F483137
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 842 | 329 | 824 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300025918|Ga0207662_10267858|Ga0207662_102678582 |
| Length | 273 |
| Sequence | MTRYYCHEHPDVLTIETRVVDARPGAVLLEDTPFYPGGGGQLADHGRLSWTSGEVIVSGIDTSDGRVWHVLAEPVELSGVVQASVDPSFRDLMCQLHTDAHILNALVYQQFRGALVTGAQLNDDGTVRVDFDLPDADNDRLRALEPAMNDAIRQDLPVRYAYLPAEECHPESGLLRSRSVAPPPAADGTIRIVEIVGLDRQGCGGTHLPSTGRSRPVRILKIDNKGRHNRRVRFGRAKALTRALDALRRGCAGRRGTAWCSAPRTSSRGCRTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 2 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 3 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 4 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 5 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 6 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 7 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 8 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 9 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 10 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 11 | 2906610324 | |||
| 12 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 13 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 14 | 2922425934 | |||
| 15 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 16 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 111 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 245 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 246 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 268 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 269 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 270 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 327 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 328 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 329 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.86 |
| Metatranscriptomes | 0.24 |
| Isolates | 1.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.72 |
| Nodule | 2.02 |
| Rhizoplane | 0.48 |
| Rhizosphere | 86.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000795 | 3300003187 | Bacteria | 25423 |
| 2 | JGI25151J46595_10058202 | 3300003187 | Bacteria | 1253 |
| 3 | rootH1_10059295 | 3300003316 | Bacteria | 1900 |
| 4 | rootL2_10139955 | 3300003322 | Bacteria | 1924 |
| 5 | rootH1_10131162 | 3300003323 | Bacteria | 1055 |
| 6 | Ga0055524_1020715 | 3300003775 | Bacteria | 2205 |
| 7 | Ga0055543_1019236 | 3300004625 | Bacteria | 1265 |
| 8 | Ga0065165_1000048 | 3300005262 | Bacteria | 196539 |
| 9 | Ga0065704_10081250 | 3300005289 | Bacteria | 3795 |
| 10 | Ga0065715_10118382 | 3300005293 | Bacteria | 2317 |
| 11 | Ga0070658_10001208 | 3300005327 | Bacteria | 22135 |
| 12 | Ga0070676_10001167 | 3300005328 | Bacteria | 13143 |
| 13 | Ga0070690_100046364 | 3300005330 | Bacteria | 2763 |
| 14 | Ga0070670_100006723 | 3300005331 | Bacteria | 9747 |
| 15 | Ga0070677_10055435 | 3300005333 | Bacteria | 1618 |
| 16 | Ga0068869_100003093 | 3300005334 | Bacteria | 10142 |
| 17 | Ga0068869_100059150 | 3300005334 | Bacteria | 2805 |
| 18 | Ga0070680_100000881 | 3300005336 | Bacteria | 21276 |
| 19 | Ga0070680_100024718 | 3300005336 | Bacteria | 4801 |
| 20 | Ga0070680_100076697 | 3300005336 | Bacteria | 2752 |
| 21 | Ga0070680_100240392 | 3300005336 | Bacteria | 1530 |
| 22 | Ga0070682_100001651 | 3300005337 | Bacteria | 12399 |
| 23 | Ga0068868_100157278 | 3300005338 | Bacteria | 1875 |
| 24 | Ga0070660_100001614 | 3300005339 | Bacteria | 15497 |
| 25 | Ga0070660_100025586 | 3300005339 | Bacteria | 4388 |
| 26 | Ga0070689_100089964 | 3300005340 | Bacteria | 2418 |
| 27 | Ga0070691_10010959 | 3300005341 | Bacteria | 4140 |
| 28 | Ga0070691_10016601 | 3300005341 | Bacteria | 3383 |
| 29 | Ga0070691_10206103 | 3300005341 | Bacteria | 1035 |
| 30 | Ga0070661_100001126 | 3300005344 | Bacteria | 18779 |
| 31 | Ga0070661_100372950 | 3300005344 | Bacteria | 1124 |
| 32 | Ga0070692_10000047 | 3300005345 | Bacteria | 22807 |
| 33 | Ga0070692_10165761 | 3300005345 | Bacteria | 1269 |
| 34 | Ga0070669_100004143 | 3300005353 | Bacteria | 10521 |
| 35 | Ga0070675_100151200 | 3300005354 | Bacteria | 1991 |
| 36 | Ga0070671_100352430 | 3300005355 | Bacteria | 1256 |
| 37 | Ga0070673_100375905 | 3300005364 | Bacteria | 1266 |
| 38 | Ga0070703_10001203 | 3300005406 | Bacteria | 7945 |
| 39 | Ga0070714_100138327 | 3300005435 | Bacteria | 2183 |
| 40 | Ga0070713_100047920 | 3300005436 | Bacteria | 3515 |
| 41 | Ga0070701_10258458 | 3300005438 | Bacteria | 1054 |
| 42 | Ga0070705_100000623 | 3300005440 | Bacteria | 20474 |
| 43 | Ga0070705_100220315 | 3300005440 | Bacteria | 1313 |
| 44 | Ga0070705_100359418 | 3300005440 | Bacteria | 1064 |
| 45 | Ga0070700_100018903 | 3300005441 | Bacteria | 3970 |
| 46 | Ga0070694_100000022 | 3300005444 | Bacteria | 71609 |
| 47 | Ga0070694_100000244 | 3300005444 | Bacteria | 28795 |
| 48 | Ga0070694_100006281 | 3300005444 | Bacteria | 7211 |
| 49 | Ga0070694_100027237 | 3300005444 | Bacteria | 3711 |
| 50 | Ga0070694_100046033 | 3300005444 | Bacteria | 2926 |
| 51 | Ga0070694_100228047 | 3300005444 | Bacteria | 1400 |
| 52 | Ga0070694_100248545 | 3300005444 | Bacteria | 1344 |
| 53 | Ga0070708_100002595 | 3300005445 | Bacteria | 13972 |
| 54 | Ga0070708_100025356 | 3300005445 | Bacteria | 5068 |
| 55 | Ga0070708_100036349 | 3300005445 | Bacteria | 4296 |
| 56 | Ga0070708_100083872 | 3300005445 | Bacteria | 2890 |
| 57 | Ga0070708_100101537 | 3300005445 | Bacteria | 2634 |
| 58 | Ga0070708_100188995 | 3300005445 | Bacteria | 1926 |
| 59 | Ga0070708_100224455 | 3300005445 | Bacteria | 1762 |
| 60 | Ga0070708_100288687 | 3300005445 | Bacteria | 1544 |
| 61 | Ga0070708_100608172 | 3300005445 | Bacteria | 1030 |
| 62 | Ga0070663_100008205 | 3300005455 | Bacteria | 6412 |
| 63 | Ga0070662_100051562 | 3300005457 | Bacteria | 2972 |
| 64 | Ga0070662_100096758 | 3300005457 | Bacteria | 2227 |
| 65 | Ga0070662_100505597 | 3300005457 | Bacteria | 1008 |
| 66 | Ga0070681_10004747 | 3300005458 | Bacteria | 13018 |
| 67 | Ga0068867_100072657 | 3300005459 | Bacteria | 2575 |
| 68 | Ga0070706_100003723 | 3300005467 | Bacteria | 14911 |
| 69 | Ga0070706_100034717 | 3300005467 | Bacteria | 4658 |
| 70 | Ga0070706_100050813 | 3300005467 | Bacteria | 3825 |
| 71 | Ga0070706_100054082 | 3300005467 | Bacteria | 3706 |
| 72 | Ga0070706_100384937 | 3300005467 | Bacteria | 1306 |
| 73 | Ga0070706_100594883 | 3300005467 | Bacteria | 1028 |
| 74 | Ga0070707_100018242 | 3300005468 | Bacteria | 6604 |
| 75 | Ga0070707_100075704 | 3300005468 | Bacteria | 3247 |
| 76 | Ga0070707_100213781 | 3300005468 | Bacteria | 1879 |
| 77 | Ga0070707_100337738 | 3300005468 | Bacteria | 1464 |
| 78 | Ga0070707_100472222 | 3300005468 | Bacteria | 1216 |
| 79 | Ga0070707_100490014 | 3300005468 | Bacteria | 1191 |
| 80 | Ga0070698_100003867 | 3300005471 | Bacteria | 16465 |
| 81 | Ga0070698_100029931 | 3300005471 | Bacteria | 5650 |
| 82 | Ga0070698_100066704 | 3300005471 | Bacteria | 3620 |
| 83 | Ga0070698_100152099 | 3300005471 | Bacteria | 2261 |
| 84 | Ga0070698_100162427 | 3300005471 | Bacteria | 2177 |
| 85 | Ga0070699_100002140 | 3300005518 | Bacteria | 17917 |
| 86 | Ga0070699_100007483 | 3300005518 | Bacteria | 9501 |
| 87 | Ga0070699_100019236 | 3300005518 | Bacteria | 5877 |
| 88 | Ga0070699_100022970 | 3300005518 | Bacteria | 5372 |
| 89 | Ga0070699_100031074 | 3300005518 | Bacteria | 4612 |
| 90 | Ga0070699_100119439 | 3300005518 | Bacteria | 2317 |
| 91 | Ga0070679_100005357 | 3300005530 | Bacteria | 11870 |
| 92 | Ga0070684_100083507 | 3300005535 | Bacteria | 2830 |
| 93 | Ga0070684_100100822 | 3300005535 | Bacteria | 2579 |
| 94 | Ga0070697_100000743 | 3300005536 | Bacteria | 24328 |
| 95 | Ga0070697_100008556 | 3300005536 | Bacteria | 7993 |
| 96 | Ga0070697_100022147 | 3300005536 | Bacteria | 5041 |
| 97 | Ga0070697_100045380 | 3300005536 | Bacteria | 3561 |
| 98 | Ga0070697_100152159 | 3300005536 | Bacteria | 1950 |
| 99 | Ga0070697_100225132 | 3300005536 | Bacteria | 1599 |
| 100 | Ga0070697_100246282 | 3300005536 | Bacteria | 1527 |
| 101 | Ga0070697_100269805 | 3300005536 | Bacteria | 1458 |
| 102 | Ga0068853_100001043 | 3300005539 | Bacteria | 19590 |
| 103 | Ga0068853_100003483 | 3300005539 | Bacteria | 12041 |
| 104 | Ga0070672_100099583 | 3300005543 | Bacteria | 2356 |
| 105 | Ga0070695_100000263 | 3300005545 | Bacteria | 26422 |
| 106 | Ga0070695_100000505 | 3300005545 | Bacteria | 20403 |
| 107 | Ga0070695_100000944 | 3300005545 | Bacteria | 15755 |
| 108 | Ga0070695_100010464 | 3300005545 | Bacteria | 5538 |
| 109 | Ga0070695_100215625 | 3300005545 | Bacteria | 1380 |
| 110 | Ga0070696_100094329 | 3300005546 | Bacteria | 2135 |
| 111 | Ga0070696_100181611 | 3300005546 | Bacteria | 1561 |
| 112 | Ga0070696_100355117 | 3300005546 | Bacteria | 1136 |
| 113 | Ga0070693_100008567 | 3300005547 | Bacteria | 5051 |
| 114 | Ga0070665_100023733 | 3300005548 | Bacteria | 6177 |
| 115 | Ga0070665_100301267 | 3300005548 | Bacteria | 1606 |
| 116 | Ga0070704_100004243 | 3300005549 | Bacteria | 8281 |
| 117 | Ga0070704_100048617 | 3300005549 | Bacteria | 2970 |
| 118 | Ga0070704_100051906 | 3300005549 | Bacteria | 2890 |
| 119 | Ga0070704_100105200 | 3300005549 | Bacteria | 2136 |
| 120 | Ga0070704_100147296 | 3300005549 | Bacteria | 1847 |
| 121 | Ga0068855_100000101 | 3300005563 | Bacteria | 105095 |
| 122 | Ga0068855_100007903 | 3300005563 | Bacteria | 12850 |
| 123 | Ga0068855_100060940 | 3300005563 | Bacteria | 4409 |
| 124 | Ga0068855_100797259 | 3300005563 | Bacteria | 1004 |
| 125 | Ga0070664_100021688 | 3300005564 | Bacteria | 5297 |
| 126 | Ga0068857_100015839 | 3300005577 | Bacteria | 6598 |
| 127 | Ga0068857_100118819 | 3300005577 | Bacteria | 2379 |
| 128 | Ga0068857_100187741 | 3300005577 | Bacteria | 1882 |
| 129 | Ga0068857_100222219 | 3300005577 | Bacteria | 1725 |
| 130 | Ga0068857_100439823 | 3300005577 | Bacteria | 1218 |
| 131 | Ga0068854_100000873 | 3300005578 | Bacteria | 18083 |
| 132 | Ga0068856_100029789 | 3300005614 | Bacteria | 5333 |
| 133 | Ga0068856_100996886 | 3300005614 | Unclassified | 856 |
| 134 | Ga0070702_100030196 | 3300005615 | Bacteria | 2953 |
| 135 | Ga0070702_100257136 | 3300005615 | Bacteria | 1187 |
| 136 | Ga0068852_100131186 | 3300005616 | Bacteria | 2308 |
| 137 | Ga0068852_100141361 | 3300005616 | Bacteria | 2228 |
| 138 | Ga0068859_100037661 | 3300005617 | Bacteria | 4854 |
| 139 | Ga0068859_100201618 | 3300005617 | Bacteria | 2074 |
| 140 | Ga0068859_100507030 | 3300005617 | Bacteria | 1302 |
| 141 | Ga0068864_100050707 | 3300005618 | Bacteria | 3573 |
| 142 | Ga0068866_10026817 | 3300005718 | Bacteria | 2726 |
| 143 | Ga0068861_100023552 | 3300005719 | Bacteria | 4442 |
| 144 | Ga0068861_100115035 | 3300005719 | Bacteria | 2161 |
| 145 | Ga0068870_10000613 | 3300005840 | Bacteria | 13564 |
| 146 | Ga0068863_100004816 | 3300005841 | Bacteria | 13294 |
| 147 | Ga0068858_100112957 | 3300005842 | Bacteria | 2537 |
| 148 | Ga0068858_100137006 | 3300005842 | Bacteria | 2297 |
| 149 | Ga0068858_100475634 | 3300005842 | Bacteria | 1205 |
| 150 | Ga0068860_100003258 | 3300005843 | Bacteria | 16723 |
| 151 | Ga0068860_100085725 | 3300005843 | Bacteria | 2997 |
| 152 | Ga0068860_100089118 | 3300005843 | Bacteria | 2937 |
| 153 | Ga0068862_100001978 | 3300005844 | Bacteria | 18607 |
| 154 | Ga0068862_100015771 | 3300005844 | Bacteria | 6279 |
| 155 | Ga0068862_100034436 | 3300005844 | Bacteria | 4285 |
| 156 | Ga0068862_100038664 | 3300005844 | Bacteria | 4048 |
| 157 | Ga0068862_100409642 | 3300005844 | Bacteria | 1270 |
| 158 | Ga0068862_100799684 | 3300005844 | Bacteria | 921 |
| 159 | Ga0081455_10000178 | 3300005937 | Bacteria | 79927 |
| 160 | Ga0081455_10000576 | 3300005937 | Bacteria | 47827 |
| 161 | Ga0081455_10002921 | 3300005937 | Bacteria | 20054 |
| 162 | Ga0081455_10038375 | 3300005937 | Bacteria | 4242 |
| 163 | Ga0081455_10068407 | 3300005937 | Bacteria | 2956 |
| 164 | Ga0081455_10152553 | 3300005937 | Bacteria | 1779 |
| 165 | Ga0081538_10020424 | 3300005981 | Bacteria | 4874 |
| 166 | Ga0081540_1067359 | 3300005983 | Bacteria | 1673 |
| 167 | Ga0081539_10000987 | 3300005985 | Bacteria | 52947 |
| 168 | Ga0070717_10247408 | 3300006028 | Bacteria | 1574 |
| 169 | Ga0075365_10075004 | 3300006038 | Bacteria | 2282 |
| 170 | Ga0075365_10398663 | 3300006038 | Bacteria | 971 |
| 171 | Ga0075363_100098168 | 3300006048 | Bacteria | 1619 |
| 172 | Ga0075364_10147677 | 3300006051 | Bacteria | 1583 |
| 173 | Ga0075432_10021510 | 3300006058 | Unclassified | 2205 |
| 174 | Ga0070716_100029371 | 3300006173 | Bacteria | 2972 |
| 175 | Ga0070716_100126622 | 3300006173 | Bacteria | 1608 |
| 176 | Ga0070712_100003200 | 3300006175 | Bacteria | 10087 |
| 177 | Ga0070712_100189853 | 3300006175 | Bacteria | 1607 |
| 178 | Ga0075362_10002293 | 3300006177 | Bacteria | 6388 |
| 179 | Ga0075362_10031783 | 3300006177 | Bacteria | 2287 |
| 180 | Ga0075362_10038829 | 3300006177 | Bacteria | 2091 |
| 181 | Ga0075362_10050819 | 3300006177 | Bacteria | 1854 |
| 182 | Ga0075362_10051055 | 3300006177 | Bacteria | 1850 |
| 183 | Ga0075362_10059779 | 3300006177 | Bacteria | 1721 |
| 184 | Ga0075367_10021536 | 3300006178 | Bacteria | 3604 |
| 185 | Ga0075367_10056350 | 3300006178 | Bacteria | 2335 |
| 186 | Ga0075367_10127635 | 3300006178 | Bacteria | 1570 |
| 187 | Ga0075367_10291797 | 3300006178 | Bacteria | 1026 |
| 188 | Ga0075367_10401428 | 3300006178 | Bacteria | 867 |
| 189 | Ga0075369_10004309 | 3300006186 | Bacteria | 5243 |
| 190 | Ga0075369_10011196 | 3300006186 | Bacteria | 3523 |
| 191 | Ga0075369_10211558 | 3300006186 | Bacteria | 896 |
| 192 | Ga0075366_10011726 | 3300006195 | Bacteria | 4954 |
| 193 | Ga0075366_10144679 | 3300006195 | Bacteria | 1438 |
| 194 | Ga0075366_10194890 | 3300006195 | Bacteria | 1231 |
| 195 | Ga0097621_100240038 | 3300006237 | Bacteria | 1584 |
| 196 | Ga0075428_100001995 | 3300006844 | Bacteria | 22000 |
| 197 | Ga0075428_100004148 | 3300006844 | Bacteria | 15951 |
| 198 | Ga0075428_100006328 | 3300006844 | Bacteria | 13170 |
| 199 | Ga0075428_100147622 | 3300006844 | Bacteria | 2556 |
| 200 | Ga0075428_100356377 | 3300006844 | Bacteria | 1570 |
| 201 | Ga0075428_100423421 | 3300006844 | Bacteria | 1426 |
| 202 | Ga0075428_100576434 | 3300006844 | Bacteria | 1202 |
| 203 | Ga0075430_100000574 | 3300006846 | Bacteria | 27901 |
| 204 | Ga0075430_100000927 | 3300006846 | Bacteria | 23040 |
| 205 | Ga0075430_100025756 | 3300006846 | Bacteria | 5005 |
| 206 | Ga0075430_100150717 | 3300006846 | Bacteria | 1937 |
| 207 | Ga0075431_100000175 | 3300006847 | Bacteria | 45515 |
| 208 | Ga0075431_100000271 | 3300006847 | Bacteria | 40085 |
| 209 | Ga0075431_100000339 | 3300006847 | Bacteria | 36926 |
| 210 | Ga0075431_100000380 | 3300006847 | Bacteria | 35549 |
| 211 | Ga0075431_100001571 | 3300006847 | Bacteria | 21219 |
| 212 | Ga0075431_100016272 | 3300006847 | Bacteria | 7546 |
| 213 | Ga0075431_100050089 | 3300006847 | Bacteria | 4307 |
| 214 | Ga0075431_100052712 | 3300006847 | Bacteria | 4195 |
| 215 | Ga0075431_100061328 | 3300006847 | Bacteria | 3880 |
| 216 | Ga0075431_100144139 | 3300006847 | Bacteria | 2455 |
| 217 | Ga0075431_100433948 | 3300006847 | Unclassified | 1311 |
| 218 | Ga0075431_100448801 | 3300006847 | Bacteria | 1286 |
| 219 | Ga0075433_10015415 | 3300006852 | Bacteria | 6268 |
| 220 | Ga0075433_10021301 | 3300006852 | Bacteria | 5435 |
| 221 | Ga0075433_10024066 | 3300006852 | Bacteria | 5135 |
| 222 | Ga0075433_10053746 | 3300006852 | Bacteria | 3512 |
| 223 | Ga0075433_10071747 | 3300006852 | Bacteria | 3044 |
| 224 | Ga0075433_10193644 | 3300006852 | Bacteria | 1808 |
| 225 | Ga0075433_10354964 | 3300006852 | Bacteria | 1295 |
| 226 | Ga0075433_10560791 | 3300006852 | Bacteria | 1004 |
| 227 | Ga0075434_100021782 | 3300006871 | Bacteria | 6234 |
| 228 | Ga0075434_100047586 | 3300006871 | Bacteria | 4256 |
| 229 | Ga0075434_100056776 | 3300006871 | Bacteria | 3891 |
| 230 | Ga0075434_100135066 | 3300006871 | Bacteria | 2486 |
| 231 | Ga0075434_100209947 | 3300006871 | Bacteria | 1967 |
| 232 | Ga0075434_100235536 | 3300006871 | Bacteria | 1851 |
| 233 | Ga0075434_100235891 | 3300006871 | Bacteria | 1849 |
| 234 | Ga0075434_100281077 | 3300006871 | Bacteria | 1684 |
| 235 | Ga0075434_100634944 | 3300006871 | Bacteria | 1086 |
| 236 | Ga0075429_100000014 | 3300006880 | Bacteria | 79603 |
| 237 | Ga0075429_100001287 | 3300006880 | Bacteria | 20435 |
| 238 | Ga0075429_100012908 | 3300006880 | Bacteria | 7248 |
| 239 | Ga0075429_100016363 | 3300006880 | Bacteria | 6427 |
| 240 | Ga0075429_100026333 | 3300006880 | Bacteria | 5048 |
| 241 | Ga0075429_100037126 | 3300006880 | Bacteria | 4241 |
| 242 | Ga0075429_100208957 | 3300006880 | Bacteria | 1710 |
| 243 | Ga0075429_100233879 | 3300006880 | Bacteria | 1610 |
| 244 | Ga0075429_100357569 | 3300006880 | Bacteria | 1279 |
| 245 | Ga0068865_100493833 | 3300006881 | Bacteria | 1019 |
| 246 | Ga0068865_100575861 | 3300006881 | Bacteria | 948 |
| 247 | Ga0075436_100011714 | 3300006914 | Bacteria | 6019 |
| 248 | Ga0075436_100020488 | 3300006914 | Bacteria | 4539 |
| 249 | Ga0075436_100033909 | 3300006914 | Bacteria | 3518 |
| 250 | Ga0075436_100047501 | 3300006914 | Bacteria | 2961 |
| 251 | Ga0075436_100112309 | 3300006914 | Bacteria | 1903 |
| 252 | Ga0075436_100177108 | 3300006914 | Bacteria | 1506 |
| 253 | Ga0097620_100037661 | 3300006931 | Bacteria | 4854 |
| 254 | Ga0097620_100201595 | 3300006931 | Bacteria | 2074 |
| 255 | Ga0097620_100507018 | 3300006931 | Bacteria | 1302 |
| 256 | Ga0099824_1007022 | 3300006942 | Bacteria | 15144 |
| 257 | Ga0099822_1009294 | 3300006943 | Bacteria | 12400 |
| 258 | Ga0075435_100066579 | 3300007076 | Bacteria | 2931 |
| 259 | Ga0075435_100083556 | 3300007076 | Bacteria | 2625 |
| 260 | Ga0075435_100112142 | 3300007076 | Bacteria | 2269 |
| 261 | Ga0099794_10006090 | 3300007265 | Bacteria | 4871 |
| 262 | Ga0099794_10045817 | 3300007265 | Bacteria | 2093 |
| 263 | Ga0099794_10057983 | 3300007265 | Bacteria | 1877 |
| 264 | Ga0099794_10134330 | 3300007265 | Bacteria | 1251 |
| 265 | Ga0105240_10053725 | 3300009093 | Bacteria | 5054 |
| 266 | Ga0105240_10294310 | 3300009093 | Bacteria | 1860 |
| 267 | Ga0111539_10006885 | 3300009094 | Bacteria | 14602 |
| 268 | Ga0111539_10016351 | 3300009094 | Bacteria | 9199 |
| 269 | Ga0111539_10089708 | 3300009094 | Bacteria | 3613 |
| 270 | Ga0105245_10782788 | 3300009098 | Bacteria | 991 |
| 271 | Ga0114129_10000312 | 3300009147 | Bacteria | 56790 |
| 272 | Ga0114129_10000495 | 3300009147 | Bacteria | 47768 |
| 273 | Ga0114129_10000499 | 3300009147 | Bacteria | 47675 |
| 274 | Ga0114129_10001148 | 3300009147 | Bacteria | 35055 |
| 275 | Ga0114129_10033919 | 3300009147 | Bacteria | 7210 |
| 276 | Ga0114129_10064303 | 3300009147 | Bacteria | 5119 |
| 277 | Ga0114129_10075473 | 3300009147 | Bacteria | 4694 |
| 278 | Ga0114129_10099435 | 3300009147 | Bacteria | 4026 |
| 279 | Ga0114129_10125309 | 3300009147 | Bacteria | 3532 |
| 280 | Ga0114129_10134905 | 3300009147 | Bacteria | 3387 |
| 281 | Ga0114129_10243507 | 3300009147 | Bacteria | 2417 |
| 282 | Ga0114129_10274334 | 3300009147 | Bacteria | 2255 |
| 283 | Ga0114129_10318271 | 3300009147 | Bacteria | 2069 |
| 284 | Ga0114129_10334023 | 3300009147 | Bacteria | 2011 |
| 285 | Ga0114129_10668703 | 3300009147 | Bacteria | 1338 |
| 286 | Ga0114129_10692601 | 3300009147 | Bacteria | 1310 |
| 287 | Ga0105243_10084234 | 3300009148 | Bacteria | 2603 |
| 288 | Ga0105243_10207163 | 3300009148 | Bacteria | 1724 |
| 289 | Ga0105243_10268126 | 3300009148 | Bacteria | 1532 |
| 290 | Ga0105243_10474004 | 3300009148 | Bacteria | 1180 |
| 291 | Ga0105241_10004528 | 3300009174 | Bacteria | 10281 |
| 292 | Ga0105241_10032631 | 3300009174 | Bacteria | 3905 |
| 293 | Ga0105242_10034543 | 3300009176 | Bacteria | 4054 |
| 294 | Ga0105242_10124527 | 3300009176 | Bacteria | 2217 |
| 295 | Ga0105248_10533349 | 3300009177 | Bacteria | 1324 |
| 296 | Ga0105238_10009913 | 3300009551 | Bacteria | 9550 |
| 297 | Ga0105238_10152411 | 3300009551 | Bacteria | 2287 |
| 298 | Ga0105249_10023224 | 3300009553 | Bacteria | 5563 |
| 299 | Ga0105249_10268770 | 3300009553 | Bacteria | 1698 |
| 300 | Ga0105035_102227 | 3300009988 | Bacteria | 1414 |
| 301 | Ga0105239_10223944 | 3300010375 | Bacteria | 2109 |
| 302 | Ga0105239_10451528 | 3300010375 | Bacteria | 1458 |
| 303 | Ga0157370_10069916 | 3300013104 | Bacteria | 3315 |
| 304 | Ga0157370_10239321 | 3300013104 | Bacteria | 1679 |
| 305 | Ga0157369_10062721 | 3300013105 | Bacteria | 4005 |
| 306 | Ga0157369_10358630 | 3300013105 | Bacteria | 1514 |
| 307 | Ga0157369_10620372 | 3300013105 | Bacteria | 1116 |
| 308 | Ga0171462_1021 | 3300013250 | Bacteria | 141297 |
| 309 | Ga0157378_10135851 | 3300013297 | Bacteria | 2280 |
| 310 | Ga0163162_10151029 | 3300013306 | Bacteria | 2440 |
| 311 | Ga0163162_10272718 | 3300013306 | Bacteria | 1824 |
| 312 | Ga0163162_10676336 | 3300013306 | Bacteria | 1155 |
| 313 | Ga0157372_10002694 | 3300013307 | Bacteria | 19211 |
| 314 | Ga0157372_10208041 | 3300013307 | Bacteria | 2267 |
| 315 | Ga0157372_10461961 | 3300013307 | Bacteria | 1479 |
| 316 | Ga0157375_10081679 | 3300013308 | Bacteria | 3272 |
| 317 | Ga0157375_11068416 | 3300013308 | Bacteria | 944 |
| 318 | Ga0157515_150309 | 3300013875 | Archaea | 869 |
| 319 | Ga0163163_10354808 | 3300014325 | Bacteria | 1523 |
| 320 | Ga0182008_10049381 | 3300014497 | Bacteria | 2089 |
| 321 | Ga0157376_10905306 | 3300014969 | Bacteria | 900 |
| 322 | Ga0163161_10061001 | 3300017792 | Bacteria | 2746 |
| 323 | Ga0206356_10052660 | 3300020070 | Bacteria | 1879 |
| 324 | Ga0206353_11152514 | 3300020082 | Bacteria | 3157 |
| 325 | Ga0213872_10012842 | 3300021361 | Bacteria | 3930 |
| 326 | Ga0213876_10001267 | 3300021384 | Bacteria | 15956 |
| 327 | Ga0213876_10046438 | 3300021384 | Bacteria | 2296 |
| 328 | Ga0213875_10001514 | 3300021388 | Bacteria | 14942 |
| 329 | Ga0213875_10041336 | 3300021388 | Bacteria | 2169 |
| 330 | Ga0213871_10030255 | 3300021441 | Bacteria | 1408 |
| 331 | Ga0209233_1004054 | 3300025261 | Bacteria | 5067 |
| 332 | Ga0209130_1000071 | 3300025284 | Bacteria | 178273 |
| 333 | Ga0209130_1001163 | 3300025284 | Bacteria | 19005 |
| 334 | Ga0209675_1000682 | 3300025291 | Bacteria | 23696 |
| 335 | Ga0209025_1000328 | 3300025294 | Bacteria | 105594 |
| 336 | Ga0209025_1009442 | 3300025294 | Bacteria | 6792 |
| 337 | Ga0209758_1001871 | 3300025297 | Bacteria | 23059 |
| 338 | Ga0209256_1000453 | 3300025299 | Bacteria | 62097 |
| 339 | Ga0207426_1000235 | 3300025302 | Bacteria | 126601 |
| 340 | Ga0207426_1007694 | 3300025302 | Bacteria | 4474 |
| 341 | Ga0207426_1018722 | 3300025302 | Bacteria | 2436 |
| 342 | Ga0207426_1038171 | 3300025302 | Bacteria | 1514 |
| 343 | Ga0209257_1009440 | 3300025304 | Bacteria | 5222 |
| 344 | Ga0207653_10006803 | 3300025885 | Bacteria | 3572 |
| 345 | Ga0207653_10011782 | 3300025885 | Bacteria | 2728 |
| 346 | Ga0207682_10026606 | 3300025893 | Bacteria | 2300 |
| 347 | Ga0207642_10273493 | 3300025899 | Bacteria | 968 |
| 348 | Ga0207699_10112155 | 3300025906 | Bacteria | 1749 |
| 349 | Ga0207645_10000268 | 3300025907 | Bacteria | 43088 |
| 350 | Ga0207643_10000144 | 3300025908 | Bacteria | 48174 |
| 351 | Ga0207705_10145539 | 3300025909 | Bacteria | 1772 |
| 352 | Ga0207684_10000474 | 3300025910 | Bacteria | 51941 |
| 353 | Ga0207684_10049419 | 3300025910 | Bacteria | 3568 |
| 354 | Ga0207684_10078456 | 3300025910 | Bacteria | 2808 |
| 355 | Ga0207684_10087776 | 3300025910 | Bacteria | 2650 |
| 356 | Ga0207684_10599668 | 3300025910 | Bacteria | 941 |
| 357 | Ga0207654_10007511 | 3300025911 | Bacteria | 5495 |
| 358 | Ga0207707_10000250 | 3300025912 | Bacteria | 59148 |
| 359 | Ga0207707_10222483 | 3300025912 | Bacteria | 1643 |
| 360 | Ga0207707_10353856 | 3300025912 | Bacteria | 1265 |
| 361 | Ga0207695_10211114 | 3300025913 | Bacteria | 1852 |
| 362 | Ga0207695_10242073 | 3300025913 | Bacteria | 1705 |
| 363 | Ga0207693_10034898 | 3300025915 | Bacteria | 3967 |
| 364 | Ga0207693_10169832 | 3300025915 | Bacteria | 1717 |
| 365 | Ga0207660_10000341 | 3300025917 | Bacteria | 30131 |
| 366 | Ga0207660_10012826 | 3300025917 | Bacteria | 5487 |
| 367 | Ga0207660_10043871 | 3300025917 | Bacteria | 3144 |
| 368 | Ga0207660_10086586 | 3300025917 | Bacteria | 2313 |
| 369 | Ga0207660_10254706 | 3300025917 | Bacteria | 1386 |
| 370 | Ga0207662_10025182 | 3300025918 | Bacteria | 3426 |
| 371 | Ga0207662_10267858 | 3300025918 | Bacteria | 1126 |
| 372 | Ga0207657_10012232 | 3300025919 | Bacteria | 8479 |
| 373 | Ga0207657_10084831 | 3300025919 | Bacteria | 2654 |
| 374 | Ga0207649_10103349 | 3300025920 | Bacteria | 1890 |
| 375 | Ga0207652_10000757 | 3300025921 | Bacteria | 31021 |
| 376 | Ga0207652_10004986 | 3300025921 | Bacteria | 10753 |
| 377 | Ga0207646_10002578 | 3300025922 | Bacteria | 21396 |
| 378 | Ga0207646_10016668 | 3300025922 | Bacteria | 6891 |
| 379 | Ga0207646_10020279 | 3300025922 | Bacteria | 6162 |
| 380 | Ga0207646_10104521 | 3300025922 | Bacteria | 2540 |
| 381 | Ga0207646_10180982 | 3300025922 | Bacteria | 1904 |
| 382 | Ga0207681_10031954 | 3300025923 | Bacteria | 3442 |
| 383 | Ga0207694_10059196 | 3300025924 | Bacteria | 2979 |
| 384 | Ga0207650_10005652 | 3300025925 | Bacteria | 8540 |
| 385 | Ga0207700_10030298 | 3300025928 | Bacteria | 3829 |
| 386 | Ga0207700_10109043 | 3300025928 | Bacteria | 2224 |
| 387 | Ga0207644_10312978 | 3300025931 | Bacteria | 1268 |
| 388 | Ga0207690_10004563 | 3300025932 | Bacteria | 8179 |
| 389 | Ga0207706_10004278 | 3300025933 | Bacteria | 13432 |
| 390 | Ga0207706_10015363 | 3300025933 | Bacteria | 6917 |
| 391 | Ga0207706_10213637 | 3300025933 | Bacteria | 1690 |
| 392 | Ga0207686_10011545 | 3300025934 | Bacteria | 4840 |
| 393 | Ga0207686_10729581 | 3300025934 | Bacteria | 790 |
| 394 | Ga0207709_10047777 | 3300025935 | Bacteria | 2604 |
| 395 | Ga0207670_10063383 | 3300025936 | Bacteria | 2529 |
| 396 | Ga0207704_10265460 | 3300025938 | Bacteria | 1297 |
| 397 | Ga0207704_10437174 | 3300025938 | Bacteria | 1041 |
| 398 | Ga0207704_10618227 | 3300025938 | Bacteria | 889 |
| 399 | Ga0207665_10018644 | 3300025939 | Bacteria | 4558 |
| 400 | Ga0207691_10060187 | 3300025940 | Bacteria | 3451 |
| 401 | Ga0207691_10256157 | 3300025940 | Bacteria | 1509 |
| 402 | Ga0207689_10000005 | 3300025942 | Bacteria | 135458 |
| 403 | Ga0207689_10008846 | 3300025942 | Bacteria | 8742 |
| 404 | Ga0207689_10060382 | 3300025942 | Bacteria | 3118 |
| 405 | Ga0207661_10082695 | 3300025944 | Bacteria | 2655 |
| 406 | Ga0207679_10000273 | 3300025945 | Bacteria | 38920 |
| 407 | Ga0207679_10043239 | 3300025945 | Bacteria | 3243 |
| 408 | Ga0207667_10001037 | 3300025949 | Bacteria | 35354 |
| 409 | Ga0207667_10009236 | 3300025949 | Bacteria | 11640 |
| 410 | Ga0207667_10184336 | 3300025949 | Bacteria | 2143 |
| 411 | Ga0207712_10126919 | 3300025961 | Unclassified | 1938 |
| 412 | Ga0207712_10390862 | 3300025961 | Bacteria | 1167 |
| 413 | Ga0207640_10003690 | 3300025981 | Bacteria | 8254 |
| 414 | Ga0207677_10110330 | 3300026023 | Bacteria | 2047 |
| 415 | Ga0207703_10175155 | 3300026035 | Bacteria | 1890 |
| 416 | Ga0207703_10216802 | 3300026035 | Bacteria | 1709 |
| 417 | Ga0207639_10002730 | 3300026041 | Bacteria | 11844 |
| 418 | Ga0207639_10007661 | 3300026041 | Bacteria | 7370 |
| 419 | Ga0207678_10004745 | 3300026067 | Bacteria | 12212 |
| 420 | Ga0207708_10334697 | 3300026075 | Bacteria | 1238 |
| 421 | Ga0207708_10367024 | 3300026075 | Bacteria | 1184 |
| 422 | Ga0207702_10000385 | 3300026078 | Bacteria | 50280 |
| 423 | Ga0207702_10011216 | 3300026078 | Bacteria | 7473 |
| 424 | Ga0207702_10276865 | 3300026078 | Bacteria | 1585 |
| 425 | Ga0207641_10326461 | 3300026088 | Bacteria | 1456 |
| 426 | Ga0207648_10000434 | 3300026089 | Bacteria | 46147 |
| 427 | Ga0207648_10019305 | 3300026089 | Bacteria | 6152 |
| 428 | Ga0207648_10132385 | 3300026089 | Bacteria | 2195 |
| 429 | Ga0207648_10609629 | 3300026089 | Bacteria | 1007 |
| 430 | Ga0207676_10110161 | 3300026095 | Bacteria | 2302 |
| 431 | Ga0207674_10000673 | 3300026116 | Bacteria | 44363 |
| 432 | Ga0207674_10010341 | 3300026116 | Bacteria | 10579 |
| 433 | Ga0207674_10434666 | 3300026116 | Bacteria | 1268 |
| 434 | Ga0207675_100050791 | 3300026118 | Bacteria | 3870 |
| 435 | Ga0207675_100059843 | 3300026118 | Bacteria | 3555 |
| 436 | Ga0207675_100203496 | 3300026118 | Bacteria | 1902 |
| 437 | Ga0207675_100302472 | 3300026118 | Bacteria | 1558 |
| 438 | Ga0207683_10093701 | 3300026121 | Bacteria | 2676 |
| 439 | Ga0207698_10098969 | 3300026142 | Bacteria | 2411 |
| 440 | Ga0207698_10133761 | 3300026142 | Bacteria | 2124 |
| 441 | Ga0207698_10196498 | 3300026142 | Bacteria | 1802 |
| 442 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 443 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 444 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 445 | Ga0209995_1002297 | 3300027471 | Bacteria | 3014 |
| 446 | Ga0209999_1001421 | 3300027543 | Bacteria | 4104 |
| 447 | Ga0209970_1002488 | 3300027614 | Bacteria | 3133 |
| 448 | Ga0209588_1103649 | 3300027671 | Bacteria | 915 |
| 449 | Ga0209971_1002698 | 3300027682 | Bacteria | 4246 |
| 450 | Ga0209966_1000430 | 3300027695 | Bacteria | 11969 |
| 451 | Ga0209998_10000123 | 3300027717 | Bacteria | 30249 |
| 452 | Ga0209974_10000444 | 3300027876 | Bacteria | 13736 |
| 453 | Ga0207428_10001382 | 3300027907 | Bacteria | 25656 |
| 454 | Ga0207428_10007386 | 3300027907 | Bacteria | 10020 |
| 455 | Ga0268266_10032724 | 3300028379 | Bacteria | 4418 |
| 456 | Ga0268266_10215300 | 3300028379 | Bacteria | 1763 |
| 457 | Ga0268266_10639244 | 3300028379 | Bacteria | 1023 |
| 458 | Ga0268265_10003299 | 3300028380 | Bacteria | 11692 |
| 459 | Ga0268265_10008981 | 3300028380 | Bacteria | 6761 |
| 460 | Ga0268265_10071382 | 3300028380 | Bacteria | 2704 |
| 461 | Ga0268265_10121191 | 3300028380 | Bacteria | 2155 |
| 462 | Ga0268264_10022305 | 3300028381 | Bacteria | 5171 |
| 463 | Ga0268264_10041016 | 3300028381 | Bacteria | 3826 |
| 464 | Ga0268264_10086913 | 3300028381 | Bacteria | 2687 |
| 465 | Ga0268264_10126390 | 3300028381 | Bacteria | 2260 |
| 466 | Ga0268264_10562599 | 3300028381 | Bacteria | 1120 |
| 467 | Ga0265334_10067869 | 3300028573 | Bacteria | 1332 |
| 468 | Ga0307515_10002860 | 3300028794 | Bacteria | 36720 |
| 469 | Ga0307408_100014069 | 3300031548 | Bacteria | 5315 |
| 470 | Ga0307514_10000225 | 3300031649 | Bacteria | 151002 |
| 471 | Ga0307410_10020475 | 3300031852 | Bacteria | 4047 |
| 472 | Ga0307416_100004672 | 3300032002 | Bacteria | 8289 |
| 473 | Ga0373948_0009901 | 3300034817 | Bacteria | 1654 |
| 474 | Ga0373959_0009702 | 3300034820 | Bacteria | 1668 |
| 475 | Ga0373940_0042419 | 3300035088 | Bacteria | 1254 |
| 476 | Ga0373949_0036575 | 3300035090 | Bacteria | 1191 |
| 477 | Ga0373932_0025953 | 3300035112 | Bacteria | 1591 |
| 478 | Ga0373941_0073816 | 3300035115 | Bacteria | 1138 |
| 479 | Ga0373961_0043743 | 3300035241 | Bacteria | 1303 |
| 480 | Ga0373931_0030939 | 3300035691 | Bacteria | 2758 |
| 481 | Ga0373931_0194808 | 3300035691 | Bacteria | 1208 |
| 482 | Ga0395899_0006315 | 3300037312 | Bacteria | 9173 |
| 483 | Ga0395899_0024705 | 3300037312 | Bacteria | 4542 |
| 484 | Ga0395899_0187578 | 3300037312 | Bacteria | 1448 |
| 485 | Ga0395900_0007881 | 3300037418 | Bacteria | 10970 |
| 486 | Ga0395900_0091151 | 3300037418 | Bacteria | 3132 |
| 487 | Ga0395900_0138852 | 3300037418 | Bacteria | 2489 |
| 488 | Ga0395900_0144124 | 3300037418 | Bacteria | 2437 |
| 489 | Ga0395898_0002751 | 3300037466 | Bacteria | 20264 |
| 490 | Ga0395898_0048502 | 3300037466 | Bacteria | 4164 |
| 491 | Ga0395905_0079638 | 3300037471 | Bacteria | 3071 |
| 492 | Ga0436364_0227330 | 3300037853 | Bacteria | 1942 |
| 493 | Ga0436364_0318669 | 3300037853 | Bacteria | 2089 |
| 494 | Ga0395901_0001952 | 3300038443 | Bacteria | 21231 |
| 495 | Ga0395901_0050792 | 3300038443 | Bacteria | 4307 |
| 496 | Ga0395901_0280638 | 3300038443 | Bacteria | 1730 |
| 497 | Ga0242420_013675 | 3300038996 | Bacteria | 1385 |
| 498 | Ga0436365_0823562 | 3300039437 | Bacteria | 2008 |
| 499 | Ga0436360_0271151 | 3300039438 | Bacteria | 2238 |
| 500 | Ga0436360_0295164 | 3300039438 | Bacteria | 14242 |
| 501 | Ga0436360_0971002 | 3300039438 | Bacteria | 1198 |
| 502 | Ga0436361_0310679 | 3300039447 | Bacteria | 11236 |
| 503 | Ga0436361_0647554 | 3300039447 | Bacteria | 1643 |
| 504 | Ga0436363_0338563 | 3300039450 | Bacteria | 1274 |
| 505 | Ga0436363_0622226 | 3300039450 | Bacteria | 1154 |
| 506 | Ga0436363_0984190 | 3300039450 | Unclassified | 1334 |
| 507 | Ga0436362_0239532 | 3300039453 | Bacteria | 1235 |
| 508 | Ga0439445_0094398 | 3300042004 | Bacteria | 845 |
| 509 | Ga0439448_0002205 | 3300042005 | Bacteria | 5265 |
| 510 | Ga0439455_0006076 | 3300042012 | Bacteria | 2487 |
| 511 | Ga0439460_0068026 | 3300042461 | Bacteria | 1098 |
| 512 | Ga0439460_0090077 | 3300042461 | Bacteria | 974 |
| 513 | Ga0451577_0012446 | 3300042876 | Bacteria | 7990 |
| 514 | Ga0451577_0044704 | 3300042876 | Bacteria | 3965 |
| 515 | Ga0451577_0191220 | 3300042876 | Bacteria | 1846 |
| 516 | Ga0453683_0070726 | 3300044673 | Bacteria | 2182 |
| 517 | Ga0466963_0376593 | 3300044694 | Bacteria | 1000 |
| 518 | Ga0453684_0027427 | 3300044712 | Bacteria | 8170 |
| 519 | Ga0453684_0474274 | 3300044712 | Bacteria | 1389 |
| 520 | Ga0466957_0168354 | 3300044842 | Bacteria | 1426 |
| 521 | Ga0451576_0040286 | 3300045051 | Bacteria | 4946 |
| 522 | Ga0451576_0064991 | 3300045051 | Bacteria | 3799 |
| 523 | Ga0451576_0099093 | 3300045051 | Bacteria | 3032 |
| 524 | Ga0451576_0191697 | 3300045051 | Bacteria | 2135 |
| 525 | Ga0451576_0196097 | 3300045051 | Bacteria | 2109 |
| 526 | Ga0451576_0236908 | 3300045051 | Bacteria | 1906 |
| 527 | Ga0451576_0237967 | 3300045051 | Bacteria | 1901 |
| 528 | Ga0451576_0406536 | 3300045051 | Bacteria | 1427 |
| 529 | Ga0451576_0575409 | 3300045051 | Bacteria | 1183 |
| 530 | Ga0451576_0907534 | 3300045051 | Bacteria | 924 |
| 531 | Ga0495603_0055236 | 3300046455 | Bacteria | 2353 |
| 532 | Ga0495603_0117585 | 3300046455 | Unclassified | 1550 |
| 533 | Ga0495591_001856 | 3300046458 | Bacteria | 12439 |
| 534 | Ga0495580_0032563 | 3300046472 | Bacteria | 3761 |
| 535 | Ga0495583_0170107 | 3300046506 | Bacteria | 896 |
| 536 | Ga0495610_0134937 | 3300046512 | Bacteria | 1068 |
| 537 | Ga0495642_0007342 | 3300046528 | Bacteria | 4230 |
| 538 | Ga0495659_0178877 | 3300046664 | Bacteria | 863 |
| 539 | Ga0495669_0015620 | 3300046684 | Bacteria | 3252 |
| 540 | Ga0495649_0139709 | 3300046694 | Bacteria | 1276 |
| 541 | Ga0495679_006589 | 3300047446 | Bacteria | 4972 |
| 542 | Ga0496102_0016559 | 3300048905 | Bacteria | 6443 |
| 543 | Ga0496106_0137543 | 3300048909 | Bacteria | 1920 |
| 544 | Ga0496106_0459290 | 3300048909 | Bacteria | 1023 |
| 545 | Ga0496112_0079049 | 3300048915 | Bacteria | 3253 |
| 546 | Ga0496121_0110745 | 3300048924 | Bacteria | 2095 |
| 547 | Ga0496122_0006578 | 3300048925 | Bacteria | 13272 |
| 548 | Ga0496123_0054463 | 3300048926 | Bacteria | 2633 |
| 549 | Ga0496124_0023226 | 3300048927 | Bacteria | 5667 |
| 550 | Ga0496125_0003788 | 3300048928 | Bacteria | 17975 |
| 551 | Ga0496126_0177802 | 3300048929 | Bacteria | 1809 |
| 552 | Ga0496126_0245102 | 3300048929 | Bacteria | 1495 |
| 553 | Ga0496126_0249733 | 3300048929 | Bacteria | 1479 |
| 554 | Ga0501033_0056471 | 3300049570 | Bacteria | 2902 |
| 555 | Ga0501033_0370570 | 3300049570 | Bacteria | 1001 |
| 556 | Ga0501034_0001140 | 3300049571 | Bacteria | 37002 |
| 557 | Ga0501034_0001685 | 3300049571 | Bacteria | 28484 |
| 558 | Ga0501034_0065722 | 3300049571 | Bacteria | 3640 |
| 559 | Ga0501034_0224682 | 3300049571 | Bacteria | 1829 |
| 560 | Ga0501036_0000740 | 3300049572 | Bacteria | 24134 |
| 561 | Ga0501036_0013100 | 3300049572 | Bacteria | 6890 |
| 562 | Ga0501036_0025039 | 3300049572 | Bacteria | 5033 |
| 563 | Ga0501036_0274959 | 3300049572 | Bacteria | 1410 |
| 564 | Ga0501036_0278751 | 3300049572 | Bacteria | 1399 |
| 565 | Ga0501038_0279568 | 3300049574 | Bacteria | 1314 |
| 566 | Ga0501038_0345198 | 3300049574 | Bacteria | 1160 |
| 567 | Ga0501038_0361891 | 3300049574 | Bacteria | 1128 |
| 568 | Ga0501039_0010087 | 3300049575 | Bacteria | 7197 |
| 569 | Ga0501039_0014086 | 3300049575 | Bacteria | 6122 |
| 570 | Ga0501039_0040458 | 3300049575 | Bacteria | 3599 |
| 571 | Ga0501039_0120845 | 3300049575 | Bacteria | 2053 |
| 572 | Ga0501039_0166194 | 3300049575 | Bacteria | 1735 |
| 573 | Ga0501039_0192874 | 3300049575 | Bacteria | 1602 |
| 574 | Ga0501039_0292464 | 3300049575 | Bacteria | 1281 |
| 575 | Ga0501039_0409717 | 3300049575 | Bacteria | 1065 |
| 576 | Ga0501040_0004045 | 3300049576 | Bacteria | 9533 |
| 577 | Ga0501040_0052461 | 3300049576 | Bacteria | 2791 |
| 578 | Ga0501040_0072442 | 3300049576 | Bacteria | 2379 |
| 579 | Ga0501040_0078315 | 3300049576 | Bacteria | 2287 |
| 580 | Ga0501040_0138454 | 3300049576 | Bacteria | 1714 |
| 581 | Ga0501040_0343168 | 3300049576 | Bacteria | 1069 |
| 582 | Ga0501041_0000154 | 3300049577 | Bacteria | 30297 |
| 583 | Ga0501041_0001274 | 3300049577 | Bacteria | 13864 |
| 584 | Ga0501041_0005047 | 3300049577 | Bacteria | 7687 |
| 585 | Ga0501041_0046269 | 3300049577 | Bacteria | 2647 |
| 586 | Ga0501041_0055929 | 3300049577 | Bacteria | 2410 |
| 587 | Ga0501041_0056916 | 3300049577 | Bacteria | 2390 |
| 588 | Ga0501041_0088041 | 3300049577 | Bacteria | 1917 |
| 589 | Ga0501041_0091658 | 3300049577 | Bacteria | 1876 |
| 590 | Ga0501041_0239981 | 3300049577 | Bacteria | 1139 |
| 591 | Ga0501042_0003231 | 3300049578 | Bacteria | 10188 |
| 592 | Ga0501042_0045957 | 3300049578 | Bacteria | 3112 |
| 593 | Ga0501042_0055387 | 3300049578 | Bacteria | 2830 |
| 594 | Ga0501042_0447690 | 3300049578 | Bacteria | 936 |
| 595 | Ga0501043_0056121 | 3300049579 | Bacteria | 3094 |
| 596 | Ga0501046_0001642 | 3300049580 | Bacteria | 21400 |
| 597 | Ga0501046_0028313 | 3300049580 | Bacteria | 4564 |
| 598 | Ga0501046_0037932 | 3300049580 | Bacteria | 3870 |
| 599 | Ga0501046_0448791 | 3300049580 | Bacteria | 928 |
| 600 | Ga0501047_0145500 | 3300049581 | Bacteria | 2247 |
| 601 | Ga0501048_0026167 | 3300049582 | Bacteria | 4248 |
| 602 | Ga0501048_0030937 | 3300049582 | Bacteria | 3874 |
| 603 | Ga0501048_0057693 | 3300049582 | Bacteria | 2753 |
| 604 | Ga0501048_0095691 | 3300049582 | Bacteria | 2094 |
| 605 | Ga0501048_0103919 | 3300049582 | Bacteria | 2005 |
| 606 | Ga0501048_0122537 | 3300049582 | Bacteria | 1837 |
| 607 | Ga0501048_0325381 | 3300049582 | Bacteria | 1095 |
| 608 | Ga0501068_0057900 | 3300049584 | Bacteria | 2350 |
| 609 | Ga0501068_0066216 | 3300049584 | Bacteria | 2200 |
| 610 | Ga0501068_0095113 | 3300049584 | Bacteria | 1842 |
| 611 | Ga0501068_0095789 | 3300049584 | Bacteria | 1836 |
| 612 | Ga0501069_0008517 | 3300049585 | Bacteria | 5393 |
| 613 | Ga0501069_0131961 | 3300049585 | Bacteria | 1431 |
| 614 | Ga0501070_0136797 | 3300049586 | Bacteria | 2023 |
| 615 | Ga0501071_0000173 | 3300049587 | Bacteria | 28262 |
| 616 | Ga0501071_0017840 | 3300049587 | Bacteria | 4904 |
| 617 | Ga0501071_0381036 | 3300049587 | Bacteria | 1075 |
| 618 | Ga0501071_0412615 | 3300049587 | Bacteria | 1032 |
| 619 | Ga0501072_0002324 | 3300049588 | Bacteria | 14266 |
| 620 | Ga0501072_0002838 | 3300049588 | Bacteria | 12999 |
| 621 | Ga0501072_0003886 | 3300049588 | Bacteria | 11297 |
| 622 | Ga0501072_0011898 | 3300049588 | Bacteria | 6646 |
| 623 | Ga0501072_0033115 | 3300049588 | Bacteria | 4049 |
| 624 | Ga0501072_0036083 | 3300049588 | Bacteria | 3875 |
| 625 | Ga0501072_0046114 | 3300049588 | Bacteria | 3429 |
| 626 | Ga0501072_0177719 | 3300049588 | Bacteria | 1698 |
| 627 | Ga0501072_0218015 | 3300049588 | Bacteria | 1521 |
| 628 | Ga0501072_0525630 | 3300049588 | Bacteria | 935 |
| 629 | Ga0501073_0251943 | 3300049589 | Bacteria | 1219 |
| 630 | Ga0501073_0279556 | 3300049589 | Bacteria | 1152 |
| 631 | Ga0501074_0001623 | 3300049590 | Bacteria | 15249 |
| 632 | Ga0501074_0015859 | 3300049590 | Bacteria | 5479 |
| 633 | Ga0501074_0162737 | 3300049590 | Bacteria | 1594 |
| 634 | Ga0501075_0001228 | 3300049591 | Bacteria | 16603 |
| 635 | Ga0501075_0006614 | 3300049591 | Bacteria | 7987 |
| 636 | Ga0501075_0010045 | 3300049591 | Bacteria | 6641 |
| 637 | Ga0501075_0012957 | 3300049591 | Bacteria | 5940 |
| 638 | Ga0501075_0019621 | 3300049591 | Bacteria | 4907 |
| 639 | Ga0501075_0026074 | 3300049591 | Bacteria | 4299 |
| 640 | Ga0501075_0137087 | 3300049591 | Bacteria | 1864 |
| 641 | Ga0501075_0144598 | 3300049591 | Bacteria | 1812 |
| 642 | Ga0501075_0159617 | 3300049591 | Bacteria | 1720 |
| 643 | Ga0501075_0234951 | 3300049591 | Bacteria | 1398 |
| 644 | Ga0501076_0000135 | 3300049592 | Bacteria | 41430 |
| 645 | Ga0501076_0002854 | 3300049592 | Bacteria | 11953 |
| 646 | Ga0501076_0006280 | 3300049592 | Bacteria | 8612 |
| 647 | Ga0501076_0021310 | 3300049592 | Bacteria | 4970 |
| 648 | Ga0501076_0021802 | 3300049592 | Bacteria | 4918 |
| 649 | Ga0501076_0068475 | 3300049592 | Bacteria | 2835 |
| 650 | Ga0501076_0099535 | 3300049592 | Bacteria | 2342 |
| 651 | Ga0501076_0211112 | 3300049592 | Bacteria | 1586 |
| 652 | Ga0501076_0231385 | 3300049592 | Bacteria | 1511 |
| 653 | Ga0501076_0266322 | 3300049592 | Bacteria | 1403 |
| 654 | Ga0501077_0005576 | 3300049593 | Bacteria | 7663 |
| 655 | Ga0501077_0008116 | 3300049593 | Bacteria | 6490 |
| 656 | Ga0501077_0045223 | 3300049593 | Bacteria | 2797 |
| 657 | Ga0501077_0142985 | 3300049593 | Bacteria | 1517 |
| 658 | Ga0501252_002363 | 3300049682 | Bacteria | 1867 |
| 659 | Ga0501079_0000848 | 3300049741 | Bacteria | 20849 |
| 660 | Ga0501079_0003115 | 3300049741 | Bacteria | 12153 |
| 661 | Ga0501079_0011877 | 3300049741 | Bacteria | 6645 |
| 662 | Ga0501079_0014082 | 3300049741 | Bacteria | 6097 |
| 663 | Ga0501079_0132854 | 3300049741 | Bacteria | 1937 |
| 664 | Ga0501079_0173721 | 3300049741 | Bacteria | 1680 |
| 665 | Ga0501080_0036955 | 3300049742 | Bacteria | 4559 |
| 666 | Ga0501080_0109983 | 3300049742 | Bacteria | 2554 |
| 667 | Ga0501080_0132273 | 3300049742 | Bacteria | 2310 |
| 668 | Ga0501080_0297651 | 3300049742 | Bacteria | 1464 |
| 669 | Ga0501080_0405726 | 3300049742 | Bacteria | 1226 |
| 670 | Ga0501081_0000390 | 3300049743 | Bacteria | 24205 |
| 671 | Ga0501081_0004835 | 3300049743 | Bacteria | 8656 |
| 672 | Ga0501081_0007124 | 3300049743 | Bacteria | 7267 |
| 673 | Ga0501081_0007312 | 3300049743 | Bacteria | 7171 |
| 674 | Ga0501081_0007773 | 3300049743 | Bacteria | 6952 |
| 675 | Ga0501081_0018454 | 3300049743 | Bacteria | 4633 |
| 676 | Ga0501081_0036919 | 3300049743 | Bacteria | 3333 |
| 677 | Ga0501081_0044350 | 3300049743 | Bacteria | 3052 |
| 678 | Ga0501081_0077906 | 3300049743 | Bacteria | 2317 |
| 679 | Ga0501081_0210185 | 3300049743 | Bacteria | 1413 |
| 680 | Ga0501081_0242158 | 3300049743 | Bacteria | 1315 |
| 681 | Ga0501083_0043997 | 3300049744 | Bacteria | 3023 |
| 682 | Ga0501083_0049385 | 3300049744 | Bacteria | 2836 |
| 683 | Ga0501083_0086398 | 3300049744 | Bacteria | 2074 |
| 684 | Ga0501083_0107373 | 3300049744 | Bacteria | 1837 |
| 685 | Ga0501035_0005442 | 3300049822 | Bacteria | 12042 |
| 686 | Ga0501035_0227768 | 3300049822 | Bacteria | 1589 |
| 687 | Ga0501044_0035461 | 3300049823 | Bacteria | 5224 |
| 688 | Ga0501044_0337049 | 3300049823 | Bacteria | 1430 |
| 689 | Ga0501044_0889685 | 3300049823 | Bacteria | 766 |
| 690 | Ga0501045_0000153 | 3300049824 | Bacteria | 36957 |
| 691 | Ga0501045_0003761 | 3300049824 | Bacteria | 10438 |
| 692 | Ga0501045_0013066 | 3300049824 | Bacteria | 5856 |
| 693 | Ga0501045_0026662 | 3300049824 | Bacteria | 4158 |
| 694 | Ga0501045_0070475 | 3300049824 | Bacteria | 2572 |
| 695 | Ga0501045_0072551 | 3300049824 | Bacteria | 2535 |
| 696 | Ga0501045_0118327 | 3300049824 | Bacteria | 1966 |
| 697 | Ga0501045_0424025 | 3300049824 | Bacteria | 990 |
| 698 | Ga0501045_0464633 | 3300049824 | Bacteria | 940 |
| 699 | nmdc:mga03683_25069_c1 | 3300050489 | Bacteria | 2338 |
| 700 | nmdc:mga03683_6935_c1 | 3300050489 | Bacteria | 3906 |
| 701 | nmdc:mga03683_7969_c1 | 3300050489 | Bacteria | 3704 |
| 702 | nmdc:mga03n38_68446_c1 | 3300050490 | Bacteria | 1637 |
| 703 | nmdc:mga00v17_356875_c1 | 3300050491 | Bacteria | 950 |
| 704 | nmdc:mga0yw44_379153_c1 | 3300050492 | Bacteria | 955 |
| 705 | nmdc:mga0yw44_4280_c1 | 3300050492 | Bacteria | 6511 |
| 706 | nmdc:mga0yw44_92068_c1 | 3300050492 | Unclassified | 1918 |
| 707 | nmdc:mga0k408_15888_c1 | 3300050493 | Bacteria | 4168 |
| 708 | nmdc:mga0k408_5510_c1 | 3300050493 | Bacteria | 6739 |
| 709 | nmdc:mga0k408_86625_c2 | 3300050493 | Bacteria | 1538 |
| 710 | nmdc:mga06z11_152879_c1 | 3300050494 | Bacteria | 1313 |
| 711 | nmdc:mga06z11_187045_c1 | 3300050494 | Bacteria | 1197 |
| 712 | nmdc:mga06z11_34651_c1 | 3300050494 | Bacteria | 2480 |
| 713 | nmdc:mga06z11_41643_c1 | 3300050494 | Bacteria | 2299 |
| 714 | nmdc:mga04h51_74556_c1 | 3300050495 | Bacteria | 1192 |
| 715 | nmdc:mga07m45_63284_c1 | 3300050496 | Bacteria | 2098 |
| 716 | nmdc:mga05p37_105117_c1 | 3300050507 | Bacteria | 3474 |
| 717 | nmdc:mga05p37_19767_c1 | 3300050507 | Bacteria | 8148 |
| 718 | nmdc:mga05p37_20275_c1 | 3300050507 | Bacteria | 8045 |
| 719 | nmdc:mga05p37_211702_c1 | 3300050507 | Bacteria | 2343 |
| 720 | nmdc:mga05p37_225839_c1 | 3300050507 | Bacteria | 2258 |
| 721 | nmdc:mga05p37_319043_c1 | 3300050507 | Bacteria | 1840 |
| 722 | nmdc:mga05p37_333546_c1 | 3300050507 | Bacteria | 1791 |
| 723 | nmdc:mga05p37_338913_c1 | 3300050507 | Bacteria | 1774 |
| 724 | nmdc:mga05p37_339490_c1 | 3300050507 | Bacteria | 1772 |
| 725 | nmdc:mga05p37_3580_c1 | 3300050507 | Bacteria | 18153 |
| 726 | nmdc:mga05p37_6041_c1 | 3300050507 | Bacteria | 14253 |
| 727 | nmdc:mga05p37_70070_c1 | 3300050507 | Bacteria | 4313 |
| 728 | nmdc:mga05p37_995467_c1 | 3300050507 | Bacteria | 891 |
| 729 | nmdc:mga09592_13704_c1 | 3300050508 | Bacteria | 6624 |
| 730 | nmdc:mga09592_1873_c1 | 3300050508 | Bacteria | 16943 |
| 731 | nmdc:mga09592_19635_c1 | 3300050508 | Bacteria | 5549 |
| 732 | nmdc:mga09592_201689_c1 | 3300050508 | Bacteria | 1723 |
| 733 | nmdc:mga09592_233566_c1 | 3300050508 | Bacteria | 1593 |
| 734 | nmdc:mga09592_340028_c1 | 3300050508 | Bacteria | 1299 |
| 735 | nmdc:mga09592_375463_c1 | 3300050508 | Unclassified | 1230 |
| 736 | nmdc:mga09592_410429_c1 | 3300050508 | Bacteria | 1170 |
| 737 | nmdc:mga09592_698_c1 | 3300050508 | Bacteria | 25682 |
| 738 | nmdc:mga0qj67_211891_c1 | 3300050509 | Bacteria | 1573 |
| 739 | nmdc:mga0qj67_26761_c1 | 3300050509 | Bacteria | 4466 |
| 740 | nmdc:mga0qj67_28307_c1 | 3300050509 | Bacteria | 4349 |
| 741 | nmdc:mga0qj67_64838_c1 | 3300050509 | Bacteria | 2907 |
| 742 | nmdc:mga0qj67_75201_c1 | 3300050509 | Bacteria | 2700 |
| 743 | nmdc:mga0qj67_9465_c1 | 3300050509 | Bacteria | 7252 |
| 744 | nmdc:mga06r32_126179_c1 | 3300050510 | Bacteria | 2528 |
| 745 | nmdc:mga06r32_177_c2 | 3300050510 | Bacteria | 42810 |
| 746 | nmdc:mga06r32_21819_c1 | 3300050510 | Bacteria | 5913 |
| 747 | nmdc:mga06r32_28822_c1 | 3300050510 | Bacteria | 5197 |
| 748 | nmdc:mga06r32_28865_c1 | 3300050510 | Bacteria | 5194 |
| 749 | nmdc:mga06r32_296416_c1 | 3300050510 | Unclassified | 1603 |
| 750 | nmdc:mga06r32_3203_c1 | 3300050510 | Bacteria | 14655 |
| 751 | nmdc:mga06r32_3977_c1 | 3300050510 | Bacteria | 13249 |
| 752 | nmdc:mga06r32_51244_c1 | 3300050510 | Bacteria | 3950 |
| 753 | nmdc:mga06r32_607_c1 | 3300050510 | Bacteria | 31296 |
| 754 | nmdc:mga06r32_97261_c1 | 3300050510 | Bacteria | 2884 |
| 755 | nmdc:mga08y16_22564_c1 | 3300050511 | Bacteria | 6646 |
| 756 | nmdc:mga08y16_332657_c1 | 3300050511 | Unclassified | 1562 |
| 757 | nmdc:mga08y16_3338_c1 | 3300050511 | Bacteria | 16625 |
| 758 | nmdc:mga08y16_384379_c1 | 3300050511 | Bacteria | 1438 |
| 759 | nmdc:mga0n895_102283_c1 | 3300050512 | Bacteria | 2876 |
| 760 | nmdc:mga0n895_131283_c1 | 3300050512 | Bacteria | 2530 |
| 761 | nmdc:mga0n895_137069_c1 | 3300050512 | Bacteria | 2474 |
| 762 | nmdc:mga0n895_175649_c1 | 3300050512 | Bacteria | 2173 |
| 763 | nmdc:mga0n895_19871_c1 | 3300050512 | Bacteria | 6253 |
| 764 | nmdc:mga0n895_23058_c1 | 3300050512 | Bacteria | 5846 |
| 765 | nmdc:mga0n895_31187_c1 | 3300050512 | Bacteria | 5101 |
| 766 | nmdc:mga0n895_640810_c1 | 3300050512 | Bacteria | 1062 |
| 767 | nmdc:mga0rr50_151901_c1 | 3300050513 | Bacteria | 1872 |
| 768 | nmdc:mga0rr50_25031_c1 | 3300050513 | Bacteria | 4144 |
| 769 | nmdc:mga0rr50_47342_c1 | 3300050513 | Bacteria | 3172 |
| 770 | nmdc:mga0rr50_87989_c1 | 3300050513 | Bacteria | 2412 |
| 771 | nmdc:mga08x19_102637_c1 | 3300050514 | Bacteria | 1899 |
| 772 | nmdc:mga08x19_30611_c1 | 3300050514 | Bacteria | 3383 |
| 773 | nmdc:mga08x19_325116_c1 | 3300050514 | Bacteria | 1071 |
| 774 | nmdc:mga08x19_41282_c1 | 3300050514 | Bacteria | 2938 |
| 775 | nmdc:mga08x19_43508_c1 | 3300050514 | Bacteria | 2865 |
| 776 | nmdc:mga0a205_117679_c1 | 3300050515 | Bacteria | 2556 |
| 777 | nmdc:mga0a205_149209_c2 | 3300050515 | Bacteria | 1813 |
| 778 | nmdc:mga0a205_1873_c1 | 3300050515 | Bacteria | 5504 |
| 779 | nmdc:mga0a205_209357_c1 | 3300050515 | Bacteria | 1839 |
| 780 | nmdc:mga0a205_454707_c1 | 3300050515 | Bacteria | 1140 |
| 781 | nmdc:mga0a205_548789_c1 | 3300050515 | Bacteria | 1011 |
| 782 | nmdc:mga0a205_5638_c1 | 3300050515 | Bacteria | 11279 |
| 783 | nmdc:mga0a205_5653_c1 | 3300050515 | Bacteria | 11262 |
| 784 | nmdc:mga0a205_68840_c2 | 3300050515 | Bacteria | 3063 |
| 785 | nmdc:mga0a205_98488_c1 | 3300050515 | Bacteria | 2823 |
| 786 | nmdc:mga0sz30_16023_c1 | 3300050516 | Bacteria | 2968 |
| 787 | nmdc:mga0sz30_272_c1 | 3300050516 | Bacteria | 19782 |
| 788 | nmdc:mga0sz30_29192_c1 | 3300050516 | Bacteria | 2272 |
| 789 | Ga0500641_0000921 | 3300053096 | Bacteria | 10489 |
| 790 | Ga0500568_0015427 | 3300053139 | Bacteria | 3422 |
| 791 | Ga0500568_0033190 | 3300053139 | Bacteria | 2120 |
| 792 | Ga0500616_0000049 | 3300053153 | Bacteria | 303396 |
| 793 | Ga0500616_0003288 | 3300053153 | Bacteria | 12474 |
| 794 | Ga0500552_000672 | 3300053733 | Bacteria | 3209 |
| 795 | Ga0501084_0002524 | 3300054114 | Bacteria | 14739 |
| 796 | Ga0501084_0006956 | 3300054114 | Bacteria | 9317 |
| 797 | Ga0501084_0007572 | 3300054114 | Bacteria | 8952 |
| 798 | Ga0501084_0017218 | 3300054114 | Bacteria | 6003 |
| 799 | Ga0501084_0019931 | 3300054114 | Bacteria | 5590 |
| 800 | Ga0501084_0032796 | 3300054114 | Bacteria | 4346 |
| 801 | Ga0501084_0077367 | 3300054114 | Bacteria | 2789 |
| 802 | Ga0501084_0174351 | 3300054114 | Bacteria | 1815 |
| 803 | Ga0501084_0177246 | 3300054114 | Bacteria | 1799 |
| 804 | Ga0501084_0451588 | 3300054114 | Bacteria | 1087 |
| 805 | Ga0501084_0496376 | 3300054114 | Bacteria | 1031 |
| 806 | Ga0501082_0002472 | 3300060353 | Bacteria | 16208 |
| 807 | Ga0501082_0004029 | 3300060353 | Bacteria | 12824 |
| 808 | Ga0501082_0005991 | 3300060353 | Bacteria | 10543 |
| 809 | Ga0501082_0015900 | 3300060353 | Bacteria | 6471 |
| 810 | Ga0501082_0023316 | 3300060353 | Bacteria | 5339 |
| 811 | Ga0501082_0146411 | 3300060353 | Bacteria | 2051 |
| 812 | Ga0501082_0174168 | 3300060353 | Bacteria | 1871 |
| 813 | Ga0501082_0214455 | 3300060353 | Bacteria | 1675 |
| 814 | Ga0501082_0226349 | 3300060353 | Bacteria | 1627 |
| 815 | Ga0530510_0000111 | 3300061734 | Bacteria | 45793 |
| 816 | Ga0530510_0007660 | 3300061734 | Bacteria | 7520 |
| 817 | Ga0530510_0008725 | 3300061734 | Bacteria | 7089 |
| 818 | Ga0530510_0022598 | 3300061734 | Bacteria | 4480 |
| 819 | Ga0530510_0024089 | 3300061734 | Bacteria | 4342 |
| 820 | Ga0530510_0035253 | 3300061734 | Bacteria | 3606 |
| 821 | Ga0530510_0052534 | 3300061734 | Bacteria | 2945 |
| 822 | Ga0530510_0119482 | 3300061734 | Bacteria | 1934 |
| 823 | Ga0530510_0135924 | 3300061734 | Bacteria | 1810 |
| 824 | Ga0530510_0412896 | 3300061734 | Bacteria | 1018 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_100996886 | Ga0068856_1009968861 | 213 |
| 2 | 3300026078 | Ga0207702_10276865 | Ga0207702_102768653 | 213 |
| 3 | 3300044673 | Ga0453683_0070726 | Ga0453683_0070726_14_664 | 214 |
| 4 | 3300049575 | Ga0501039_0010087 | Ga0501039_0010087_2779_3435 | 216 |
| 5 | 3300028794 | Ga0307515_10002860 | Ga0307515_100028603 | 221 |
| 6 | 3300005435 | Ga0070714_100138327 | Ga0070714_1001383272 | 223 |
| 7 | 3300035241 | Ga0373961_0043743 | Ga0373961_0043743_25_708 | 225 |
| 8 | 3300005546 | Ga0070696_100355117 | Ga0070696_1003551172 | 226 |
| 9 | 3300006880 | Ga0075429_100037126 | Ga0075429_1000371264 | 226 |
| 10 | 3300049744 | Ga0501083_0086398 | Ga0501083_0086398_672_1361 | 228 |
| 11 | 3300049582 | Ga0501048_0026167 | Ga0501048_0026167_1723_2427 | 229 |
| 12 | iso_pu_bacteria | 3005474847 | 3005482773 | 230 |
| 13 | iso_pu_bacteria | 2791355197 | 2793072877 | 232 |
| 14 | iso_pu_bacteria | 2885374607 | 2885382879 | 232 |
| 15 | iso_pu_bacteria | 2903748898 | 2903751460 | 232 |
| 16 | iso_pu_bacteria | 2906610324 | 2906612647 | 232 |
| 17 | iso_pu_bacteria | 2908739725 | 2908745894 | 232 |
| 18 | iso_pu_bacteria | 2922425934 | 2922433146 | 232 |
| 19 | iso_pu_bacteria | 8019555841 | 8019563623 | 232 |
| 20 | iso_pu_bacteria | 8019565922 | 8019573692 | 232 |
| 21 | 3300025302 | Ga0207426_1018722 | Ga0207426_10187222 | 234 |
| 22 | iso_pu_bacteria | 2835312727 | 2835316602 | 234 |
| 23 | iso_pu_bacteria | 2643221736 | 2644745051 | 235 |
| 24 | iso_pu_bacteria | 2841760612 | 2841766435 | 235 |
| 25 | iso_pu_bacteria | 2844104063 | 2844106202 | 235 |
| 26 | iso_pu_bacteria | 2851182111 | 2851186709 | 235 |
| 27 | iso_pu_bacteria | 2851246043 | 2851246558 | 235 |
| 28 | iso_pu_bacteria | 8057529695 | 8057531249 | 235 |
| 29 | 3300005344 | Ga0070661_100372950 | Ga0070661_1003729501 | 236 |
| 30 | 3300005535 | Ga0070684_100083507 | Ga0070684_1000835074 | 236 |
| 31 | 3300005563 | Ga0068855_100060940 | Ga0068855_1000609404 | 236 |
| 32 | 3300005614 | Ga0068856_100029789 | Ga0068856_1000297893 | 236 |
| 33 | 3300005616 | Ga0068852_100131186 | Ga0068852_1001311863 | 236 |
| 34 | 3300006237 | Ga0097621_100240038 | Ga0097621_1002400382 | 236 |
| 35 | 3300006942 | Ga0099824_1007022 | Ga0099824_10070225 | 236 |
| 36 | 3300006943 | Ga0099822_1009294 | Ga0099822_10092942 | 236 |
| 37 | 3300009093 | Ga0105240_10053725 | Ga0105240_100537255 | 236 |
| 38 | 3300009551 | Ga0105238_10152411 | Ga0105238_101524111 | 236 |
| 39 | 3300010375 | Ga0105239_10223944 | Ga0105239_102239443 | 236 |
| 40 | 3300013105 | Ga0157369_10062721 | Ga0157369_100627211 | 236 |
| 41 | 3300013307 | Ga0157372_10461961 | Ga0157372_104619612 | 236 |
| 42 | 3300021361 | Ga0213872_10012842 | Ga0213872_100128424 | 236 |
| 43 | 3300025261 | Ga0209233_1004054 | Ga0209233_10040542 | 236 |
| 44 | 3300025302 | Ga0207426_1038171 | Ga0207426_10381712 | 236 |
| 45 | 3300025913 | Ga0207695_10211114 | Ga0207695_102111141 | 236 |
| 46 | 3300025919 | Ga0207657_10084831 | Ga0207657_100848312 | 236 |
| 47 | 3300025944 | Ga0207661_10082695 | Ga0207661_100826953 | 236 |
| 48 | 3300025945 | Ga0207679_10043239 | Ga0207679_100432394 | 236 |
| 49 | 3300025949 | Ga0207667_10184336 | Ga0207667_101843362 | 236 |
| 50 | 3300026023 | Ga0207677_10110330 | Ga0207677_101103302 | 236 |
| 51 | 3300026078 | Ga0207702_10011216 | Ga0207702_100112165 | 236 |
| 52 | 3300026089 | Ga0207648_10609629 | Ga0207648_106096291 | 236 |
| 53 | 3300026121 | Ga0207683_10093701 | Ga0207683_100937013 | 236 |
| 54 | 3300026142 | Ga0207698_10133761 | Ga0207698_101337612 | 236 |
| 55 | 3300027357 | Ga0209589_1000005 | Ga0209589_100000527 | 236 |
| 56 | 3300027361 | Ga0209489_100005 | Ga0209489_10000527 | 236 |
| 57 | 3300027363 | Ga0209700_100006 | Ga0209700_10000627 | 236 |
| 58 | 3300037312 | Ga0395899_0187578 | Ga0395899_0187578_474_1184 | 236 |
| 59 | 3300037418 | Ga0395900_0138852 | Ga0395900_0138852_145_855 | 236 |
| 60 | 3300038443 | Ga0395901_0050792 | Ga0395901_0050792_3498_4208 | 236 |
| 61 | 3300039447 | Ga0436361_0310679 | Ga0436361_0310679_2698_3414 | 236 |
| 62 | 3300044694 | Ga0466963_0376593 | Ga0466963_0376593_252_962 | 236 |
| 63 | 3300044842 | Ga0466957_0168354 | Ga0466957_0168354_608_1318 | 236 |
| 64 | 3300048924 | Ga0496121_0110745 | Ga0496121_0110745_1039_1749 | 236 |
| 65 | 3300049571 | Ga0501034_0001140 | Ga0501034_0001140_17964_18674 | 236 |
| 66 | 3300053139 | Ga0500568_0015427 | Ga0500568_0015427_2642_3352 | 236 |
| 67 | iso_pu_bacteria | 2917699015 | 2917704997 | 236 |
| 68 | 3300005354 | Ga0070675_100151200 | Ga0070675_1001512002 | 237 |
| 69 | 3300005445 | Ga0070708_100101537 | Ga0070708_1001015373 | 237 |
| 70 | 3300005536 | Ga0070697_100045380 | Ga0070697_1000453801 | 237 |
| 71 | 3300005548 | Ga0070665_100023733 | Ga0070665_1000237334 | 237 |
| 72 | 3300005549 | Ga0070704_100105200 | Ga0070704_1001052004 | 237 |
| 73 | 3300005563 | Ga0068855_100797259 | Ga0068855_1007972592 | 237 |
| 74 | 3300005577 | Ga0068857_100187741 | Ga0068857_1001877412 | 237 |
| 75 | 3300005937 | Ga0081455_10002921 | Ga0081455_1000292115 | 237 |
| 76 | 3300005985 | Ga0081539_10000987 | Ga0081539_1000098721 | 237 |
| 77 | 3300006038 | Ga0075365_10075004 | Ga0075365_100750042 | 237 |
| 78 | 3300006038 | Ga0075365_10398663 | Ga0075365_103986632 | 237 |
| 79 | 3300006177 | Ga0075362_10038829 | Ga0075362_100388292 | 237 |
| 80 | 3300006195 | Ga0075366_10011726 | Ga0075366_100117265 | 237 |
| 81 | 3300006844 | Ga0075428_100006328 | Ga0075428_10000632811 | 237 |
| 82 | 3300006844 | Ga0075428_100147622 | Ga0075428_1001476222 | 237 |
| 83 | 3300006844 | Ga0075428_100576434 | Ga0075428_1005764342 | 237 |
| 84 | 3300006846 | Ga0075430_100000574 | Ga0075430_10000057426 | 237 |
| 85 | 3300006846 | Ga0075430_100000927 | Ga0075430_10000092714 | 237 |
| 86 | 3300006847 | Ga0075431_100000175 | Ga0075431_10000017523 | 237 |
| 87 | 3300006847 | Ga0075431_100000339 | Ga0075431_1000003392 | 237 |
| 88 | 3300006852 | Ga0075433_10071747 | Ga0075433_100717472 | 237 |
| 89 | 3300006871 | Ga0075434_100235891 | Ga0075434_1002358915 | 237 |
| 90 | 3300006880 | Ga0075429_100000014 | Ga0075429_10000001413 | 237 |
| 91 | 3300006880 | Ga0075429_100233879 | Ga0075429_1002338792 | 237 |
| 92 | 3300006914 | Ga0075436_100047501 | Ga0075436_1000475013 | 237 |
| 93 | 3300007265 | Ga0099794_10057983 | Ga0099794_100579832 | 237 |
| 94 | 3300009147 | Ga0114129_10001148 | Ga0114129_1000114814 | 237 |
| 95 | 3300009147 | Ga0114129_10064303 | Ga0114129_100643033 | 237 |
| 96 | 3300009147 | Ga0114129_10668703 | Ga0114129_106687032 | 237 |
| 97 | 3300013104 | Ga0157370_10069916 | Ga0157370_100699164 | 237 |
| 98 | 3300013105 | Ga0157369_10358630 | Ga0157369_103586301 | 237 |
| 99 | 3300014969 | Ga0157376_10905306 | Ga0157376_109053061 | 237 |
| 100 | 3300021384 | Ga0213876_10001267 | Ga0213876_1000126711 | 237 |
| 101 | 3300021384 | Ga0213876_10046438 | Ga0213876_100464383 | 237 |
| 102 | 3300021388 | Ga0213875_10001514 | Ga0213875_100015143 | 237 |
| 103 | 3300021388 | Ga0213875_10041336 | Ga0213875_100413362 | 237 |
| 104 | 3300025304 | Ga0209257_1009440 | Ga0209257_10094402 | 237 |
| 105 | 3300027671 | Ga0209588_1103649 | Ga0209588_11036492 | 237 |
| 106 | 3300028379 | Ga0268266_10032724 | Ga0268266_100327244 | 237 |
| 107 | 3300028379 | Ga0268266_10215300 | Ga0268266_102153003 | 237 |
| 108 | 3300037312 | Ga0395899_0024705 | Ga0395899_0024705_927_1640 | 237 |
| 109 | 3300037418 | Ga0395900_0007881 | Ga0395900_0007881_6680_7393 | 237 |
| 110 | 3300037418 | Ga0395900_0091151 | Ga0395900_0091151_762_1475 | 237 |
| 111 | 3300037466 | Ga0395898_0002751 | Ga0395898_0002751_17534_18247 | 237 |
| 112 | 3300037466 | Ga0395898_0048502 | Ga0395898_0048502_3339_4052 | 237 |
| 113 | 3300037853 | Ga0436364_0227330 | Ga0436364_0227330_712_1425 | 237 |
| 114 | 3300037853 | Ga0436364_0318669 | Ga0436364_0318669_475_1188 | 237 |
| 115 | 3300038443 | Ga0395901_0280638 | Ga0395901_0280638_807_1520 | 237 |
| 116 | 3300039437 | Ga0436365_0823562 | Ga0436365_0823562_1242_1955 | 237 |
| 117 | 3300039438 | Ga0436360_0271151 | Ga0436360_0271151_915_1634 | 237 |
| 118 | 3300039450 | Ga0436363_0338563 | Ga0436363_0338563_439_1152 | 237 |
| 119 | 3300039450 | Ga0436363_0622226 | Ga0436363_0622226_34_747 | 237 |
| 120 | 3300039450 | Ga0436363_0984190 | Ga0436363_0984190_309_1022 | 237 |
| 121 | 3300039453 | Ga0436362_0239532 | Ga0436362_0239532_188_901 | 237 |
| 122 | 3300049571 | Ga0501034_0001685 | Ga0501034_0001685_8054_8767 | 237 |
| 123 | 3300049571 | Ga0501034_0065722 | Ga0501034_0065722_105_818 | 237 |
| 124 | 3300049575 | Ga0501039_0192874 | Ga0501039_0192874_187_912 | 237 |
| 125 | 3300049577 | Ga0501041_0088041 | Ga0501041_0088041_120_845 | 237 |
| 126 | 3300049584 | Ga0501068_0057900 | Ga0501068_0057900_331_1044 | 237 |
| 127 | 3300049589 | Ga0501073_0279556 | Ga0501073_0279556_338_1084 | 237 |
| 128 | 3300049591 | Ga0501075_0234951 | Ga0501075_0234951_552_1277 | 237 |
| 129 | 3300049592 | Ga0501076_0266322 | Ga0501076_0266322_520_1236 | 237 |
| 130 | 3300049823 | Ga0501044_0337049 | Ga0501044_0337049_207_953 | 237 |
| 131 | 3300050491 | nmdc:mga00v17_356875_c1 | nmdc:mga00v17_356875_c1_164_877 | 237 |
| 132 | 3300050492 | nmdc:mga0yw44_379153_c1 | nmdc:mga0yw44_379153_c1_95_808 | 237 |
| 133 | 3300050493 | nmdc:mga0k408_5510_c1 | nmdc:mga0k408_5510_c1_3137_3850 | 237 |
| 134 | 3300050494 | nmdc:mga06z11_34651_c1 | nmdc:mga06z11_34651_c1_519_1232 | 237 |
| 135 | 3300050495 | nmdc:mga04h51_74556_c1 | nmdc:mga04h51_74556_c1_36_749 | 237 |
| 136 | 3300050507 | nmdc:mga05p37_20275_c1 | nmdc:mga05p37_20275_c1_1832_2545 | 237 |
| 137 | 3300050507 | nmdc:mga05p37_333546_c1 | nmdc:mga05p37_333546_c1_124_837 | 237 |
| 138 | 3300050507 | nmdc:mga05p37_6041_c1 | nmdc:mga05p37_6041_c1_11315_12028 | 237 |
| 139 | 3300050508 | nmdc:mga09592_1873_c1 | nmdc:mga09592_1873_c1_3831_4544 | 237 |
| 140 | 3300050508 | nmdc:mga09592_201689_c1 | nmdc:mga09592_201689_c1_331_1044 | 237 |
| 141 | 3300050508 | nmdc:mga09592_233566_c1 | nmdc:mga09592_233566_c1_624_1337 | 237 |
| 142 | 3300050509 | nmdc:mga0qj67_75201_c1 | nmdc:mga0qj67_75201_c1_1581_2294 | 237 |
| 143 | 3300050509 | nmdc:mga0qj67_9465_c1 | nmdc:mga0qj67_9465_c1_6468_7181 | 237 |
| 144 | 3300050510 | nmdc:mga06r32_126179_c1 | nmdc:mga06r32_126179_c1_1743_2462 | 237 |
| 145 | 3300050510 | nmdc:mga06r32_21819_c1 | nmdc:mga06r32_21819_c1_794_1507 | 237 |
| 146 | 3300050510 | nmdc:mga06r32_28865_c1 | nmdc:mga06r32_28865_c1_4240_4953 | 237 |
| 147 | 3300050511 | nmdc:mga08y16_384379_c1 | nmdc:mga08y16_384379_c1_174_887 | 237 |
| 148 | 3300050514 | nmdc:mga08x19_41282_c1 | nmdc:mga08x19_41282_c1_1204_1920 | 237 |
| 149 | 3300005334 | Ga0068869_100059150 | Ga0068869_1000591502 | 238 |
| 150 | 3300005336 | Ga0070680_100024718 | Ga0070680_1000247184 | 238 |
| 151 | 3300005336 | Ga0070680_100076697 | Ga0070680_1000766972 | 238 |
| 152 | 3300005353 | Ga0070669_100004143 | Ga0070669_10000414311 | 238 |
| 153 | 3300005355 | Ga0070671_100352430 | Ga0070671_1003524302 | 238 |
| 154 | 3300005440 | Ga0070705_100220315 | Ga0070705_1002203152 | 238 |
| 155 | 3300005444 | Ga0070694_100046033 | Ga0070694_1000460332 | 238 |
| 156 | 3300005444 | Ga0070694_100228047 | Ga0070694_1002280472 | 238 |
| 157 | 3300005445 | Ga0070708_100002595 | Ga0070708_10000259513 | 238 |
| 158 | 3300005445 | Ga0070708_100083872 | Ga0070708_1000838724 | 238 |
| 159 | 3300005457 | Ga0070662_100505597 | Ga0070662_1005055972 | 238 |
| 160 | 3300005467 | Ga0070706_100054082 | Ga0070706_1000540824 | 238 |
| 161 | 3300005467 | Ga0070706_100384937 | Ga0070706_1003849372 | 238 |
| 162 | 3300005468 | Ga0070707_100337738 | Ga0070707_1003377382 | 238 |
| 163 | 3300005471 | Ga0070698_100152099 | Ga0070698_1001520992 | 238 |
| 164 | 3300005518 | Ga0070699_100002140 | Ga0070699_1000021406 | 238 |
| 165 | 3300005518 | Ga0070699_100022970 | Ga0070699_1000229703 | 238 |
| 166 | 3300005518 | Ga0070699_100031074 | Ga0070699_1000310744 | 238 |
| 167 | 3300005536 | Ga0070697_100000743 | Ga0070697_10000074324 | 238 |
| 168 | 3300005539 | Ga0068853_100003483 | Ga0068853_1000034835 | 238 |
| 169 | 3300005543 | Ga0070672_100099583 | Ga0070672_1000995832 | 238 |
| 170 | 3300005545 | Ga0070695_100215625 | Ga0070695_1002156251 | 238 |
| 171 | 3300005546 | Ga0070696_100094329 | Ga0070696_1000943292 | 238 |
| 172 | 3300005546 | Ga0070696_100181611 | Ga0070696_1001816112 | 238 |
| 173 | 3300005548 | Ga0070665_100301267 | Ga0070665_1003012672 | 238 |
| 174 | 3300005549 | Ga0070704_100051906 | Ga0070704_1000519062 | 238 |
| 175 | 3300005577 | Ga0068857_100015839 | Ga0068857_1000158393 | 238 |
| 176 | 3300005577 | Ga0068857_100222219 | Ga0068857_1002222192 | 238 |
| 177 | 3300005615 | Ga0070702_100257136 | Ga0070702_1002571362 | 238 |
| 178 | 3300005617 | Ga0068859_100507030 | Ga0068859_1005070302 | 238 |
| 179 | 3300005718 | Ga0068866_10026817 | Ga0068866_100268172 | 238 |
| 180 | 3300005843 | Ga0068860_100089118 | Ga0068860_1000891184 | 238 |
| 181 | 3300005844 | Ga0068862_100038664 | Ga0068862_1000386642 | 238 |
| 182 | 3300005937 | Ga0081455_10152553 | Ga0081455_101525533 | 238 |
| 183 | 3300006051 | Ga0075364_10147677 | Ga0075364_101476772 | 238 |
| 184 | 3300006058 | Ga0075432_10021510 | Ga0075432_100215102 | 238 |
| 185 | 3300006177 | Ga0075362_10051055 | Ga0075362_100510552 | 238 |
| 186 | 3300006178 | Ga0075367_10401428 | Ga0075367_104014281 | 238 |
| 187 | 3300006186 | Ga0075369_10011196 | Ga0075369_100111963 | 238 |
| 188 | 3300006186 | Ga0075369_10211558 | Ga0075369_102115581 | 238 |
| 189 | 3300006844 | Ga0075428_100004148 | Ga0075428_10000414817 | 238 |
| 190 | 3300006844 | Ga0075428_100356377 | Ga0075428_1003563772 | 238 |
| 191 | 3300006847 | Ga0075431_100000271 | Ga0075431_10000027135 | 238 |
| 192 | 3300006847 | Ga0075431_100052712 | Ga0075431_1000527122 | 238 |
| 193 | 3300006852 | Ga0075433_10021301 | Ga0075433_100213018 | 238 |
| 194 | 3300006852 | Ga0075433_10560791 | Ga0075433_105607911 | 238 |
| 195 | 3300006871 | Ga0075434_100021782 | Ga0075434_1000217825 | 238 |
| 196 | 3300006871 | Ga0075434_100056776 | Ga0075434_1000567764 | 238 |
| 197 | 3300006871 | Ga0075434_100281077 | Ga0075434_1002810772 | 238 |
| 198 | 3300006880 | Ga0075429_100012908 | Ga0075429_1000129081 | 238 |
| 199 | 3300006880 | Ga0075429_100208957 | Ga0075429_1002089572 | 238 |
| 200 | 3300006880 | Ga0075429_100357569 | Ga0075429_1003575692 | 238 |
| 201 | 3300006881 | Ga0068865_100493833 | Ga0068865_1004938332 | 238 |
| 202 | 3300006881 | Ga0068865_100575861 | Ga0068865_1005758611 | 238 |
| 203 | 3300006914 | Ga0075436_100011714 | Ga0075436_1000117144 | 238 |
| 204 | 3300006931 | Ga0097620_100507018 | Ga0097620_1005070182 | 238 |
| 205 | 3300009094 | Ga0111539_10016351 | Ga0111539_100163512 | 238 |
| 206 | 3300009094 | Ga0111539_10089708 | Ga0111539_100897083 | 238 |
| 207 | 3300009147 | Ga0114129_10000495 | Ga0114129_1000049510 | 238 |
| 208 | 3300009147 | Ga0114129_10000499 | Ga0114129_1000049940 | 238 |
| 209 | 3300009147 | Ga0114129_10318271 | Ga0114129_103182713 | 238 |
| 210 | 3300009148 | Ga0105243_10084234 | Ga0105243_100842342 | 238 |
| 211 | 3300009148 | Ga0105243_10474004 | Ga0105243_104740041 | 238 |
| 212 | 3300009174 | Ga0105241_10032631 | Ga0105241_100326312 | 238 |
| 213 | 3300009176 | Ga0105242_10034543 | Ga0105242_100345434 | 238 |
| 214 | 3300009553 | Ga0105249_10268770 | Ga0105249_102687702 | 238 |
| 215 | 3300013297 | Ga0157378_10135851 | Ga0157378_101358512 | 238 |
| 216 | 3300013306 | Ga0163162_10151029 | Ga0163162_101510292 | 238 |
| 217 | 3300013308 | Ga0157375_10081679 | Ga0157375_100816792 | 238 |
| 218 | 3300025899 | Ga0207642_10273493 | Ga0207642_102734932 | 238 |
| 219 | 3300025910 | Ga0207684_10000474 | Ga0207684_1000047424 | 238 |
| 220 | 3300025910 | Ga0207684_10049419 | Ga0207684_100494192 | 238 |
| 221 | 3300025917 | Ga0207660_10012826 | Ga0207660_100128265 | 238 |
| 222 | 3300025917 | Ga0207660_10043871 | Ga0207660_100438712 | 238 |
| 223 | 3300025922 | Ga0207646_10002578 | Ga0207646_100025788 | 238 |
| 224 | 3300025923 | Ga0207681_10031954 | Ga0207681_100319543 | 238 |
| 225 | 3300025931 | Ga0207644_10312978 | Ga0207644_103129781 | 238 |
| 226 | 3300025933 | Ga0207706_10213637 | Ga0207706_102136372 | 238 |
| 227 | 3300025934 | Ga0207686_10011545 | Ga0207686_100115454 | 238 |
| 228 | 3300025935 | Ga0207709_10047777 | Ga0207709_100477772 | 238 |
| 229 | 3300025938 | Ga0207704_10437174 | Ga0207704_104371741 | 238 |
| 230 | 3300025940 | Ga0207691_10060187 | Ga0207691_100601873 | 238 |
| 231 | 3300025942 | Ga0207689_10060382 | Ga0207689_100603822 | 238 |
| 232 | 3300025961 | Ga0207712_10126919 | Ga0207712_101269193 | 238 |
| 233 | 3300025961 | Ga0207712_10390862 | Ga0207712_103908621 | 238 |
| 234 | 3300026041 | Ga0207639_10007661 | Ga0207639_100076615 | 238 |
| 235 | 3300026089 | Ga0207648_10132385 | Ga0207648_101323852 | 238 |
| 236 | 3300026116 | Ga0207674_10010341 | Ga0207674_100103416 | 238 |
| 237 | 3300026118 | Ga0207675_100203496 | Ga0207675_1002034962 | 238 |
| 238 | 3300026142 | Ga0207698_10196498 | Ga0207698_101964982 | 238 |
| 239 | 3300027907 | Ga0207428_10007386 | Ga0207428_1000738612 | 238 |
| 240 | 3300028379 | Ga0268266_10639244 | Ga0268266_106392441 | 238 |
| 241 | 3300028380 | Ga0268265_10121191 | Ga0268265_101211912 | 238 |
| 242 | 3300028381 | Ga0268264_10086913 | Ga0268264_100869132 | 238 |
| 243 | 3300028381 | Ga0268264_10562599 | Ga0268264_105625991 | 238 |
| 244 | 3300028573 | Ga0265334_10067869 | Ga0265334_100678692 | 238 |
| 245 | 3300031548 | Ga0307408_100014069 | Ga0307408_1000140694 | 238 |
| 246 | 3300032002 | Ga0307416_100004672 | Ga0307416_1000046723 | 238 |
| 247 | 3300034817 | Ga0373948_0009901 | Ga0373948_0009901_346_1086 | 238 |
| 248 | 3300035088 | Ga0373940_0042419 | Ga0373940_0042419_397_1137 | 238 |
| 249 | 3300035691 | Ga0373931_0030939 | Ga0373931_0030939_484_1224 | 238 |
| 250 | 3300037471 | Ga0395905_0079638 | Ga0395905_0079638_752_1471 | 238 |
| 251 | 3300038996 | Ga0242420_013675 | Ga0242420_013675_26_751 | 238 |
| 252 | 3300039438 | Ga0436360_0971002 | Ga0436360_0971002_134_850 | 238 |
| 253 | 3300042876 | Ga0451577_0044704 | Ga0451577_0044704_1582_2322 | 238 |
| 254 | 3300044712 | Ga0453684_0474274 | Ga0453684_0474274_650_1369 | 238 |
| 255 | 3300046455 | Ga0495603_0055236 | Ga0495603_0055236_893_1612 | 238 |
| 256 | 3300046528 | Ga0495642_0007342 | Ga0495642_0007342_2479_3198 | 238 |
| 257 | 3300046664 | Ga0495659_0178877 | Ga0495659_0178877_86_805 | 238 |
| 258 | 3300046684 | Ga0495669_0015620 | Ga0495669_0015620_1898_2617 | 238 |
| 259 | 3300048905 | Ga0496102_0016559 | Ga0496102_0016559_4542_5282 | 238 |
| 260 | 3300048909 | Ga0496106_0137543 | Ga0496106_0137543_1016_1756 | 238 |
| 261 | 3300049570 | Ga0501033_0370570 | Ga0501033_0370570_64_795 | 238 |
| 262 | 3300049572 | Ga0501036_0000740 | Ga0501036_0000740_21552_22268 | 238 |
| 263 | 3300049572 | Ga0501036_0013100 | Ga0501036_0013100_2713_3435 | 238 |
| 264 | 3300049572 | Ga0501036_0274959 | Ga0501036_0274959_54_785 | 238 |
| 265 | 3300049572 | Ga0501036_0278751 | Ga0501036_0278751_130_846 | 238 |
| 266 | 3300049574 | Ga0501038_0345198 | Ga0501038_0345198_381_1097 | 238 |
| 267 | 3300049575 | Ga0501039_0014086 | Ga0501039_0014086_2665_3381 | 238 |
| 268 | 3300049575 | Ga0501039_0120845 | Ga0501039_0120845_1085_1801 | 238 |
| 269 | 3300049575 | Ga0501039_0409717 | Ga0501039_0409717_25_756 | 238 |
| 270 | 3300049576 | Ga0501040_0004045 | Ga0501040_0004045_1327_2043 | 238 |
| 271 | 3300049576 | Ga0501040_0078315 | Ga0501040_0078315_1406_2128 | 238 |
| 272 | 3300049577 | Ga0501041_0000154 | Ga0501041_0000154_23996_24712 | 238 |
| 273 | 3300049577 | Ga0501041_0005047 | Ga0501041_0005047_972_1694 | 238 |
| 274 | 3300049577 | Ga0501041_0046269 | Ga0501041_0046269_655_1377 | 238 |
| 275 | 3300049578 | Ga0501042_0003231 | Ga0501042_0003231_3539_4255 | 238 |
| 276 | 3300049578 | Ga0501042_0045957 | Ga0501042_0045957_2293_3015 | 238 |
| 277 | 3300049578 | Ga0501042_0447690 | Ga0501042_0447690_118_840 | 238 |
| 278 | 3300049580 | Ga0501046_0001642 | Ga0501046_0001642_15717_16433 | 238 |
| 279 | 3300049580 | Ga0501046_0037932 | Ga0501046_0037932_2156_2887 | 238 |
| 280 | 3300049582 | Ga0501048_0030937 | Ga0501048_0030937_3107_3829 | 238 |
| 281 | 3300049582 | Ga0501048_0057693 | Ga0501048_0057693_1776_2492 | 238 |
| 282 | 3300049582 | Ga0501048_0103919 | Ga0501048_0103919_1003_1725 | 238 |
| 283 | 3300049582 | Ga0501048_0325381 | Ga0501048_0325381_315_1031 | 238 |
| 284 | 3300049584 | Ga0501068_0066216 | Ga0501068_0066216_622_1344 | 238 |
| 285 | 3300049586 | Ga0501070_0136797 | Ga0501070_0136797_656_1372 | 238 |
| 286 | 3300049587 | Ga0501071_0000173 | Ga0501071_0000173_24006_24722 | 238 |
| 287 | 3300049587 | Ga0501071_0017840 | Ga0501071_0017840_3990_4721 | 238 |
| 288 | 3300049587 | Ga0501071_0381036 | Ga0501071_0381036_87_809 | 238 |
| 289 | 3300049588 | Ga0501072_0002324 | Ga0501072_0002324_1010_1726 | 238 |
| 290 | 3300049588 | Ga0501072_0002838 | Ga0501072_0002838_3954_4676 | 238 |
| 291 | 3300049588 | Ga0501072_0011898 | Ga0501072_0011898_413_1159 | 238 |
| 292 | 3300049588 | Ga0501072_0046114 | Ga0501072_0046114_2345_3076 | 238 |
| 293 | 3300049590 | Ga0501074_0015859 | Ga0501074_0015859_1595_2311 | 238 |
| 294 | 3300049591 | Ga0501075_0001228 | Ga0501075_0001228_7455_8177 | 238 |
| 295 | 3300049591 | Ga0501075_0006614 | Ga0501075_0006614_6045_6761 | 238 |
| 296 | 3300049591 | Ga0501075_0159617 | Ga0501075_0159617_509_1255 | 238 |
| 297 | 3300049592 | Ga0501076_0000135 | Ga0501076_0000135_18302_19024 | 238 |
| 298 | 3300049592 | Ga0501076_0002854 | Ga0501076_0002854_5422_6138 | 238 |
| 299 | 3300049592 | Ga0501076_0021802 | Ga0501076_0021802_3919_4635 | 238 |
| 300 | 3300049592 | Ga0501076_0068475 | Ga0501076_0068475_1612_2343 | 238 |
| 301 | 3300049592 | Ga0501076_0231385 | Ga0501076_0231385_45_767 | 238 |
| 302 | 3300049593 | Ga0501077_0005576 | Ga0501077_0005576_6206_6922 | 238 |
| 303 | 3300049593 | Ga0501077_0008116 | Ga0501077_0008116_4938_5654 | 238 |
| 304 | 3300049682 | Ga0501252_002363 | Ga0501252_002363_525_1241 | 238 |
| 305 | 3300049741 | Ga0501079_0003115 | Ga0501079_0003115_8901_9617 | 238 |
| 306 | 3300049741 | Ga0501079_0011877 | Ga0501079_0011877_3632_4348 | 238 |
| 307 | 3300049741 | Ga0501079_0132854 | Ga0501079_0132854_981_1703 | 238 |
| 308 | 3300049742 | Ga0501080_0036955 | Ga0501080_0036955_3270_3992 | 238 |
| 309 | 3300049742 | Ga0501080_0132273 | Ga0501080_0132273_1235_1966 | 238 |
| 310 | 3300049743 | Ga0501081_0004835 | Ga0501081_0004835_5657_6379 | 238 |
| 311 | 3300049743 | Ga0501081_0007773 | Ga0501081_0007773_1536_2252 | 238 |
| 312 | 3300049743 | Ga0501081_0044350 | Ga0501081_0044350_815_1537 | 238 |
| 313 | 3300049743 | Ga0501081_0077906 | Ga0501081_0077906_859_1590 | 238 |
| 314 | 3300049743 | Ga0501081_0210185 | Ga0501081_0210185_375_1097 | 238 |
| 315 | 3300049822 | Ga0501035_0005442 | Ga0501035_0005442_2369_3085 | 238 |
| 316 | 3300049822 | Ga0501035_0227768 | Ga0501035_0227768_163_885 | 238 |
| 317 | 3300049824 | Ga0501045_0000153 | Ga0501045_0000153_5878_6594 | 238 |
| 318 | 3300049824 | Ga0501045_0013066 | Ga0501045_0013066_1265_1987 | 238 |
| 319 | 3300049824 | Ga0501045_0026662 | Ga0501045_0026662_2210_2941 | 238 |
| 320 | 3300049824 | Ga0501045_0070475 | Ga0501045_0070475_1650_2372 | 238 |
| 321 | 3300050489 | nmdc:mga03683_6935_c1 | nmdc:mga03683_6935_c1_545_1261 | 238 |
| 322 | 3300050494 | nmdc:mga06z11_41643_c1 | nmdc:mga06z11_41643_c1_1482_2198 | 238 |
| 323 | 3300050496 | nmdc:mga07m45_63284_c1 | nmdc:mga07m45_63284_c1_360_1076 | 238 |
| 324 | 3300050507 | nmdc:mga05p37_105117_c1 | nmdc:mga05p37_105117_c1_10_732 | 238 |
| 325 | 3300050507 | nmdc:mga05p37_319043_c1 | nmdc:mga05p37_319043_c1_941_1660 | 238 |
| 326 | 3300050507 | nmdc:mga05p37_3580_c1 | nmdc:mga05p37_3580_c1_10449_11168 | 238 |
| 327 | 3300050508 | nmdc:mga09592_13704_c1 | nmdc:mga09592_13704_c1_98_817 | 238 |
| 328 | 3300050508 | nmdc:mga09592_340028_c1 | nmdc:mga09592_340028_c1_365_1084 | 238 |
| 329 | 3300050508 | nmdc:mga09592_410429_c1 | nmdc:mga09592_410429_c1_61_780 | 238 |
| 330 | 3300050509 | nmdc:mga0qj67_211891_c1 | nmdc:mga0qj67_211891_c1_420_1136 | 238 |
| 331 | 3300050510 | nmdc:mga06r32_3977_c1 | nmdc:mga06r32_3977_c1_4064_4783 | 238 |
| 332 | 3300050510 | nmdc:mga06r32_97261_c1 | nmdc:mga06r32_97261_c1_2084_2800 | 238 |
| 333 | 3300050511 | nmdc:mga08y16_332657_c1 | nmdc:mga08y16_332657_c1_732_1460 | 238 |
| 334 | 3300050511 | nmdc:mga08y16_3338_c1 | nmdc:mga08y16_3338_c1_6658_7377 | 238 |
| 335 | 3300050512 | nmdc:mga0n895_102283_c1 | nmdc:mga0n895_102283_c1_987_1706 | 238 |
| 336 | 3300050512 | nmdc:mga0n895_19871_c1 | nmdc:mga0n895_19871_c1_3811_4527 | 238 |
| 337 | 3300050512 | nmdc:mga0n895_640810_c1 | nmdc:mga0n895_640810_c1_36_755 | 238 |
| 338 | 3300050513 | nmdc:mga0rr50_47342_c1 | nmdc:mga0rr50_47342_c1_784_1503 | 238 |
| 339 | 3300050514 | nmdc:mga08x19_30611_c1 | nmdc:mga08x19_30611_c1_656_1375 | 238 |
| 340 | 3300050514 | nmdc:mga08x19_43508_c1 | nmdc:mga08x19_43508_c1_1804_2520 | 238 |
| 341 | 3300050515 | nmdc:mga0a205_149209_c2 | nmdc:mga0a205_149209_c2_50_766 | 238 |
| 342 | 3300050515 | nmdc:mga0a205_548789_c1 | nmdc:mga0a205_548789_c1_223_942 | 238 |
| 343 | 3300050515 | nmdc:mga0a205_5638_c1 | nmdc:mga0a205_5638_c1_3155_3874 | 238 |
| 344 | 3300050516 | nmdc:mga0sz30_272_c1 | nmdc:mga0sz30_272_c1_9100_9816 | 238 |
| 345 | 3300053153 | Ga0500616_0000049 | Ga0500616_0000049_257796_258512 | 238 |
| 346 | 3300054114 | Ga0501084_0007572 | Ga0501084_0007572_5153_5875 | 238 |
| 347 | 3300054114 | Ga0501084_0019931 | Ga0501084_0019931_1480_2196 | 238 |
| 348 | 3300054114 | Ga0501084_0077367 | Ga0501084_0077367_1762_2493 | 238 |
| 349 | 3300054114 | Ga0501084_0451588 | Ga0501084_0451588_77_823 | 238 |
| 350 | 3300054114 | Ga0501084_0496376 | Ga0501084_0496376_119_841 | 238 |
| 351 | 3300060353 | Ga0501082_0002472 | Ga0501082_0002472_290_1006 | 238 |
| 352 | 3300060353 | Ga0501082_0004029 | Ga0501082_0004029_2730_3452 | 238 |
| 353 | 3300060353 | Ga0501082_0023316 | Ga0501082_0023316_1691_2407 | 238 |
| 354 | 3300060353 | Ga0501082_0146411 | Ga0501082_0146411_292_1014 | 238 |
| 355 | 3300060353 | Ga0501082_0174168 | Ga0501082_0174168_1074_1820 | 238 |
| 356 | 3300061734 | Ga0530510_0000111 | Ga0530510_0000111_18247_18969 | 238 |
| 357 | 3300061734 | Ga0530510_0007660 | Ga0530510_0007660_721_1437 | 238 |
| 358 | 3300061734 | Ga0530510_0412896 | Ga0530510_0412896_16_762 | 238 |
| 359 | iso_pu_bacteria | 2844533157 | 2844539196 | 238 |
| 360 | 3300003187 | JGI25151J46595_10058202 | JGI25151J46595_100582022 | 239 |
| 361 | 3300004625 | Ga0055543_1019236 | Ga0055543_10192362 | 239 |
| 362 | 3300005262 | Ga0065165_1000048 | Ga0065165_1000048110 | 239 |
| 363 | 3300005293 | Ga0065715_10118382 | Ga0065715_101183822 | 239 |
| 364 | 3300005327 | Ga0070658_10001208 | Ga0070658_1000120818 | 239 |
| 365 | 3300005328 | Ga0070676_10001167 | Ga0070676_100011674 | 239 |
| 366 | 3300005330 | Ga0070690_100046364 | Ga0070690_1000463642 | 239 |
| 367 | 3300005331 | Ga0070670_100006723 | Ga0070670_1000067232 | 239 |
| 368 | 3300005333 | Ga0070677_10055435 | Ga0070677_100554353 | 239 |
| 369 | 3300005334 | Ga0068869_100003093 | Ga0068869_1000030938 | 239 |
| 370 | 3300005336 | Ga0070680_100000881 | Ga0070680_10000088116 | 239 |
| 371 | 3300005336 | Ga0070680_100240392 | Ga0070680_1002403922 | 239 |
| 372 | 3300005337 | Ga0070682_100001651 | Ga0070682_1000016518 | 239 |
| 373 | 3300005338 | Ga0068868_100157278 | Ga0068868_1001572783 | 239 |
| 374 | 3300005339 | Ga0070660_100001614 | Ga0070660_10000161414 | 239 |
| 375 | 3300005339 | Ga0070660_100025586 | Ga0070660_1000255863 | 239 |
| 376 | 3300005340 | Ga0070689_100089964 | Ga0070689_1000899641 | 239 |
| 377 | 3300005341 | Ga0070691_10010959 | Ga0070691_100109595 | 239 |
| 378 | 3300005341 | Ga0070691_10016601 | Ga0070691_100166015 | 239 |
| 379 | 3300005344 | Ga0070661_100001126 | Ga0070661_10000112614 | 239 |
| 380 | 3300005345 | Ga0070692_10000047 | Ga0070692_100000474 | 239 |
| 381 | 3300005364 | Ga0070673_100375905 | Ga0070673_1003759052 | 239 |
| 382 | 3300005406 | Ga0070703_10001203 | Ga0070703_100012031 | 239 |
| 383 | 3300005436 | Ga0070713_100047920 | Ga0070713_1000479202 | 239 |
| 384 | 3300005440 | Ga0070705_100000623 | Ga0070705_10000062315 | 239 |
| 385 | 3300005441 | Ga0070700_100018903 | Ga0070700_1000189032 | 239 |
| 386 | 3300005444 | Ga0070694_100000022 | Ga0070694_10000002221 | 239 |
| 387 | 3300005444 | Ga0070694_100000244 | Ga0070694_10000024427 | 239 |
| 388 | 3300005445 | Ga0070708_100025356 | Ga0070708_1000253564 | 239 |
| 389 | 3300005445 | Ga0070708_100036349 | Ga0070708_1000363496 | 239 |
| 390 | 3300005445 | Ga0070708_100188995 | Ga0070708_1001889954 | 239 |
| 391 | 3300005445 | Ga0070708_100224455 | Ga0070708_1002244553 | 239 |
| 392 | 3300005445 | Ga0070708_100288687 | Ga0070708_1002886873 | 239 |
| 393 | 3300005455 | Ga0070663_100008205 | Ga0070663_1000082053 | 239 |
| 394 | 3300005457 | Ga0070662_100096758 | Ga0070662_1000967583 | 239 |
| 395 | 3300005458 | Ga0070681_10004747 | Ga0070681_100047472 | 239 |
| 396 | 3300005459 | Ga0068867_100072657 | Ga0068867_1000726572 | 239 |
| 397 | 3300005467 | Ga0070706_100003723 | Ga0070706_10000372315 | 239 |
| 398 | 3300005467 | Ga0070706_100034717 | Ga0070706_1000347174 | 239 |
| 399 | 3300005467 | Ga0070706_100050813 | Ga0070706_1000508133 | 239 |
| 400 | 3300005468 | Ga0070707_100018242 | Ga0070707_1000182425 | 239 |
| 401 | 3300005468 | Ga0070707_100075704 | Ga0070707_1000757042 | 239 |
| 402 | 3300005468 | Ga0070707_100213781 | Ga0070707_1002137813 | 239 |
| 403 | 3300005471 | Ga0070698_100003867 | Ga0070698_1000038678 | 239 |
| 404 | 3300005471 | Ga0070698_100029931 | Ga0070698_1000299312 | 239 |
| 405 | 3300005471 | Ga0070698_100162427 | Ga0070698_1001624271 | 239 |
| 406 | 3300005518 | Ga0070699_100007483 | Ga0070699_1000074837 | 239 |
| 407 | 3300005518 | Ga0070699_100019236 | Ga0070699_1000192367 | 239 |
| 408 | 3300005518 | Ga0070699_100119439 | Ga0070699_1001194393 | 239 |
| 409 | 3300005530 | Ga0070679_100005357 | Ga0070679_1000053575 | 239 |
| 410 | 3300005535 | Ga0070684_100100822 | Ga0070684_1001008222 | 239 |
| 411 | 3300005536 | Ga0070697_100008556 | Ga0070697_1000085563 | 239 |
| 412 | 3300005536 | Ga0070697_100022147 | Ga0070697_1000221477 | 239 |
| 413 | 3300005536 | Ga0070697_100152159 | Ga0070697_1001521592 | 239 |
| 414 | 3300005536 | Ga0070697_100225132 | Ga0070697_1002251322 | 239 |
| 415 | 3300005536 | Ga0070697_100269805 | Ga0070697_1002698052 | 239 |
| 416 | 3300005539 | Ga0068853_100001043 | Ga0068853_10000104314 | 239 |
| 417 | 3300005545 | Ga0070695_100000263 | Ga0070695_10000026327 | 239 |
| 418 | 3300005545 | Ga0070695_100000944 | Ga0070695_10000094415 | 239 |
| 419 | 3300005547 | Ga0070693_100008567 | Ga0070693_1000085676 | 239 |
| 420 | 3300005549 | Ga0070704_100004243 | Ga0070704_10000424310 | 239 |
| 421 | 3300005549 | Ga0070704_100147296 | Ga0070704_1001472962 | 239 |
| 422 | 3300005563 | Ga0068855_100000101 | Ga0068855_10000010126 | 239 |
| 423 | 3300005563 | Ga0068855_100007903 | Ga0068855_1000079032 | 239 |
| 424 | 3300005564 | Ga0070664_100021688 | Ga0070664_1000216885 | 239 |
| 425 | 3300005577 | Ga0068857_100118819 | Ga0068857_1001188193 | 239 |
| 426 | 3300005578 | Ga0068854_100000873 | Ga0068854_10000087312 | 239 |
| 427 | 3300005615 | Ga0070702_100030196 | Ga0070702_1000301964 | 239 |
| 428 | 3300005616 | Ga0068852_100141361 | Ga0068852_1001413613 | 239 |
| 429 | 3300005617 | Ga0068859_100037661 | Ga0068859_1000376612 | 239 |
| 430 | 3300005618 | Ga0068864_100050707 | Ga0068864_1000507074 | 239 |
| 431 | 3300005719 | Ga0068861_100023552 | Ga0068861_1000235525 | 239 |
| 432 | 3300005840 | Ga0068870_10000613 | Ga0068870_1000061314 | 239 |
| 433 | 3300005841 | Ga0068863_100004816 | Ga0068863_1000048167 | 239 |
| 434 | 3300005842 | Ga0068858_100112957 | Ga0068858_1001129572 | 239 |
| 435 | 3300005842 | Ga0068858_100137006 | Ga0068858_1001370063 | 239 |
| 436 | 3300005843 | Ga0068860_100003258 | Ga0068860_1000032584 | 239 |
| 437 | 3300005843 | Ga0068860_100085725 | Ga0068860_1000857253 | 239 |
| 438 | 3300005844 | Ga0068862_100001978 | Ga0068862_10000197815 | 239 |
| 439 | 3300005844 | Ga0068862_100799684 | Ga0068862_1007996841 | 239 |
| 440 | 3300005937 | Ga0081455_10000576 | Ga0081455_1000057641 | 239 |
| 441 | 3300005937 | Ga0081455_10038375 | Ga0081455_100383754 | 239 |
| 442 | 3300005937 | Ga0081455_10068407 | Ga0081455_100684074 | 239 |
| 443 | 3300006028 | Ga0070717_10247408 | Ga0070717_102474082 | 239 |
| 444 | 3300006048 | Ga0075363_100098168 | Ga0075363_1000981682 | 239 |
| 445 | 3300006173 | Ga0070716_100029371 | Ga0070716_1000293712 | 239 |
| 446 | 3300006175 | Ga0070712_100189853 | Ga0070712_1001898532 | 239 |
| 447 | 3300006177 | Ga0075362_10002293 | Ga0075362_100022936 | 239 |
| 448 | 3300006177 | Ga0075362_10031783 | Ga0075362_100317833 | 239 |
| 449 | 3300006177 | Ga0075362_10050819 | Ga0075362_100508192 | 239 |
| 450 | 3300006177 | Ga0075362_10059779 | Ga0075362_100597793 | 239 |
| 451 | 3300006178 | Ga0075367_10021536 | Ga0075367_100215364 | 239 |
| 452 | 3300006178 | Ga0075367_10056350 | Ga0075367_100563502 | 239 |
| 453 | 3300006178 | Ga0075367_10127635 | Ga0075367_101276352 | 239 |
| 454 | 3300006178 | Ga0075367_10291797 | Ga0075367_102917972 | 239 |
| 455 | 3300006186 | Ga0075369_10004309 | Ga0075369_100043096 | 239 |
| 456 | 3300006195 | Ga0075366_10144679 | Ga0075366_101446792 | 239 |
| 457 | 3300006195 | Ga0075366_10194890 | Ga0075366_101948901 | 239 |
| 458 | 3300006844 | Ga0075428_100001995 | Ga0075428_10000199512 | 239 |
| 459 | 3300006846 | Ga0075430_100150717 | Ga0075430_1001507172 | 239 |
| 460 | 3300006847 | Ga0075431_100001571 | Ga0075431_1000015714 | 239 |
| 461 | 3300006847 | Ga0075431_100144139 | Ga0075431_1001441394 | 239 |
| 462 | 3300006847 | Ga0075431_100448801 | Ga0075431_1004488012 | 239 |
| 463 | 3300006852 | Ga0075433_10193644 | Ga0075433_101936441 | 239 |
| 464 | 3300006871 | Ga0075434_100047586 | Ga0075434_1000475863 | 239 |
| 465 | 3300006871 | Ga0075434_100209947 | Ga0075434_1002099472 | 239 |
| 466 | 3300006914 | Ga0075436_100020488 | Ga0075436_1000204884 | 239 |
| 467 | 3300006914 | Ga0075436_100033909 | Ga0075436_1000339092 | 239 |
| 468 | 3300006914 | Ga0075436_100112309 | Ga0075436_1001123092 | 239 |
| 469 | 3300006914 | Ga0075436_100177108 | Ga0075436_1001771082 | 239 |
| 470 | 3300006931 | Ga0097620_100037661 | Ga0097620_1000376612 | 239 |
| 471 | 3300007076 | Ga0075435_100066579 | Ga0075435_1000665792 | 239 |
| 472 | 3300007265 | Ga0099794_10006090 | Ga0099794_100060906 | 239 |
| 473 | 3300007265 | Ga0099794_10045817 | Ga0099794_100458172 | 239 |
| 474 | 3300007265 | Ga0099794_10134330 | Ga0099794_101343302 | 239 |
| 475 | 3300009093 | Ga0105240_10294310 | Ga0105240_102943102 | 239 |
| 476 | 3300009098 | Ga0105245_10782788 | Ga0105245_107827882 | 239 |
| 477 | 3300009147 | Ga0114129_10000312 | Ga0114129_1000031238 | 239 |
| 478 | 3300009147 | Ga0114129_10274334 | Ga0114129_102743343 | 239 |
| 479 | 3300009174 | Ga0105241_10004528 | Ga0105241_100045285 | 239 |
| 480 | 3300009988 | Ga0105035_102227 | Ga0105035_1022271 | 239 |
| 481 | 3300010375 | Ga0105239_10451528 | Ga0105239_104515283 | 239 |
| 482 | 3300013104 | Ga0157370_10239321 | Ga0157370_102393212 | 239 |
| 483 | 3300013105 | Ga0157369_10620372 | Ga0157369_106203722 | 239 |
| 484 | 3300013307 | Ga0157372_10002694 | Ga0157372_1000269410 | 239 |
| 485 | 3300013308 | Ga0157375_11068416 | Ga0157375_110684162 | 239 |
| 486 | 3300013875 | Ga0157515_150309 | Ga0157515_1503092 | 239 |
| 487 | 3300014325 | Ga0163163_10354808 | Ga0163163_103548081 | 239 |
| 488 | 3300014497 | Ga0182008_10049381 | Ga0182008_100493812 | 239 |
| 489 | 3300020070 | Ga0206356_10052660 | Ga0206356_100526602 | 239 |
| 490 | 3300020082 | Ga0206353_11152514 | Ga0206353_111525144 | 239 |
| 491 | 3300021441 | Ga0213871_10030255 | Ga0213871_100302552 | 239 |
| 492 | 3300025284 | Ga0209130_1000071 | Ga0209130_100007192 | 239 |
| 493 | 3300025291 | Ga0209675_1000682 | Ga0209675_10006825 | 239 |
| 494 | 3300025294 | Ga0209025_1009442 | Ga0209025_10094426 | 239 |
| 495 | 3300025302 | Ga0207426_1007694 | Ga0207426_10076942 | 239 |
| 496 | 3300025885 | Ga0207653_10006803 | Ga0207653_100068031 | 239 |
| 497 | 3300025885 | Ga0207653_10011782 | Ga0207653_100117822 | 239 |
| 498 | 3300025893 | Ga0207682_10026606 | Ga0207682_100266062 | 239 |
| 499 | 3300025906 | Ga0207699_10112155 | Ga0207699_101121553 | 239 |
| 500 | 3300025907 | Ga0207645_10000268 | Ga0207645_1000026838 | 239 |
| 501 | 3300025908 | Ga0207643_10000144 | Ga0207643_1000014443 | 239 |
| 502 | 3300025909 | Ga0207705_10145539 | Ga0207705_101455392 | 239 |
| 503 | 3300025910 | Ga0207684_10078456 | Ga0207684_100784562 | 239 |
| 504 | 3300025910 | Ga0207684_10087776 | Ga0207684_100877763 | 239 |
| 505 | 3300025911 | Ga0207654_10007511 | Ga0207654_100075112 | 239 |
| 506 | 3300025912 | Ga0207707_10000250 | Ga0207707_100002502 | 239 |
| 507 | 3300025912 | Ga0207707_10222483 | Ga0207707_102224833 | 239 |
| 508 | 3300025912 | Ga0207707_10353856 | Ga0207707_103538562 | 239 |
| 509 | 3300025913 | Ga0207695_10242073 | Ga0207695_102420732 | 239 |
| 510 | 3300025915 | Ga0207693_10169832 | Ga0207693_101698323 | 239 |
| 511 | 3300025917 | Ga0207660_10000341 | Ga0207660_1000034122 | 239 |
| 512 | 3300025917 | Ga0207660_10086586 | Ga0207660_100865863 | 239 |
| 513 | 3300025917 | Ga0207660_10254706 | Ga0207660_102547062 | 239 |
| 514 | 3300025918 | Ga0207662_10025182 | Ga0207662_100251822 | 239 |
| 515 | 3300025919 | Ga0207657_10012232 | Ga0207657_100122325 | 239 |
| 516 | 3300025920 | Ga0207649_10103349 | Ga0207649_101033493 | 239 |
| 517 | 3300025921 | Ga0207652_10000757 | Ga0207652_1000075728 | 239 |
| 518 | 3300025921 | Ga0207652_10004986 | Ga0207652_100049863 | 239 |
| 519 | 3300025922 | Ga0207646_10016668 | Ga0207646_100166682 | 239 |
| 520 | 3300025922 | Ga0207646_10020279 | Ga0207646_100202795 | 239 |
| 521 | 3300025922 | Ga0207646_10104521 | Ga0207646_101045212 | 239 |
| 522 | 3300025922 | Ga0207646_10180982 | Ga0207646_101809824 | 239 |
| 523 | 3300025925 | Ga0207650_10005652 | Ga0207650_1000565210 | 239 |
| 524 | 3300025928 | Ga0207700_10109043 | Ga0207700_101090433 | 239 |
| 525 | 3300025932 | Ga0207690_10004563 | Ga0207690_100045636 | 239 |
| 526 | 3300025933 | Ga0207706_10004278 | Ga0207706_100042787 | 239 |
| 527 | 3300025934 | Ga0207686_10729581 | Ga0207686_107295811 | 239 |
| 528 | 3300025936 | Ga0207670_10063383 | Ga0207670_100633832 | 239 |
| 529 | 3300025938 | Ga0207704_10265460 | Ga0207704_102654601 | 239 |
| 530 | 3300025939 | Ga0207665_10018644 | Ga0207665_100186442 | 239 |
| 531 | 3300025940 | Ga0207691_10256157 | Ga0207691_102561572 | 239 |
| 532 | 3300025942 | Ga0207689_10000005 | Ga0207689_1000000541 | 239 |
| 533 | 3300025945 | Ga0207679_10000273 | Ga0207679_1000027322 | 239 |
| 534 | 3300025949 | Ga0207667_10001037 | Ga0207667_1000103710 | 239 |
| 535 | 3300025949 | Ga0207667_10009236 | Ga0207667_100092362 | 239 |
| 536 | 3300025981 | Ga0207640_10003690 | Ga0207640_100036909 | 239 |
| 537 | 3300026035 | Ga0207703_10216802 | Ga0207703_102168022 | 239 |
| 538 | 3300026041 | Ga0207639_10002730 | Ga0207639_1000273012 | 239 |
| 539 | 3300026067 | Ga0207678_10004745 | Ga0207678_100047459 | 239 |
| 540 | 3300026075 | Ga0207708_10367024 | Ga0207708_103670241 | 239 |
| 541 | 3300026078 | Ga0207702_10000385 | Ga0207702_1000038535 | 239 |
| 542 | 3300026088 | Ga0207641_10326461 | Ga0207641_103264612 | 239 |
| 543 | 3300026089 | Ga0207648_10000434 | Ga0207648_1000043423 | 239 |
| 544 | 3300026095 | Ga0207676_10110161 | Ga0207676_101101612 | 239 |
| 545 | 3300026116 | Ga0207674_10000673 | Ga0207674_100006738 | 239 |
| 546 | 3300026118 | Ga0207675_100050791 | Ga0207675_1000507915 | 239 |
| 547 | 3300026142 | Ga0207698_10098969 | Ga0207698_100989692 | 239 |
| 548 | 3300028380 | Ga0268265_10003299 | Ga0268265_1000329912 | 239 |
| 549 | 3300028381 | Ga0268264_10022305 | Ga0268264_100223053 | 239 |
| 550 | 3300028381 | Ga0268264_10041016 | Ga0268264_100410165 | 239 |
| 551 | 3300031649 | Ga0307514_10000225 | Ga0307514_1000022563 | 239 |
| 552 | 3300031852 | Ga0307410_10020475 | Ga0307410_100204753 | 239 |
| 553 | 3300034820 | Ga0373959_0009702 | Ga0373959_0009702_475_1200 | 239 |
| 554 | 3300035090 | Ga0373949_0036575 | Ga0373949_0036575_234_959 | 239 |
| 555 | 3300035112 | Ga0373932_0025953 | Ga0373932_0025953_102_821 | 239 |
| 556 | 3300035115 | Ga0373941_0073816 | Ga0373941_0073816_387_1106 | 239 |
| 557 | 3300037312 | Ga0395899_0006315 | Ga0395899_0006315_7618_8337 | 239 |
| 558 | 3300037418 | Ga0395900_0144124 | Ga0395900_0144124_1097_1816 | 239 |
| 559 | 3300038443 | Ga0395901_0001952 | Ga0395901_0001952_17456_18175 | 239 |
| 560 | 3300039438 | Ga0436360_0295164 | Ga0436360_0295164_2484_3203 | 239 |
| 561 | 3300039447 | Ga0436361_0647554 | Ga0436361_0647554_353_1072 | 239 |
| 562 | 3300042004 | Ga0439445_0094398 | Ga0439445_0094398_103_831 | 239 |
| 563 | 3300042005 | Ga0439448_0002205 | Ga0439448_0002205_2133_2858 | 239 |
| 564 | 3300042461 | Ga0439460_0090077 | Ga0439460_0090077_229_948 | 239 |
| 565 | 3300042876 | Ga0451577_0191220 | Ga0451577_0191220_667_1392 | 239 |
| 566 | 3300045051 | Ga0451576_0196097 | Ga0451576_0196097_1089_1814 | 239 |
| 567 | 3300045051 | Ga0451576_0236908 | Ga0451576_0236908_396_1115 | 239 |
| 568 | 3300045051 | Ga0451576_0406536 | Ga0451576_0406536_201_926 | 239 |
| 569 | 3300045051 | Ga0451576_0575409 | Ga0451576_0575409_365_1090 | 239 |
| 570 | 3300046472 | Ga0495580_0032563 | Ga0495580_0032563_903_1628 | 239 |
| 571 | 3300048909 | Ga0496106_0459290 | Ga0496106_0459290_40_765 | 239 |
| 572 | 3300048915 | Ga0496112_0079049 | Ga0496112_0079049_1290_2015 | 239 |
| 573 | 3300048929 | Ga0496126_0177802 | Ga0496126_0177802_1047_1772 | 239 |
| 574 | 3300049571 | Ga0501034_0224682 | Ga0501034_0224682_999_1727 | 239 |
| 575 | 3300049577 | Ga0501041_0091658 | Ga0501041_0091658_911_1630 | 239 |
| 576 | 3300049580 | Ga0501046_0448791 | Ga0501046_0448791_127_846 | 239 |
| 577 | 3300049585 | Ga0501069_0131961 | Ga0501069_0131961_372_1097 | 239 |
| 578 | 3300049588 | Ga0501072_0033115 | Ga0501072_0033115_421_1140 | 239 |
| 579 | 3300049591 | Ga0501075_0019621 | Ga0501075_0019621_586_1305 | 239 |
| 580 | 3300049591 | Ga0501075_0137087 | Ga0501075_0137087_969_1688 | 239 |
| 581 | 3300049592 | Ga0501076_0211112 | Ga0501076_0211112_17_736 | 239 |
| 582 | 3300049593 | Ga0501077_0142985 | Ga0501077_0142985_357_1076 | 239 |
| 583 | 3300049741 | Ga0501079_0173721 | Ga0501079_0173721_878_1597 | 239 |
| 584 | 3300049823 | Ga0501044_0035461 | Ga0501044_0035461_2122_2859 | 239 |
| 585 | 3300049824 | Ga0501045_0464633 | Ga0501045_0464633_107_826 | 239 |
| 586 | 3300050489 | nmdc:mga03683_25069_c1 | nmdc:mga03683_25069_c1_883_1602 | 239 |
| 587 | 3300050489 | nmdc:mga03683_7969_c1 | nmdc:mga03683_7969_c1_2616_3341 | 239 |
| 588 | 3300050490 | nmdc:mga03n38_68446_c1 | nmdc:mga03n38_68446_c1_682_1401 | 239 |
| 589 | 3300050492 | nmdc:mga0yw44_4280_c1 | nmdc:mga0yw44_4280_c1_4946_5683 | 239 |
| 590 | 3300050492 | nmdc:mga0yw44_92068_c1 | nmdc:mga0yw44_92068_c1_495_1214 | 239 |
| 591 | 3300050493 | nmdc:mga0k408_15888_c1 | nmdc:mga0k408_15888_c1_2660_3379 | 239 |
| 592 | 3300050493 | nmdc:mga0k408_86625_c2 | nmdc:mga0k408_86625_c2_393_1112 | 239 |
| 593 | 3300050494 | nmdc:mga06z11_152879_c1 | nmdc:mga06z11_152879_c1_103_822 | 239 |
| 594 | 3300050494 | nmdc:mga06z11_187045_c1 | nmdc:mga06z11_187045_c1_18_737 | 239 |
| 595 | 3300050507 | nmdc:mga05p37_338913_c1 | nmdc:mga05p37_338913_c1_28_753 | 239 |
| 596 | 3300050507 | nmdc:mga05p37_339490_c1 | nmdc:mga05p37_339490_c1_347_1072 | 239 |
| 597 | 3300050509 | nmdc:mga0qj67_28307_c1 | nmdc:mga0qj67_28307_c1_1110_1835 | 239 |
| 598 | 3300050510 | nmdc:mga06r32_3203_c1 | nmdc:mga06r32_3203_c1_591_1316 | 239 |
| 599 | 3300050512 | nmdc:mga0n895_175649_c1 | nmdc:mga0n895_175649_c1_440_1165 | 239 |
| 600 | 3300050512 | nmdc:mga0n895_31187_c1 | nmdc:mga0n895_31187_c1_482_1207 | 239 |
| 601 | 3300050513 | nmdc:mga0rr50_87989_c1 | nmdc:mga0rr50_87989_c1_1627_2352 | 239 |
| 602 | 3300050514 | nmdc:mga08x19_102637_c1 | nmdc:mga08x19_102637_c1_560_1279 | 239 |
| 603 | 3300050514 | nmdc:mga08x19_325116_c1 | nmdc:mga08x19_325116_c1_153_878 | 239 |
| 604 | 3300050515 | nmdc:mga0a205_209357_c1 | nmdc:mga0a205_209357_c1_1009_1734 | 239 |
| 605 | 3300050515 | nmdc:mga0a205_98488_c1 | nmdc:mga0a205_98488_c1_1617_2342 | 239 |
| 606 | 3300050516 | nmdc:mga0sz30_16023_c1 | nmdc:mga0sz30_16023_c1_1511_2230 | 239 |
| 607 | 3300050516 | nmdc:mga0sz30_29192_c1 | nmdc:mga0sz30_29192_c1_652_1371 | 239 |
| 608 | 3300053096 | Ga0500641_0000921 | Ga0500641_0000921_6427_7152 | 239 |
| 609 | 3300053153 | Ga0500616_0003288 | Ga0500616_0003288_6524_7243 | 239 |
| 610 | 3300053733 | Ga0500552_000672 | Ga0500552_000672_1429_2148 | 239 |
| 611 | 3300054114 | Ga0501084_0174351 | Ga0501084_0174351_896_1615 | 239 |
| 612 | 3300061734 | Ga0530510_0022598 | Ga0530510_0022598_1083_1808 | 239 |
| 613 | 3300061734 | Ga0530510_0035253 | Ga0530510_0035253_2147_2866 | 239 |
| 614 | 3300061734 | Ga0530510_0052534 | Ga0530510_0052534_1809_2528 | 239 |
| 615 | 3300003322 | rootL2_10139955 | rootL2_101399551 | 240 |
| 616 | 3300003323 | rootH1_10131162 | rootH1_101311622 | 240 |
| 617 | 3300003775 | Ga0055524_1020715 | Ga0055524_10207152 | 240 |
| 618 | 3300005289 | Ga0065704_10081250 | Ga0065704_100812502 | 240 |
| 619 | 3300005341 | Ga0070691_10206103 | Ga0070691_102061032 | 240 |
| 620 | 3300005444 | Ga0070694_100006281 | Ga0070694_1000062818 | 240 |
| 621 | 3300005444 | Ga0070694_100027237 | Ga0070694_1000272372 | 240 |
| 622 | 3300005457 | Ga0070662_100051562 | Ga0070662_1000515624 | 240 |
| 623 | 3300005468 | Ga0070707_100472222 | Ga0070707_1004722222 | 240 |
| 624 | 3300005471 | Ga0070698_100066704 | Ga0070698_1000667042 | 240 |
| 625 | 3300005545 | Ga0070695_100000505 | Ga0070695_10000050516 | 240 |
| 626 | 3300005545 | Ga0070695_100010464 | Ga0070695_1000104645 | 240 |
| 627 | 3300005549 | Ga0070704_100048617 | Ga0070704_1000486172 | 240 |
| 628 | 3300005577 | Ga0068857_100439823 | Ga0068857_1004398233 | 240 |
| 629 | 3300005719 | Ga0068861_100115035 | Ga0068861_1001150353 | 240 |
| 630 | 3300005844 | Ga0068862_100015771 | Ga0068862_1000157712 | 240 |
| 631 | 3300005844 | Ga0068862_100409642 | Ga0068862_1004096422 | 240 |
| 632 | 3300005937 | Ga0081455_10000178 | Ga0081455_1000017810 | 240 |
| 633 | 3300005981 | Ga0081538_10020424 | Ga0081538_100204244 | 240 |
| 634 | 3300005983 | Ga0081540_1067359 | Ga0081540_10673591 | 240 |
| 635 | 3300006173 | Ga0070716_100126622 | Ga0070716_1001266222 | 240 |
| 636 | 3300006844 | Ga0075428_100423421 | Ga0075428_1004234213 | 240 |
| 637 | 3300006847 | Ga0075431_100000380 | Ga0075431_1000003806 | 240 |
| 638 | 3300006852 | Ga0075433_10024066 | Ga0075433_100240661 | 240 |
| 639 | 3300006852 | Ga0075433_10053746 | Ga0075433_100537464 | 240 |
| 640 | 3300006852 | Ga0075433_10354964 | Ga0075433_103549642 | 240 |
| 641 | 3300006871 | Ga0075434_100135066 | Ga0075434_1001350661 | 240 |
| 642 | 3300006871 | Ga0075434_100235536 | Ga0075434_1002355362 | 240 |
| 643 | 3300006871 | Ga0075434_100634944 | Ga0075434_1006349441 | 240 |
| 644 | 3300007076 | Ga0075435_100083556 | Ga0075435_1000835564 | 240 |
| 645 | 3300009094 | Ga0111539_10006885 | Ga0111539_1000688511 | 240 |
| 646 | 3300009147 | Ga0114129_10033919 | Ga0114129_100339196 | 240 |
| 647 | 3300009147 | Ga0114129_10334023 | Ga0114129_103340232 | 240 |
| 648 | 3300009147 | Ga0114129_10692601 | Ga0114129_106926011 | 240 |
| 649 | 3300009148 | Ga0105243_10207163 | Ga0105243_102071633 | 240 |
| 650 | 3300009176 | Ga0105242_10124527 | Ga0105242_101245271 | 240 |
| 651 | 3300013250 | Ga0171462_1021 | Ga0171462_102196 | 240 |
| 652 | 3300013306 | Ga0163162_10676336 | Ga0163162_106763362 | 240 |
| 653 | 3300013307 | Ga0157372_10208041 | Ga0157372_102080414 | 240 |
| 654 | 3300017792 | Ga0163161_10061001 | Ga0163161_100610012 | 240 |
| 655 | 3300025299 | Ga0209256_1000453 | Ga0209256_100045332 | 240 |
| 656 | 3300025910 | Ga0207684_10599668 | Ga0207684_105996681 | 240 |
| 657 | 3300025933 | Ga0207706_10015363 | Ga0207706_100153637 | 240 |
| 658 | 3300025942 | Ga0207689_10008846 | Ga0207689_100088465 | 240 |
| 659 | 3300026089 | Ga0207648_10019305 | Ga0207648_100193053 | 240 |
| 660 | 3300026118 | Ga0207675_100302472 | Ga0207675_1003024722 | 240 |
| 661 | 3300027471 | Ga0209995_1002297 | Ga0209995_10022975 | 240 |
| 662 | 3300027543 | Ga0209999_1001421 | Ga0209999_10014215 | 240 |
| 663 | 3300027614 | Ga0209970_1002488 | Ga0209970_10024884 | 240 |
| 664 | 3300027682 | Ga0209971_1002698 | Ga0209971_10026985 | 240 |
| 665 | 3300027695 | Ga0209966_1000430 | Ga0209966_10004307 | 240 |
| 666 | 3300027717 | Ga0209998_10000123 | Ga0209998_1000012312 | 240 |
| 667 | 3300027876 | Ga0209974_10000444 | Ga0209974_100004445 | 240 |
| 668 | 3300027907 | Ga0207428_10001382 | Ga0207428_100013824 | 240 |
| 669 | 3300028380 | Ga0268265_10008981 | Ga0268265_100089816 | 240 |
| 670 | 3300028380 | Ga0268265_10071382 | Ga0268265_100713822 | 240 |
| 671 | 3300028381 | Ga0268264_10126390 | Ga0268264_101263902 | 240 |
| 672 | 3300042012 | Ga0439455_0006076 | Ga0439455_0006076_1678_2406 | 240 |
| 673 | 3300042461 | Ga0439460_0068026 | Ga0439460_0068026_292_1020 | 240 |
| 674 | 3300042876 | Ga0451577_0012446 | Ga0451577_0012446_1825_2556 | 240 |
| 675 | 3300044712 | Ga0453684_0027427 | Ga0453684_0027427_6076_6807 | 240 |
| 676 | 3300045051 | Ga0451576_0040286 | Ga0451576_0040286_2704_3432 | 240 |
| 677 | 3300045051 | Ga0451576_0064991 | Ga0451576_0064991_2265_2999 | 240 |
| 678 | 3300045051 | Ga0451576_0099093 | Ga0451576_0099093_1758_2483 | 240 |
| 679 | 3300045051 | Ga0451576_0191697 | Ga0451576_0191697_490_1221 | 240 |
| 680 | 3300045051 | Ga0451576_0237967 | Ga0451576_0237967_671_1402 | 240 |
| 681 | 3300045051 | Ga0451576_0907534 | Ga0451576_0907534_15_743 | 240 |
| 682 | 3300046455 | Ga0495603_0117585 | Ga0495603_0117585_748_1473 | 240 |
| 683 | 3300046458 | Ga0495591_001856 | Ga0495591_001856_10709_11434 | 240 |
| 684 | 3300047446 | Ga0495679_006589 | Ga0495679_006589_2447_3172 | 240 |
| 685 | 3300048925 | Ga0496122_0006578 | Ga0496122_0006578_1687_2415 | 240 |
| 686 | 3300048926 | Ga0496123_0054463 | Ga0496123_0054463_218_946 | 240 |
| 687 | 3300048927 | Ga0496124_0023226 | Ga0496124_0023226_3247_3975 | 240 |
| 688 | 3300048928 | Ga0496125_0003788 | Ga0496125_0003788_7329_8057 | 240 |
| 689 | 3300048929 | Ga0496126_0245102 | Ga0496126_0245102_484_1212 | 240 |
| 690 | 3300048929 | Ga0496126_0249733 | Ga0496126_0249733_571_1296 | 240 |
| 691 | 3300049570 | Ga0501033_0056471 | Ga0501033_0056471_468_1196 | 240 |
| 692 | 3300049574 | Ga0501038_0279568 | Ga0501038_0279568_445_1173 | 240 |
| 693 | 3300049575 | Ga0501039_0040458 | Ga0501039_0040458_1472_2200 | 240 |
| 694 | 3300049575 | Ga0501039_0166194 | Ga0501039_0166194_709_1431 | 240 |
| 695 | 3300049576 | Ga0501040_0052461 | Ga0501040_0052461_488_1216 | 240 |
| 696 | 3300049576 | Ga0501040_0343168 | Ga0501040_0343168_189_929 | 240 |
| 697 | 3300049577 | Ga0501041_0001274 | Ga0501041_0001274_4435_5163 | 240 |
| 698 | 3300049577 | Ga0501041_0056916 | Ga0501041_0056916_1043_1774 | 240 |
| 699 | 3300049579 | Ga0501043_0056121 | Ga0501043_0056121_318_1046 | 240 |
| 700 | 3300049580 | Ga0501046_0028313 | Ga0501046_0028313_19_747 | 240 |
| 701 | 3300049581 | Ga0501047_0145500 | Ga0501047_0145500_1406_2134 | 240 |
| 702 | 3300049582 | Ga0501048_0122537 | Ga0501048_0122537_615_1343 | 240 |
| 703 | 3300049584 | Ga0501068_0095113 | Ga0501068_0095113_665_1393 | 240 |
| 704 | 3300049584 | Ga0501068_0095789 | Ga0501068_0095789_208_939 | 240 |
| 705 | 3300049587 | Ga0501071_0412615 | Ga0501071_0412615_194_925 | 240 |
| 706 | 3300049588 | Ga0501072_0003886 | Ga0501072_0003886_6559_7284 | 240 |
| 707 | 3300049588 | Ga0501072_0218015 | Ga0501072_0218015_770_1501 | 240 |
| 708 | 3300049588 | Ga0501072_0525630 | Ga0501072_0525630_68_808 | 240 |
| 709 | 3300049589 | Ga0501073_0251943 | Ga0501073_0251943_213_938 | 240 |
| 710 | 3300049590 | Ga0501074_0001623 | Ga0501074_0001623_7369_8097 | 240 |
| 711 | 3300049590 | Ga0501074_0162737 | Ga0501074_0162737_440_1168 | 240 |
| 712 | 3300049591 | Ga0501075_0010045 | Ga0501075_0010045_833_1564 | 240 |
| 713 | 3300049591 | Ga0501075_0144598 | Ga0501075_0144598_939_1667 | 240 |
| 714 | 3300049592 | Ga0501076_0006280 | Ga0501076_0006280_4840_5571 | 240 |
| 715 | 3300049593 | Ga0501077_0045223 | Ga0501077_0045223_1659_2390 | 240 |
| 716 | 3300049741 | Ga0501079_0000848 | Ga0501079_0000848_16530_17258 | 240 |
| 717 | 3300049742 | Ga0501080_0109983 | Ga0501080_0109983_89_820 | 240 |
| 718 | 3300049742 | Ga0501080_0297651 | Ga0501080_0297651_49_771 | 240 |
| 719 | 3300049742 | Ga0501080_0405726 | Ga0501080_0405726_469_1197 | 240 |
| 720 | 3300049743 | Ga0501081_0000390 | Ga0501081_0000390_4373_5101 | 240 |
| 721 | 3300049743 | Ga0501081_0007124 | Ga0501081_0007124_1229_1960 | 240 |
| 722 | 3300049743 | Ga0501081_0036919 | Ga0501081_0036919_843_1565 | 240 |
| 723 | 3300049743 | Ga0501081_0242158 | Ga0501081_0242158_431_1153 | 240 |
| 724 | 3300049744 | Ga0501083_0043997 | Ga0501083_0043997_262_990 | 240 |
| 725 | 3300049744 | Ga0501083_0107373 | Ga0501083_0107373_437_1162 | 240 |
| 726 | 3300049823 | Ga0501044_0889685 | Ga0501044_0889685_29_754 | 240 |
| 727 | 3300049824 | Ga0501045_0003761 | Ga0501045_0003761_5216_5944 | 240 |
| 728 | 3300049824 | Ga0501045_0072551 | Ga0501045_0072551_767_1498 | 240 |
| 729 | 3300049824 | Ga0501045_0424025 | Ga0501045_0424025_157_888 | 240 |
| 730 | 3300050507 | nmdc:mga05p37_19767_c1 | nmdc:mga05p37_19767_c1_4428_5150 | 240 |
| 731 | 3300050507 | nmdc:mga05p37_995467_c1 | nmdc:mga05p37_995467_c1_61_792 | 240 |
| 732 | 3300050509 | nmdc:mga0qj67_26761_c1 | nmdc:mga0qj67_26761_c1_3016_3750 | 240 |
| 733 | 3300050510 | nmdc:mga06r32_177_c2 | nmdc:mga06r32_177_c2_12947_13681 | 240 |
| 734 | 3300050511 | nmdc:mga08y16_22564_c1 | nmdc:mga08y16_22564_c1_4663_5394 | 240 |
| 735 | 3300050512 | nmdc:mga0n895_131283_c1 | nmdc:mga0n895_131283_c1_50_784 | 240 |
| 736 | 3300050512 | nmdc:mga0n895_137069_c1 | nmdc:mga0n895_137069_c1_1250_1981 | 240 |
| 737 | 3300050513 | nmdc:mga0rr50_151901_c1 | nmdc:mga0rr50_151901_c1_1074_1805 | 240 |
| 738 | 3300050515 | nmdc:mga0a205_117679_c1 | nmdc:mga0a205_117679_c1_126_857 | 240 |
| 739 | 3300050515 | nmdc:mga0a205_1873_c1 | nmdc:mga0a205_1873_c1_227_958 | 240 |
| 740 | 3300050515 | nmdc:mga0a205_5653_c1 | nmdc:mga0a205_5653_c1_10196_10927 | 240 |
| 741 | 3300054114 | Ga0501084_0002524 | Ga0501084_0002524_6358_7086 | 240 |
| 742 | 3300054114 | Ga0501084_0006956 | Ga0501084_0006956_3563_4294 | 240 |
| 743 | 3300054114 | Ga0501084_0032796 | Ga0501084_0032796_102_827 | 240 |
| 744 | 3300060353 | Ga0501082_0005991 | Ga0501082_0005991_7345_8073 | 240 |
| 745 | 3300060353 | Ga0501082_0214455 | Ga0501082_0214455_338_1063 | 240 |
| 746 | 3300061734 | Ga0530510_0024089 | Ga0530510_0024089_3382_4110 | 240 |
| 747 | 3300005345 | Ga0070692_10165761 | Ga0070692_101657612 | 241 |
| 748 | 3300005438 | Ga0070701_10258458 | Ga0070701_102584582 | 241 |
| 749 | 3300005440 | Ga0070705_100359418 | Ga0070705_1003594181 | 241 |
| 750 | 3300005444 | Ga0070694_100248545 | Ga0070694_1002485452 | 241 |
| 751 | 3300005445 | Ga0070708_100608172 | Ga0070708_1006081721 | 241 |
| 752 | 3300005467 | Ga0070706_100594883 | Ga0070706_1005948832 | 241 |
| 753 | 3300005468 | Ga0070707_100490014 | Ga0070707_1004900142 | 241 |
| 754 | 3300005536 | Ga0070697_100246282 | Ga0070697_1002462822 | 241 |
| 755 | 3300005617 | Ga0068859_100201618 | Ga0068859_1002016181 | 241 |
| 756 | 3300005842 | Ga0068858_100475634 | Ga0068858_1004756342 | 241 |
| 757 | 3300005844 | Ga0068862_100034436 | Ga0068862_1000344365 | 241 |
| 758 | 3300006175 | Ga0070712_100003200 | Ga0070712_10000320011 | 241 |
| 759 | 3300006846 | Ga0075430_100025756 | Ga0075430_1000257563 | 241 |
| 760 | 3300006847 | Ga0075431_100016272 | Ga0075431_10001627210 | 241 |
| 761 | 3300006847 | Ga0075431_100050089 | Ga0075431_1000500893 | 241 |
| 762 | 3300006847 | Ga0075431_100061328 | Ga0075431_1000613286 | 241 |
| 763 | 3300006847 | Ga0075431_100433948 | Ga0075431_1004339482 | 241 |
| 764 | 3300006852 | Ga0075433_10015415 | Ga0075433_100154154 | 241 |
| 765 | 3300006880 | Ga0075429_100001287 | Ga0075429_1000012877 | 241 |
| 766 | 3300006880 | Ga0075429_100016363 | Ga0075429_1000163635 | 241 |
| 767 | 3300006880 | Ga0075429_100026333 | Ga0075429_1000263336 | 241 |
| 768 | 3300006931 | Ga0097620_100201595 | Ga0097620_1002015952 | 241 |
| 769 | 3300007076 | Ga0075435_100112142 | Ga0075435_1001121422 | 241 |
| 770 | 3300009147 | Ga0114129_10075473 | Ga0114129_100754737 | 241 |
| 771 | 3300009147 | Ga0114129_10099435 | Ga0114129_100994352 | 241 |
| 772 | 3300009147 | Ga0114129_10125309 | Ga0114129_101253092 | 241 |
| 773 | 3300009147 | Ga0114129_10134905 | Ga0114129_101349053 | 241 |
| 774 | 3300009147 | Ga0114129_10243507 | Ga0114129_102435073 | 241 |
| 775 | 3300009148 | Ga0105243_10268126 | Ga0105243_102681261 | 241 |
| 776 | 3300009177 | Ga0105248_10533349 | Ga0105248_105333492 | 241 |
| 777 | 3300009551 | Ga0105238_10009913 | Ga0105238_1000991310 | 241 |
| 778 | 3300009553 | Ga0105249_10023224 | Ga0105249_100232247 | 241 |
| 779 | 3300013306 | Ga0163162_10272718 | Ga0163162_102727182 | 241 |
| 780 | 3300025915 | Ga0207693_10034898 | Ga0207693_100348984 | 241 |
| 781 | 3300025918 | Ga0207662_10267858 | Ga0207662_102678582 | 241 |
| 782 | 3300025924 | Ga0207694_10059196 | Ga0207694_100591962 | 241 |
| 783 | 3300025928 | Ga0207700_10030298 | Ga0207700_100302984 | 241 |
| 784 | 3300025938 | Ga0207704_10618227 | Ga0207704_106182271 | 241 |
| 785 | 3300026035 | Ga0207703_10175155 | Ga0207703_101751551 | 241 |
| 786 | 3300026075 | Ga0207708_10334697 | Ga0207708_103346972 | 241 |
| 787 | 3300026116 | Ga0207674_10434666 | Ga0207674_104346661 | 241 |
| 788 | 3300026118 | Ga0207675_100059843 | Ga0207675_1000598433 | 241 |
| 789 | 3300035691 | Ga0373931_0194808 | Ga0373931_0194808_211_936 | 241 |
| 790 | 3300049572 | Ga0501036_0025039 | Ga0501036_0025039_1382_2107 | 241 |
| 791 | 3300049574 | Ga0501038_0361891 | Ga0501038_0361891_345_1070 | 241 |
| 792 | 3300049575 | Ga0501039_0292464 | Ga0501039_0292464_143_871 | 241 |
| 793 | 3300049576 | Ga0501040_0072442 | Ga0501040_0072442_518_1243 | 241 |
| 794 | 3300049576 | Ga0501040_0138454 | Ga0501040_0138454_741_1469 | 241 |
| 795 | 3300049577 | Ga0501041_0055929 | Ga0501041_0055929_575_1300 | 241 |
| 796 | 3300049577 | Ga0501041_0239981 | Ga0501041_0239981_84_812 | 241 |
| 797 | 3300049578 | Ga0501042_0055387 | Ga0501042_0055387_581_1306 | 241 |
| 798 | 3300049582 | Ga0501048_0095691 | Ga0501048_0095691_1021_1746 | 241 |
| 799 | 3300049585 | Ga0501069_0008517 | Ga0501069_0008517_352_1077 | 241 |
| 800 | 3300049588 | Ga0501072_0036083 | Ga0501072_0036083_1090_1818 | 241 |
| 801 | 3300049588 | Ga0501072_0177719 | Ga0501072_0177719_50_775 | 241 |
| 802 | 3300049591 | Ga0501075_0012957 | Ga0501075_0012957_4754_5479 | 241 |
| 803 | 3300049591 | Ga0501075_0026074 | Ga0501075_0026074_3053_3778 | 241 |
| 804 | 3300049592 | Ga0501076_0021310 | Ga0501076_0021310_786_1511 | 241 |
| 805 | 3300049592 | Ga0501076_0099535 | Ga0501076_0099535_468_1193 | 241 |
| 806 | 3300049741 | Ga0501079_0014082 | Ga0501079_0014082_1575_2300 | 241 |
| 807 | 3300049743 | Ga0501081_0007312 | Ga0501081_0007312_5493_6218 | 241 |
| 808 | 3300049743 | Ga0501081_0018454 | Ga0501081_0018454_1406_2131 | 241 |
| 809 | 3300049744 | Ga0501083_0049385 | Ga0501083_0049385_1874_2599 | 241 |
| 810 | 3300049824 | Ga0501045_0118327 | Ga0501045_0118327_149_874 | 241 |
| 811 | 3300050507 | nmdc:mga05p37_211702_c1 | nmdc:mga05p37_211702_c1_808_1533 | 241 |
| 812 | 3300050507 | nmdc:mga05p37_225839_c1 | nmdc:mga05p37_225839_c1_1244_1981 | 241 |
| 813 | 3300050507 | nmdc:mga05p37_70070_c1 | nmdc:mga05p37_70070_c1_2882_3607 | 241 |
| 814 | 3300050508 | nmdc:mga09592_19635_c1 | nmdc:mga09592_19635_c1_1645_2382 | 241 |
| 815 | 3300050508 | nmdc:mga09592_375463_c1 | nmdc:mga09592_375463_c1_133_858 | 241 |
| 816 | 3300050508 | nmdc:mga09592_698_c1 | nmdc:mga09592_698_c1_7721_8446 | 241 |
| 817 | 3300050509 | nmdc:mga0qj67_64838_c1 | nmdc:mga0qj67_64838_c1_1152_1877 | 241 |
| 818 | 3300050510 | nmdc:mga06r32_28822_c1 | nmdc:mga06r32_28822_c1_2341_3078 | 241 |
| 819 | 3300050510 | nmdc:mga06r32_296416_c1 | nmdc:mga06r32_296416_c1_814_1539 | 241 |
| 820 | 3300050510 | nmdc:mga06r32_51244_c1 | nmdc:mga06r32_51244_c1_2950_3675 | 241 |
| 821 | 3300050510 | nmdc:mga06r32_607_c1 | nmdc:mga06r32_607_c1_6220_6945 | 241 |
| 822 | 3300050512 | nmdc:mga0n895_23058_c1 | nmdc:mga0n895_23058_c1_1606_2340 | 241 |
| 823 | 3300050513 | nmdc:mga0rr50_25031_c1 | nmdc:mga0rr50_25031_c1_1236_1970 | 241 |
| 824 | 3300050515 | nmdc:mga0a205_454707_c1 | nmdc:mga0a205_454707_c1_282_1019 | 241 |
| 825 | 3300050515 | nmdc:mga0a205_68840_c2 | nmdc:mga0a205_68840_c2_1042_1767 | 241 |
| 826 | 3300054114 | Ga0501084_0017218 | Ga0501084_0017218_3826_4551 | 241 |
| 827 | 3300054114 | Ga0501084_0177246 | Ga0501084_0177246_41_766 | 241 |
| 828 | 3300060353 | Ga0501082_0015900 | Ga0501082_0015900_4818_5543 | 241 |
| 829 | 3300060353 | Ga0501082_0226349 | Ga0501082_0226349_874_1602 | 241 |
| 830 | 3300061734 | Ga0530510_0008725 | Ga0530510_0008725_5567_6292 | 241 |
| 831 | 3300061734 | Ga0530510_0119482 | Ga0530510_0119482_144_872 | 241 |
| 832 | 3300061734 | Ga0530510_0135924 | Ga0530510_0135924_802_1527 | 241 |
| 833 | 3300003187 | JGI25151J46595_10000795 | JGI25151J46595_1000079510 | 242 |
| 834 | 3300003316 | rootH1_10059295 | rootH1_100592952 | 242 |
| 835 | 3300025284 | Ga0209130_1001163 | Ga0209130_10011638 | 242 |
| 836 | 3300025294 | Ga0209025_1000328 | Ga0209025_100032810 | 242 |
| 837 | 3300025297 | Ga0209758_1001871 | Ga0209758_10018719 | 242 |
| 838 | 3300025302 | Ga0207426_1000235 | Ga0207426_100023594 | 242 |
| 839 | 3300046506 | Ga0495583_0170107 | Ga0495583_0170107_108_836 | 242 |
| 840 | 3300046512 | Ga0495610_0134937 | Ga0495610_0134937_246_974 | 242 |
| 841 | 3300046694 | Ga0495649_0139709 | Ga0495649_0139709_161_889 | 242 |
| 842 | 3300053139 | Ga0500568_0033190 | Ga0500568_0033190_165_893 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zzf-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase without oligomerization domain | 0.9031 | 3 | 238 |
| 2zzg-assembly2.cif.gz_B | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.9018 | 3 | 238 |
| 2zze-assembly2.cif.gz_B | crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form | 0.9002 | 3 | 238 |
| 2zzg-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.8999 | 3 | 238 |
| 2e1b-assembly1.cif.gz_A | crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii | 0.892 | 1 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e1bA02 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.881 | 87 | 237 | 3.30.980.10 |
| 2e1bA02 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.8684 | 87 | 237 | 3.30.980.10 |
| af_Q4DQ33_587_768_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.8648 | 87 | 240 | 3.30.980.10 |
| 2ztgA03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.8636 | 3 | 85 | 2.40.30.130 |
| af_A0A2R8QSU7_595_766_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.8564 | 87 | 238 | 3.30.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5HQQ0-F1-model_v4 | Alanyl-tRNA editing protein | 0.9733 | 1 | 146 |
GO:0000166
GO:0002161 GO:0046872 |
| AF-A0A535EAG5-F1-model_v4 | Alanyl-tRNA editing protein | 0.9721 | 110 | 242 |
GO:0004812
GO:0005524 GO:0043039 |
| AF-A0A1H5MHD4-F1-model_v4 | deleted | 0.972 | 3 | 238 |
|
| AF-A0A848UEE3-F1-model_v4 | Alanyl-tRNA editing protein | 0.9678 | 29 | 238 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A7Z0B9X1-F1-model_v4 | Misacylated tRNA(Ala) deacylase (EC 3.1.1.-) | 0.9674 | 1 | 239 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar