703_10000358 Ga0207703_1000035833 145
501 3300026035 Ga0207703_10077833 Ga0207703_100778333 145
502 3300026035 Ga0207703_10108548 Ga0207703_101085483 145
503 3300026035 Ga0207703_10271113 Ga0207703_102711132 145
504 3300026041 Ga0207639_10000199 Ga0207639_1000019920 145
505 3300026041 Ga0207639_10000347 Ga0207639_1000034723 145
506 3300026041 Ga0207639_10094150 Ga0207639_100941504 145
507 3300026041 Ga0207639_10159640 Ga0207639_101596403 145
508 3300026041 Ga0207639_10175880 Ga0207639_101758802 145
509 3300026041 Ga0207639_10384484 Ga0207639_103844842 145
510 3300026041 Ga0207639_10739372 Ga0207639_107393722 145
511 3300026041 Ga0207639_10979968 Ga0207639_109799682 145
512 3300026067 Ga0207678_10137305 Ga0207678_101373052 145
513 3300026067 Ga0207678_10431540 Ga0207678_104315402 145
514 3300026075 Ga0207708_10375209 Ga0207708_103752092 145
515 3300026078 Ga0207702_10000496 Ga0207702_1000049633 145
516 3300026078 Ga0207702_10098715 Ga0207702_100987152 145
517 3300026078 Ga0207702_10355059 Ga0207702_103550592 145
518 3300026078 Ga0207702_10617275 Ga0207702_106172751 145
519 3300026078 Ga0207702_11267867 Ga0207702_112678672 145
520 3300026078 Ga0207702_11297307 Ga0207702_112973072 145
521 3300026088 Ga0207641_10000004 Ga0207641_10000004450 145
522 3300026088 Ga0207641_10000042 Ga0207641_1000004267 145
523 3300026088 Ga0207641_10000720 Ga0207641_100007209 145
524 3300026088 Ga0207641_10000959 Ga0207641_1000095911 145
525 3300026088 Ga0207641_10004191 Ga0207641_100041912 145
526 3300026088 Ga0207641_10043172 Ga0207641_100431724 145
527 3300026088 Ga0207641_10080673 Ga0207641_100806732 145
528 3300026088 Ga0207641_10253550 Ga0207641_102535502 145
529 3300026088 Ga0207641_10572491 Ga0207641_105724911 145
530 3300026088 Ga0207641_10935034 Ga0207641_109350342 145
531 3300026089 Ga0207648_10001216 Ga0207648_1000121618 145
532 3300026095 Ga0207676_10001237 Ga0207676_1000123714 145
533 3300026095 Ga0207676_10019321 Ga0207676_100193214 145
534 3300026095 Ga0207676_10026624 Ga0207676_100266245 145
535 3300026095 Ga0207676_10802081 Ga0207676_108020812 145
536 3300026116 Ga0207674_10000945 Ga0207674_1000094512 145
537 3300026116 Ga0207674_10005054 Ga0207674_100050543 145
538 3300026116 Ga0207674_10006327 Ga0207674_100063277 145
539 3300026116 Ga0207674_10013895 Ga0207674_1001389511 145
540 3300026116 Ga0207674_10099138 Ga0207674_100991382 145
541 3300026116 Ga0207674_10171056 Ga0207674_101710561 145
542 3300026116 Ga0207674_10193815 Ga0207674_101938153 145
543 3300026116 Ga0207674_10268205 Ga0207674_102682053 145
544 3300026118 Ga0207675_100046539 Ga0207675_1000465394 145
545 3300026118 Ga0207675_100056638 Ga0207675_1000566382 145
546 3300026142 Ga0207698_10000427 Ga0207698_1000042719 145
547 3300026142 Ga0207698_10015214 Ga0207698_100152144 145
548 3300026142 Ga0207698_10334046 Ga0207698_103340462 145
549 3300026142 Ga0207698_10673859 Ga0207698_106738592 145
550 3300026142 Ga0207698_10720843 Ga0207698_107208432 145
551 3300027866 Ga0209813_10000017 Ga0209813_1000001719 145
552 3300027866 Ga0209813_10000082 Ga0209813_100000824 145
553 3300027876 Ga0209974_10034832 Ga0209974_100348321 145
554 3300028379 Ga0268266_10000118 Ga0268266_10000118156 145
555 3300028379 Ga0268266_10000309 Ga0268266_1000030968 145
556 3300028379 Ga0268266_10002431 Ga0268266_100024318 145
557 3300028379 Ga0268266_10005364 Ga0268266_1000536412 145
558 3300028379 Ga0268266_10122751 Ga0268266_101227512 145
559 3300028380 Ga0268265_10000424 Ga0268265_1000042438 145
560 3300028380 Ga0268265_10000469 Ga0268265_1000046920 145
561 3300028380 Ga0268265_10028122 Ga0268265_100281222 145
562 3300028380 Ga0268265_10084403 Ga0268265_100844033 145
563 3300028380 Ga0268265_10108110 Ga0268265_101081103 145
564 3300028380 Ga0268265_10219792 Ga0268265_102197922 145
565 3300028380 Ga0268265_10501821 Ga0268265_105018212 145
566 3300028380 Ga0268265_10937659 Ga0268265_109376591 145
567 3300028381 Ga0268264_10000087 Ga0268264_10000087117 145
568 3300028381 Ga0268264_10000091 Ga0268264_10000091225 145
569 3300028381 Ga0268264_10000101 Ga0268264_1000010167 145
570 3300028381 Ga0268264_10000134 Ga0268264_1000013465 145
571 3300028381 Ga0268264_10011832 Ga0268264_100118324 145
572 3300028381 Ga0268264_10053504 Ga0268264_100535042 145
573 3300028381 Ga0268264_10153593 Ga0268264_101535933 145
574 3300028786 Ga0307517_10187486 Ga0307517_101874862 145
575 3300028800 Ga0265338_10199094 Ga0265338_101990942 145
576 3300031250 Ga0265331_10059525 Ga0265331_100595252 145
577 3300031251 Ga0265327_10047419 Ga0265327_100474194 145
578 3300031456 Ga0307513_10109817 Ga0307513_101098172 145
579 3300031548 Ga0307408_100010852 Ga0307408_1000108527 145
580 3300031548 Ga0307408_100105234 Ga0307408_1001052342 145
581 3300031548 Ga0307408_100492285 Ga0307408_1004922852 145
582 3300031548 Ga0307408_100916674 Ga0307408_1009166742 145
583 3300031548 Ga0307408_101114027 Ga0307408_1011140272 145
584 3300031595 Ga0265313_10255408 Ga0265313_102554081 145
585 3300031665 Ga0316575_10001316 Ga0316575_1000131610 145
586 3300031665 Ga0316575_10439230 Ga0316575_104392302 145
587 3300031711 Ga0265314_10015740 Ga0265314_100157405 145
588 3300031731 Ga0307405_10029770 Ga0307405_100297702 145
589 3300031731 Ga0307405_10145134 Ga0307405_101451342 145
590 3300031731 Ga0307405_11099492 Ga0307405_110994922 145
591 3300031824 Ga0307413_10105216 Ga0307413_101052163 145
592 3300031824 Ga0307413_10818549 Ga0307413_108185492 145
593 3300031824 Ga0307413_10985474 Ga0307413_109854742 145
594 3300031852 Ga0307410_10014693 Ga0307410_100146932 145
595 3300031901 Ga0307406_10118407 Ga0307406_101184072 145
596 3300031901 Ga0307406_10431377 Ga0307406_104313772 145
597 3300031901 Ga0307406_10728889 Ga0307406_107288891 145
598 3300031901 Ga0307406_11020277 Ga0307406_110202772 145
599 3300031903 Ga0307407_10286441 Ga0307407_102864412 145
600 3300031903 Ga0307407_10822272 Ga0307407_108222721 145
601 3300031911 Ga0307412_10160407 Ga0307412_101604072 145
602 3300031911 Ga0307412_10245213 Ga0307412_102452132 145
603 3300031911 Ga0307412_10471254 Ga0307412_104712542 145
604 3300031911 Ga0307412_11388979 Ga0307412_113889791 145
605 3300031995 Ga0307409_100018325 Ga0307409_1000183253 145
606 3300031995 Ga0307409_100065368 Ga0307409_1000653683 145
607 3300031995 Ga0307409_100600216 Ga0307409_1006002161 145
608 3300031995 Ga0307409_101338017 Ga0307409_1013380172 145
609 3300032002 Ga0307416_100016385 Ga0307416_1000163852 145
610 3300032002 Ga0307416_100061652 Ga0307416_1000616524 145
611 3300032002 Ga0307416_100824235 Ga0307416_1008242352 145
612 3300032004 Ga0307414_10005500 Ga0307414_100055003 145
613 3300032004 Ga0307414_10084360 Ga0307414_100843603 145
614 3300032004 Ga0307414_10370744 Ga0307414_103707442 145
615 3300032004 Ga0307414_10393213 Ga0307414_103932132 145
616 3300032004 Ga0307414_10475099 Ga0307414_104750992 145
617 3300032004 Ga0307414_11192195 Ga0307414_111921952 145
618 3300032005 Ga0307411_10010117 Ga0307411_100101173 145
619 3300032005 Ga0307411_10434007 Ga0307411_104340072 145
620 3300032126 Ga0307415_100418905 Ga0307415_1004189051 145
621 3300032133 Ga0316583_10012845 Ga0316583_100128453 145
622 3300034820 Ga0373959_0015955 Ga0373959_0015955_753_1190 145
623 3300034957 Ga0373938_0064894 Ga0373938_0064894_295_732 145
624 3300035086 Ga0373934_0303686 Ga0373934_0303686_169_639 145
625 3300035111 Ga0373923_0004387 Ga0373923_0004387_3210_3647 145
626 3300035111 Ga0373923_0106023 Ga0373923_0106023_54_500 145
627 3300035119 Ga0373956_0010017 Ga0373956_0010017_1651_2088 145
628 3300035120 Ga0373957_0017656 Ga0373957_0017656_958_1395 145
629 3300035121 Ga0373960_0015422 Ga0373960_0015422_1230_1667 145
630 3300035172 Ga0373955_0002366 Ga0373955_0002366_551_988 145
631 3300035207 Ga0373942_0048300 Ga0373942_0048300_710_1147 145
632 3300035242 Ga0373962_0096931 Ga0373962_0096931_166_603 145
633 3300035691 Ga0373931_0047725 Ga0373931_0047725_207_644 145
634 3300035692 Ga0373935_0547913 Ga0373935_0547913_394_831 145
635 3300035724 Ga0373933_0086952 Ga0373933_0086952_918_1355 145
636 3300036401 Ga0373937_0006632 Ga0373937_0006632_1618_2055 145
637 3300036647 Ga0316582_0224828 Ga0316582_0224828_751_1212 145
638 3300037312 Ga0395899_0037881 Ga0395899_0037881_382_819 145
639 3300037312 Ga0395899_0046407 Ga0395899_0046407_2113_2550 145
640 3300037312 Ga0395899_0076741 Ga0395899_0076741_433_870 145
641 3300037312 Ga0395899_0110916 Ga0395899_0110916_460_897 145
642 3300037312 Ga0395899_0388300 Ga0395899_0388300_445_882 145
643 3300037312 Ga0395899_0396896 Ga0395899_0396896_69_506 145
644 3300037418 Ga0395900_0052961 Ga0395900_0052961_3605_4042 145
645 3300037418 Ga0395900_0084617 Ga0395900_0084617_306_743 145
646 3300037418 Ga0395900_0139753 Ga0395900_0139753_1643_2080 145
647 3300037418 Ga0395900_0167894 Ga0395900_0167894_1663_2100 145
648 3300037418 Ga0395900_0242926 Ga0395900_0242926_650_1087 145
649 3300037418 Ga0395900_0348972 Ga0395900_0348972_145_582 145
650 3300037418 Ga0395900_0367241 Ga0395900_0367241_345_782 145
651 3300037418 Ga0395900_0727841 Ga0395900_0727841_128_565 145
652 3300037466 Ga0395898_0038647 Ga0395898_0038647_171_608 145
653 3300037466 Ga0395898_0230714 Ga0395898_0230714_179_616 145
654 3300037466 Ga0395898_0244719 Ga0395898_0244719_578_1015 145
655 3300037466 Ga0395898_0369396 Ga0395898_0369396_341_778 145
656 3300037466 Ga0395898_0591404 Ga0395898_0591404_67_504 145
657 3300037466 Ga0395898_1363132 Ga0395898_1363132_42_479 145
658 3300037471 Ga0395905_0025304 Ga0395905_0025304_2993_3430 145
659 3300037471 Ga0395905_0050182 Ga0395905_0050182_2429_2866 145
660 3300037471 Ga0395905_0096517 Ga0395905_0096517_2114_2551 145
661 3300037471 Ga0395905_0103309 Ga0395905_0103309_119_556 145
662 3300037471 Ga0395905_0208157 Ga0395905_0208157_1165_1602 145
663 3300037471 Ga0395905_0306413 Ga0395905_0306413_857_1294 145
664 3300037471 Ga0395905_0439178 Ga0395905_0439178_693_1130 145
665 3300037471 Ga0395905_0864200 Ga0395905_0864200_345_782 145
666 3300037471 Ga0395905_1373346 Ga0395905_1373346_142_579 145
667 3300037471 Ga0395905_1492281 Ga0395905_1492281_73_510 145
668 3300037471 Ga0395905_1747883 Ga0395905_1747883_13_450 145
669 3300037853 Ga0436364_0619037 Ga0436364_0619037_433_882 145
670 3300038443 Ga0395901_0008144 Ga0395901_0008144_8555_8992 145
671 3300038443 Ga0395901_0134144 Ga0395901_0134144_442_879 145
672 3300038443 Ga0395901_0282727 Ga0395901_0282727_578_1015 145
673 3300038443 Ga0395901_0288212 Ga0395901_0288212_453_890 145
674 3300038443 Ga0395901_0330994 Ga0395901_0330994_695_1132 145
675 3300038443 Ga0395901_0511359 Ga0395901_0511359_261_698 145
676 3300038443 Ga0395901_0611927 Ga0395901_0611927_146_595 145
677 3300038443 Ga0395901_1103085 Ga0395901_1103085_259_708 145
678 3300039437 Ga0436365_0192103 Ga0436365_0192103_10327_10794 145
679 3300039437 Ga0436365_0410983 Ga0436365_0410983_3968_4417 145
680 3300039450 Ga0436363_0930037 Ga0436363_0930037_89_538 145
681 3300039453 Ga0436362_0383697 Ga0436362_0383697_51729_52196 145
682 3300041408 Ga0439453_0005321 Ga0439453_0005321_1005_1457 145
683 3300041451 Ga0451791_1678702 Ga0451791_1678702_142_591 145
684 3300041459 Ga0451800_1418878 Ga0451800_1418878_96_533 145
685 3300041512 Ga0451853_3208052 Ga0451853_3208052_43_513 145
686 3300042435 Ga0439434_0109128 Ga0439434_0109128_62_511 145
687 3300044656 Ga0466969_0108133 Ga0466969_0108133_696_1133 145
688 3300044694 Ga0466963_0085421 Ga0466963_0085421_1033_1470 145
689 3300044842 Ga0466957_0085985 Ga0466957_0085985_648_1085 145
690 3300045049 Ga0466959_0104571 Ga0466959_0104571_589_1026 145
691 3300046452 Ga0495617_074497 Ga0495617_074497_632_1087 145
692 3300046453 Ga0495627_000570 Ga0495627_000570_27435_27890 145
693 3300046453 Ga0495627_001851 Ga0495627_001851_5361_5816 145
694 3300046460 Ga0495638_0165833 Ga0495638_0165833_150_596 145
695 3300046471 Ga0495650_0145666 Ga0495650_0145666_26_472 145
696 3300046471 Ga0495650_0201405 Ga0495650_0201405_85_531 145
697 3300046491 Ga0495584_0005846 Ga0495584_0005846_1903_2358 145
698 3300046506 Ga0495583_0000577 Ga0495583_0000577_37258_37704 145
699 3300046507 Ga0495606_0003324 Ga0495606_0003324_7974_8420 145
700 3300046507 Ga0495606_0139796 Ga0495606_0139796_852_1352 145
701 3300046512 Ga0495610_0000268 Ga0495610_0000268_42464_42919 145
702 3300046513 Ga0495616_0348458 Ga0495616_0348458_28_474 145
703 3300046518 Ga0495631_0106470 Ga0495631_0106470_15_470 145
704 3300046519 Ga0495632_0000075 Ga0495632_0000075_48000_48455 145
705 3300046520 Ga0495637_0000123 Ga0495637_0000123_53583_54038 145
706 3300046520 Ga0495637_0000890 Ga0495637_0000890_16099_16554 145
707 3300046522 Ga0495643_0000009 Ga0495643_0000009_266087_266542 145
708 3300046524 Ga0495648_0002760 Ga0495648_0002760_11582_12037 145
709 3300046525 Ga0495663_0000003 Ga0495663_0000003_94684_95139 145
710 3300046528 Ga0495642_0073523 Ga0495642_0073523_514_957 145
711 3300046530 Ga0495654_0192564 Ga0495654_0192564_317_787 145
712 3300046539 Ga0495621_0009525 Ga0495621_0009525_163_600 145
713 3300046558 Ga0495633_0000173 Ga0495633_0000173_14536_14991 145
714 3300046558 Ga0495633_0000834 Ga0495633_0000834_21383_21838 145
715 3300046648 Ga0495611_0029615 Ga0495611_0029615_990_1508 145
716 3300046660 Ga0495625_0037398 Ga0495625_0037398_251_721 145
717 3300046660 Ga0495625_0680309 Ga0495625_0680309_43_501 145
718 3300046665 Ga0495661_0191590 Ga0495661_0191590_228_683 145
719 3300046679 Ga0495623_0012520 Ga0495623_0012520_2403_2840 145
720 3300046691 Ga0495670_0046480 Ga0495670_0046480_1590_2036 145
721 3300046691 Ga0495670_0072476 Ga0495670_0072476_993_1430 145
722 3300046692 Ga0495671_0000013 Ga0495671_0000013_266087_266542 145
723 3300046692 Ga0495671_0080367 Ga0495671_0080367_207_656 145
724 3300047320 Ga0495672_0109202 Ga0495672_0109202_357_812 145
725 3300047443 Ga0495687_182929 Ga0495687_182929_183_629 145
726 3300047470 Ga0495681_0000059 Ga0495681_0000059_92407_92862 145
727 3300047470 Ga0495681_0001690 Ga0495681_0001690_12912_13367 145
728 3300047472 Ga0495686_0000430 Ga0495686_0000430_5853_6296 145
729 3300047472 Ga0495686_0001136 Ga0495686_0001136_27961_28407 145
730 3300047472 Ga0495686_0001320 Ga0495686_0001320_7498_7941 145
731 3300047472 Ga0495686_0001775 Ga0495686_0001775_51_497 145
732 3300047472 Ga0495686_0026479 Ga0495686_0026479_612_1067 145
733 3300047472 Ga0495686_0167029 Ga0495686_0167029_138_581 145
734 3300048904 Ga0496101_0066545 Ga0496101_0066545_399_836 145
735 3300048905 Ga0496102_0007382 Ga0496102_0007382_3485_3961 145
736 3300048905 Ga0496102_0662149 Ga0496102_0662149_128_565 145
737 3300048906 Ga0496103_0003095 Ga0496103_0003095_1869_2345 145
738 3300048906 Ga0496103_0710718 Ga0496103_0710718_97_579 145
739 3300048907 Ga0496104_0010352 Ga0496104_0010352_3843_4313 145
740 3300048908 Ga0496105_0007301 Ga0496105_0007301_3320_3790 145
741 3300048909 Ga0496106_0726706 Ga0496106_0726706_25_462 145
742 3300048912 Ga0496109_0415352 Ga0496109_0415352_341_778 145
743 3300048913 Ga0496110_0169877 Ga0496110_0169877_674_1111 145
744 3300048913 Ga0496110_0186659 Ga0496110_0186659_77_514 145
745 3300048914 Ga0496111_0616798 Ga0496111_0616798_21_458 145
746 3300048917 Ga0496114_0000131 Ga0496114_0000131_7167_7604 145
747 3300048919 Ga0496116_0020569 Ga0496116_0020569_1361_1837 145
748 3300048920 Ga0496117_0014014 Ga0496117_0014014_6261_6701 145
749 3300048920 Ga0496117_0024513 Ga0496117_0024513_3817_4293 145
750 3300048920 Ga0496117_0052042 Ga0496117_0052042_2252_2722 145
751 3300048920 Ga0496117_0083593 Ga0496117_0083593_1343_1813 145
752 3300048920 Ga0496117_0093819 Ga0496117_0093819_207_653 145
753 3300048921 Ga0496118_0004303 Ga0496118_0004303_6984_7424 145
754 3300048921 Ga0496118_0010761 Ga0496118_0010761_1895_2365 145
755 3300048921 Ga0496118_0023122 Ga0496118_0023122_2205_2681 145
756 3300048921 Ga0496118_0039935 Ga0496118_0039935_1956_2402 145
757 3300048921 Ga0496118_0281397 Ga0496118_0281397_140_610 145
758 3300048922 Ga0496119_0102841 Ga0496119_0102841_587_1057 145
759 3300048922 Ga0496119_0260541 Ga0496119_0260541_50_499 145
760 3300048923 Ga0496120_0058204 Ga0496120_0058204_1037_1507 145
761 3300048923 Ga0496120_0133236 Ga0496120_0133236_413_898 145
762 3300048924 Ga0496121_0000196 Ga0496121_0000196_125363_125833 145
763 3300048924 Ga0496121_0006803 Ga0496121_0006803_10155_10625 145
764 3300048925 Ga0496122_0001736 Ga0496122_0001736_2662_3120 145
765 3300048926 Ga0496123_0000590 Ga0496123_0000590_58537_58995 145
766 3300048926 Ga0496123_0147502 Ga0496123_0147502_64_534 145
767 3300048927 Ga0496124_0032443 Ga0496124_0032443_2983_3423 145
768 3300048927 Ga0496124_0424727 Ga0496124_0424727_31_534 145
769 3300048927 Ga0496124_0546701 Ga0496124_0546701_49_519 145
770 3300048928 Ga0496125_0049512 Ga0496125_0049512_1652_2122 145
771 3300048928 Ga0496125_0403189 Ga0496125_0403189_63_533 145
772 3300048929 Ga0496126_0039078 Ga0496126_0039078_3158_3616 145
773 3300048929 Ga0496126_0319523 Ga0496126_0319523_29_532 145
774 3300049459 Ga0495678_054039 Ga0495678_054039_360_815 145
775 3300049460 Ga0495682_0002949 Ga0495682_0002949_5874_6320 145
776 3300049513 Ga0501290_000159 Ga0501290_000159_5114_5563 145
777 3300049515 Ga0501292_000020 Ga0501292_000020_47542_47991 145
778 3300049517 Ga0501294_000244 Ga0501294_000244_3643_4092 145
779 3300049568 Ga0501031_0197420 Ga0501031_0197420_335_811 145
780 3300049569 Ga0501032_0028908 Ga0501032_0028908_49_498 145
781 3300049571 Ga0501034_0054204 Ga0501034_0054204_2483_2968 145
782 3300049571 Ga0501034_0545075 Ga0501034_0545075_132_581 145
783 3300049573 Ga0501037_0117007 Ga0501037_0117007_1204_1680 145
784 3300049575 Ga0501039_0269984 Ga0501039_0269984_754_1224 145
785 3300049575 Ga0501039_1071627 Ga0501039_1071627_79_555 145
786 3300049577 Ga0501041_0549636 Ga0501041_0549636_205_642 145
787 3300049578 Ga0501042_0270174 Ga0501042_0270174_527_1003 145
788 3300049579 Ga0501043_0079703 Ga0501043_0079703_2114_2563 145
789 3300049580 Ga0501046_0056977 Ga0501046_0056977_1528_1977 145
790 3300049581 Ga0501047_0002116 Ga0501047_0002116_4260_4709 145
791 3300049581 Ga0501047_0911445 Ga0501047_0911445_187_657 145
792 3300049582 Ga0501048_0074973 Ga0501048_0074973_94_543 145
793 3300049583 Ga0501067_0003583 Ga0501067_0003583_4699_5136 145
794 3300049584 Ga0501068_0242824 Ga0501068_0242824_439_876 145
795 3300049653 Ga0501206_000401 Ga0501206_000401_3300_3749 145
796 3300049662 Ga0501222_000648 Ga0501222_000648_4502_4951 145
797 3300049663 Ga0501223_005698 Ga0501223_005698_244_693 145
798 3300049664 Ga0501224_000328 Ga0501224_000328_3547_3996 145
799 3300049669 Ga0501235_011202 Ga0501235_011202_1273_1722 145
800 3300049686 Ga0501257_000031 Ga0501257_000031_18601_19041 145
801 3300049688 Ga0501259_000367 Ga0501259_000367_669_1118 145
802 3300049690 Ga0501261_001824 Ga0501261_001824_1380_1829 145
803 3300049705 Ga0501225_0009052 Ga0501225_0009052_2272_2721 145
804 3300049708 Ga0501245_000196 Ga0501245_000196_603_1052 145
805 3300049741 Ga0501079_0629603 Ga0501079_0629603_96_572 145
806 3300049775 Ga0501279_000022 Ga0501279_000022_47540_47989 145
807 3300049776 Ga0501280_000353 Ga0501280_000353_6387_6836 145
808 3300049776 Ga0501280_003906 Ga0501280_003906_1625_2065 145
809 3300049777 Ga0501281_00259 Ga0501281_00259_3780_4229 145
810 3300049778 Ga0501282_000191 Ga0501282_000191_4419_4868 145
811 3300049822 Ga0501035_0122135 Ga0501035_0122135_1406_1855 145
812 3300049822 Ga0501035_0386940 Ga0501035_0386940_370_810 145
813 3300049823 Ga0501044_0077021 Ga0501044_0077021_2352_2792 145
814 3300049823 Ga0501044_0086482 Ga0501044_0086482_103_552 145
815 3300049824 Ga0501045_0887699 Ga0501045_0887699_36_479 145
816 3300050489 nmdc:mga03683_259403_c1 nmdc:mga03683_259403_c1_100_570 145
817 3300050489 nmdc:mga03683_3517_c1 nmdc:mga03683_3517_c1_4558_5028 145
818 3300050490 nmdc:mga03n38_40422_c1 nmdc:mga03n38_40422_c1_389_844 145
819 3300050490 nmdc:mga03n38_47793_c1 nmdc:mga03n38_47793_c1_790_1260 145
820 3300050490 nmdc:mga03n38_75671_c1 nmdc:mga03n38_75671_c1_463_933 145
821 3300050491 nmdc:mga00v17_51062_c1 nmdc:mga00v17_51062_c1_1409_1879 145
822 3300050491 nmdc:mga00v17_5310_c1 nmdc:mga00v17_5310_c1_637_1107 145
823 3300050491 nmdc:mga00v17_581703_c1 nmdc:mga00v17_581703_c1_157_594 145
824 3300050492 nmdc:mga0yw44_108049_c1 nmdc:mga0yw44_108049_c1_640_1110 145
825 3300050492 nmdc:mga0yw44_204872_c1 nmdc:mga0yw44_204872_c1_45_515 145
826 3300050493 nmdc:mga0k408_121012_c1 nmdc:mga0k408_121012_c1_780_1229 145
827 3300050493 nmdc:mga0k408_3840_c1 nmdc:mga0k408_3840_c1_87_560 145
828 3300050493 nmdc:mga0k408_61685_c1 nmdc:mga0k408_61685_c1_1048_1518 145
829 3300050494 nmdc:mga06z11_20_c1 nmdc:mga06z11_20_c1_57803_58258 145
830 3300050494 nmdc:mga06z11_770_c1 nmdc:mga06z11_770_c1_3871_4341 145
831 3300050495 nmdc:mga04h51_108_c1 nmdc:mga04h51_108_c1_17446_17901 145
832 3300050495 nmdc:mga04h51_339_c1 nmdc:mga04h51_339_c1_1655_2125 145
833 3300050496 nmdc:mga07m45_35_c1 nmdc:mga07m45_35_c1_66379_66849 145
834 3300050509 nmdc:mga0qj67_112215_c1 nmdc:mga0qj67_112215_c1_318_767 145
835 3300050512 nmdc:mga0n895_1306955_c1 nmdc:mga0n895_1306955_c1_100_552 145
836 3300050512 nmdc:mga0n895_1625131_c1 nmdc:mga0n895_1625131_c1_41_490 145
837 3300050512 nmdc:mga0n895_92167_c1 nmdc:mga0n895_92167_c1_240_683 145
838 3300050516 nmdc:mga0sz30_41_c1 nmdc:mga0sz30_41_c1_31064_31534 145
839 3300050516 nmdc:mga0sz30_79563_c1 nmdc:mga0sz30_79563_c1_790_1260 145
840 3300053078 Ga0495612_0107420 Ga0495612_0107420_271_708 145
841 3300053084 Ga0495595_0468711 Ga0495595_0468711_84_548 145
842 3300053087 Ga0500643_000195 Ga0500643_000195_49475_49924 145
843 3300053087 Ga0500643_012652 Ga0500643_012652_1592_2041 145
844 3300053087 Ga0500643_024520 Ga0500643_024520_390_872 145
845 3300053087 Ga0500643_038746 Ga0500643_038746_424_894 145
846 3300053087 Ga0500643_070216 Ga0500643_070216_100_546 145
847 3300053103 Ga0500555_000645 Ga0500555_000645_7162_7608 145
848 3300053104 Ga0500556_0000054 Ga0500556_0000054_3039_3641 145
849 3300053108 Ga0500562_002192 Ga0500562_002192_4136_4597 145
850 3300053108 Ga0500562_007791 Ga0500562_007791_1977_2579 145
851 3300053116 Ga0500592_001661 Ga0500592_001661_768_1250 145
852 3300053119 Ga0500595_000379 Ga0500595_000379_20179_20625 145
853 3300053119 Ga0500595_011903 Ga0500595_011903_2399_2857 145
854 3300053125 Ga0500618_152347 Ga0500618_152347_35_490 145
855 3300053136 Ga0500559_0209779 Ga0500559_0209779_65_523 145
856 3300053151 Ga0500604_0038426 Ga0500604_0038426_225_674 145
857 3300053153 Ga0500616_0043163 Ga0500616_0043163_1844_2290 145
858 3300053156 Ga0500622_0000119 Ga0500622_0000119_51439_51909 145
859 3300054114 Ga0501084_1856662 Ga0501084_1856662_10_486 145
860 3300061719 Ga0466962_0410849 Ga0466962_0410849_89_526 145
861 iso_pu_bacteria 2510917021 2511126458 145
862 iso_pu_bacteria 2512564014 2512645012 145
863 iso_pu_bacteria 2643221541 2643730557 145
864 iso_pu_bacteria 2643221588 2643950756 145
865 iso_pu_bacteria 2643221605 2644037540 145
866 iso_pu_bacteria 2643221606 2644043726 145
867 iso_pu_bacteria 2643221671 2644393885 145
868 iso_pu_bacteria 2808606401 2809064879 145
869 iso_pu_bacteria 2808606404 2809080955 145
870 iso_pu_bacteria 2808606405 2809085211 145
871 iso_pu_bacteria 2842333319 2842335732 145
872 iso_pu_bacteria 2846952575 2846952796 145
873 iso_pu_bacteria 2880518877 2880521944 145
874 iso_pu_bacteria 2919709256 2919709874 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

40

171

0.95

PF22769

DCD

dCTP deaminase-like

48

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9696 1 127
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9656 3 129
5edd-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant 0.9653 3 129
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.9629 1 131
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9609 3 129
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9583 1 131 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9548 1 130 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9477 1 130 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9338 1 132 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9299 1 139 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A1F9ZMA5-F1-model_v4 deleted 0.9905 1 122
AF-A0A349J258-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9861 1 127 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A1Q3IXS7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9835 2 130 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A2S6THV7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9823 1 127 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A357CEZ8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9817 1 130 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Feature Viewer

pLDDT pTM Quality
93.98 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map