F483137

General Info

Members Datasets Scaffolds Average Seq Length
842 329 824 240

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10267858|Ga0207662_102678582
Length 273
Sequence MTRYYCHEHPDVLTIETRVVDARPGAVLLEDTPFYPGGGGQLADHGRLSWTSGEVIVSGIDTSDGRVWHVLAEPVELSGVVQASVDPSFRDLMCQLHTDAHILNALVYQQFRGALVTGAQLNDDGTVRVDFDLPDADNDRLRALEPAMNDAIRQDLPVRYAYLPAEECHPESGLLRSRSVAPPPAADGTIRIVEIVGLDRQGCGGTHLPSTGRSRPVRILKIDNKGRHNRRVRFGRAKALTRALDALRRGCAGRRGTAWCSAPRTSSRGCRTG

Samples

Sample ID Description Type Environment
1 2643221736 Bosea sp. Root483D1 Isolate Unclassified
2 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
3 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
4 2841760612 Bosea sp. Tri-49 Isolate Nodule
5 2844104063 Bosea sp. Tri-39 Isolate Nodule
6 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
7 2851182111 Bosea sp. Tri-44 Isolate Nodule
8 2851246043 Bosea sp. Tri-54 Isolate Nodule
9 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
10 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
11 2906610324
12 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
13 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
14 2922425934
15 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
111 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
203 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
244 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
245 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
246 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
294 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
328 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
329 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0.24
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 2.02
Rhizoplane 0.48
Rhizosphere 86.46
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000795 3300003187 Bacteria 25423
2 JGI25151J46595_10058202 3300003187 Bacteria 1253
3 rootH1_10059295 3300003316 Bacteria 1900
4 rootL2_10139955 3300003322 Bacteria 1924
5 rootH1_10131162 3300003323 Bacteria 1055
6 Ga0055524_1020715 3300003775 Bacteria 2205
7 Ga0055543_1019236 3300004625 Bacteria 1265
8 Ga0065165_1000048 3300005262 Bacteria 196539
9 Ga0065704_10081250 3300005289 Bacteria 3795
10 Ga0065715_10118382 3300005293 Bacteria 2317
11 Ga0070658_10001208 3300005327 Bacteria 22135
12 Ga0070676_10001167 3300005328 Bacteria 13143
13 Ga0070690_100046364 3300005330 Bacteria 2763
14 Ga0070670_100006723 3300005331 Bacteria 9747
15 Ga0070677_10055435 3300005333 Bacteria 1618
16 Ga0068869_100003093 3300005334 Bacteria 10142
17 Ga0068869_100059150 3300005334 Bacteria 2805
18 Ga0070680_100000881 3300005336 Bacteria 21276
19 Ga0070680_100024718 3300005336 Bacteria 4801
20 Ga0070680_100076697 3300005336 Bacteria 2752
21 Ga0070680_100240392 3300005336 Bacteria 1530
22 Ga0070682_100001651 3300005337 Bacteria 12399
23 Ga0068868_100157278 3300005338 Bacteria 1875
24 Ga0070660_100001614 3300005339 Bacteria 15497
25 Ga0070660_100025586 3300005339 Bacteria 4388
26 Ga0070689_100089964 3300005340 Bacteria 2418
27 Ga0070691_10010959 3300005341 Bacteria 4140
28 Ga0070691_10016601 3300005341 Bacteria 3383
29 Ga0070691_10206103 3300005341 Bacteria 1035
30 Ga0070661_100001126 3300005344 Bacteria 18779
31 Ga0070661_100372950 3300005344 Bacteria 1124
32 Ga0070692_10000047 3300005345 Bacteria 22807
33 Ga0070692_10165761 3300005345 Bacteria 1269
34 Ga0070669_100004143 3300005353 Bacteria 10521
35 Ga0070675_100151200 3300005354 Bacteria 1991
36 Ga0070671_100352430 3300005355 Bacteria 1256
37 Ga0070673_100375905 3300005364 Bacteria 1266
38 Ga0070703_10001203 3300005406 Bacteria 7945
39 Ga0070714_100138327 3300005435 Bacteria 2183
40 Ga0070713_100047920 3300005436 Bacteria 3515
41 Ga0070701_10258458 3300005438 Bacteria 1054
42 Ga0070705_100000623 3300005440 Bacteria 20474
43 Ga0070705_100220315 3300005440 Bacteria 1313
44 Ga0070705_100359418 3300005440 Bacteria 1064
45 Ga0070700_100018903 3300005441 Bacteria 3970
46 Ga0070694_100000022 3300005444 Bacteria 71609
47 Ga0070694_100000244 3300005444 Bacteria 28795
48 Ga0070694_100006281 3300005444 Bacteria 7211
49 Ga0070694_100027237 3300005444 Bacteria 3711
50 Ga0070694_100046033 3300005444 Bacteria 2926
51 Ga0070694_100228047 3300005444 Bacteria 1400
52 Ga0070694_100248545 3300005444 Bacteria 1344
53 Ga0070708_100002595 3300005445 Bacteria 13972
54 Ga0070708_100025356 3300005445 Bacteria 5068
55 Ga0070708_100036349 3300005445 Bacteria 4296
56 Ga0070708_100083872 3300005445 Bacteria 2890
57 Ga0070708_100101537 3300005445 Bacteria 2634
58 Ga0070708_100188995 3300005445 Bacteria 1926
59 Ga0070708_100224455 3300005445 Bacteria 1762
60 Ga0070708_100288687 3300005445 Bacteria 1544
61 Ga0070708_100608172 3300005445 Bacteria 1030
62 Ga0070663_100008205 3300005455 Bacteria 6412
63 Ga0070662_100051562 3300005457 Bacteria 2972
64 Ga0070662_100096758 3300005457 Bacteria 2227
65 Ga0070662_100505597 3300005457 Bacteria 1008
66 Ga0070681_10004747 3300005458 Bacteria 13018
67 Ga0068867_100072657 3300005459 Bacteria 2575
68 Ga0070706_100003723 3300005467 Bacteria 14911
69 Ga0070706_100034717 3300005467 Bacteria 4658
70 Ga0070706_100050813 3300005467 Bacteria 3825
71 Ga0070706_100054082 3300005467 Bacteria 3706
72 Ga0070706_100384937 3300005467 Bacteria 1306
73 Ga0070706_100594883 3300005467 Bacteria 1028
74 Ga0070707_100018242 3300005468 Bacteria 6604
75 Ga0070707_100075704 3300005468 Bacteria 3247
76 Ga0070707_100213781 3300005468 Bacteria 1879
77 Ga0070707_100337738 3300005468 Bacteria 1464
78 Ga0070707_100472222 3300005468 Bacteria 1216
79 Ga0070707_100490014 3300005468 Bacteria 1191
80 Ga0070698_100003867 3300005471 Bacteria 16465
81 Ga0070698_100029931 3300005471 Bacteria 5650
82 Ga0070698_100066704 3300005471 Bacteria 3620
83 Ga0070698_100152099 3300005471 Bacteria 2261
84 Ga0070698_100162427 3300005471 Bacteria 2177
85 Ga0070699_100002140 3300005518 Bacteria 17917
86 Ga0070699_100007483 3300005518 Bacteria 9501
87 Ga0070699_100019236 3300005518 Bacteria 5877
88 Ga0070699_100022970 3300005518 Bacteria 5372
89 Ga0070699_100031074 3300005518 Bacteria 4612
90 Ga0070699_100119439 3300005518 Bacteria 2317
91 Ga0070679_100005357 3300005530 Bacteria 11870
92 Ga0070684_100083507 3300005535 Bacteria 2830
93 Ga0070684_100100822 3300005535 Bacteria 2579
94 Ga0070697_100000743 3300005536 Bacteria 24328
95 Ga0070697_100008556 3300005536 Bacteria 7993
96 Ga0070697_100022147 3300005536 Bacteria 5041
97 Ga0070697_100045380 3300005536 Bacteria 3561
98 Ga0070697_100152159 3300005536 Bacteria 1950
99 Ga0070697_100225132 3300005536 Bacteria 1599
100 Ga0070697_100246282 3300005536 Bacteria 1527
101 Ga0070697_100269805 3300005536 Bacteria 1458
102 Ga0068853_100001043 3300005539 Bacteria 19590
103 Ga0068853_100003483 3300005539 Bacteria 12041
104 Ga0070672_100099583 3300005543 Bacteria 2356
105 Ga0070695_100000263 3300005545 Bacteria 26422
106 Ga0070695_100000505 3300005545 Bacteria 20403
107 Ga0070695_100000944 3300005545 Bacteria 15755
108 Ga0070695_100010464 3300005545 Bacteria 5538
109 Ga0070695_100215625 3300005545 Bacteria 1380
110 Ga0070696_100094329 3300005546 Bacteria 2135
111 Ga0070696_100181611 3300005546 Bacteria 1561
112 Ga0070696_100355117 3300005546 Bacteria 1136
113 Ga0070693_100008567 3300005547 Bacteria 5051
114 Ga0070665_100023733 3300005548 Bacteria 6177
115 Ga0070665_100301267 3300005548 Bacteria 1606
116 Ga0070704_100004243 3300005549 Bacteria 8281
117 Ga0070704_100048617 3300005549 Bacteria 2970
118 Ga0070704_100051906 3300005549 Bacteria 2890
119 Ga0070704_100105200 3300005549 Bacteria 2136
120 Ga0070704_100147296 3300005549 Bacteria 1847
121 Ga0068855_100000101 3300005563 Bacteria 105095
122 Ga0068855_100007903 3300005563 Bacteria 12850
123 Ga0068855_100060940 3300005563 Bacteria 4409
124 Ga0068855_100797259 3300005563 Bacteria 1004
125 Ga0070664_100021688 3300005564 Bacteria 5297
126 Ga0068857_100015839 3300005577 Bacteria 6598
127 Ga0068857_100118819 3300005577 Bacteria 2379
128 Ga0068857_100187741 3300005577 Bacteria 1882
129 Ga0068857_100222219 3300005577 Bacteria 1725
130 Ga0068857_100439823 3300005577 Bacteria 1218
131 Ga0068854_100000873 3300005578 Bacteria 18083
132 Ga0068856_100029789 3300005614 Bacteria 5333
133 Ga0068856_100996886 3300005614 Unclassified 856
134 Ga0070702_100030196 3300005615 Bacteria 2953
135 Ga0070702_100257136 3300005615 Bacteria 1187
136 Ga0068852_100131186 3300005616 Bacteria 2308
137 Ga0068852_100141361 3300005616 Bacteria 2228
138 Ga0068859_100037661 3300005617 Bacteria 4854
139 Ga0068859_100201618 3300005617 Bacteria 2074
140 Ga0068859_100507030 3300005617 Bacteria 1302
141 Ga0068864_100050707 3300005618 Bacteria 3573
142 Ga0068866_10026817 3300005718 Bacteria 2726
143 Ga0068861_100023552 3300005719 Bacteria 4442
144 Ga0068861_100115035 3300005719 Bacteria 2161
145 Ga0068870_10000613 3300005840 Bacteria 13564
146 Ga0068863_100004816 3300005841 Bacteria 13294
147 Ga0068858_100112957 3300005842 Bacteria 2537
148 Ga0068858_100137006 3300005842 Bacteria 2297
149 Ga0068858_100475634 3300005842 Bacteria 1205
150 Ga0068860_100003258 3300005843 Bacteria 16723
151 Ga0068860_100085725 3300005843 Bacteria 2997
152 Ga0068860_100089118 3300005843 Bacteria 2937
153 Ga0068862_100001978 3300005844 Bacteria 18607
154 Ga0068862_100015771 3300005844 Bacteria 6279
155 Ga0068862_100034436 3300005844 Bacteria 4285
156 Ga0068862_100038664 3300005844 Bacteria 4048
157 Ga0068862_100409642 3300005844 Bacteria 1270
158 Ga0068862_100799684 3300005844 Bacteria 921
159 Ga0081455_10000178 3300005937 Bacteria 79927
160 Ga0081455_10000576 3300005937 Bacteria 47827
161 Ga0081455_10002921 3300005937 Bacteria 20054
162 Ga0081455_10038375 3300005937 Bacteria 4242
163 Ga0081455_10068407 3300005937 Bacteria 2956
164 Ga0081455_10152553 3300005937 Bacteria 1779
165 Ga0081538_10020424 3300005981 Bacteria 4874
166 Ga0081540_1067359 3300005983 Bacteria 1673
167 Ga0081539_10000987 3300005985 Bacteria 52947
168 Ga0070717_10247408 3300006028 Bacteria 1574
169 Ga0075365_10075004 3300006038 Bacteria 2282
170 Ga0075365_10398663 3300006038 Bacteria 971
171 Ga0075363_100098168 3300006048 Bacteria 1619
172 Ga0075364_10147677 3300006051 Bacteria 1583
173 Ga0075432_10021510 3300006058 Unclassified 2205
174 Ga0070716_100029371 3300006173 Bacteria 2972
175 Ga0070716_100126622 3300006173 Bacteria 1608
176 Ga0070712_100003200 3300006175 Bacteria 10087
177 Ga0070712_100189853 3300006175 Bacteria 1607
178 Ga0075362_10002293 3300006177 Bacteria 6388
179 Ga0075362_10031783 3300006177 Bacteria 2287
180 Ga0075362_10038829 3300006177 Bacteria 2091
181 Ga0075362_10050819 3300006177 Bacteria 1854
182 Ga0075362_10051055 3300006177 Bacteria 1850
183 Ga0075362_10059779 3300006177 Bacteria 1721
184 Ga0075367_10021536 3300006178 Bacteria 3604
185 Ga0075367_10056350 3300006178 Bacteria 2335
186 Ga0075367_10127635 3300006178 Bacteria 1570
187 Ga0075367_10291797 3300006178 Bacteria 1026
188 Ga0075367_10401428 3300006178 Bacteria 867
189 Ga0075369_10004309 3300006186 Bacteria 5243
190 Ga0075369_10011196 3300006186 Bacteria 3523
191 Ga0075369_10211558 3300006186 Bacteria 896
192 Ga0075366_10011726 3300006195 Bacteria 4954
193 Ga0075366_10144679 3300006195 Bacteria 1438
194 Ga0075366_10194890 3300006195 Bacteria 1231
195 Ga0097621_100240038 3300006237 Bacteria 1584
196 Ga0075428_100001995 3300006844 Bacteria 22000
197 Ga0075428_100004148 3300006844 Bacteria 15951
198 Ga0075428_100006328 3300006844 Bacteria 13170
199 Ga0075428_100147622 3300006844 Bacteria 2556
200 Ga0075428_100356377 3300006844 Bacteria 1570
201 Ga0075428_100423421 3300006844 Bacteria 1426
202 Ga0075428_100576434 3300006844 Bacteria 1202
203 Ga0075430_100000574 3300006846 Bacteria 27901
204 Ga0075430_100000927 3300006846 Bacteria 23040
205 Ga0075430_100025756 3300006846 Bacteria 5005
206 Ga0075430_100150717 3300006846 Bacteria 1937
207 Ga0075431_100000175 3300006847 Bacteria 45515
208 Ga0075431_100000271 3300006847 Bacteria 40085
209 Ga0075431_100000339 3300006847 Bacteria 36926
210 Ga0075431_100000380 3300006847 Bacteria 35549
211 Ga0075431_100001571 3300006847 Bacteria 21219
212 Ga0075431_100016272 3300006847 Bacteria 7546
213 Ga0075431_100050089 3300006847 Bacteria 4307
214 Ga0075431_100052712 3300006847 Bacteria 4195
215 Ga0075431_100061328 3300006847 Bacteria 3880
216 Ga0075431_100144139 3300006847 Bacteria 2455
217 Ga0075431_100433948 3300006847 Unclassified 1311
218 Ga0075431_100448801 3300006847 Bacteria 1286
219 Ga0075433_10015415 3300006852 Bacteria 6268
220 Ga0075433_10021301 3300006852 Bacteria 5435
221 Ga0075433_10024066 3300006852 Bacteria 5135
222 Ga0075433_10053746 3300006852 Bacteria 3512
223 Ga0075433_10071747 3300006852 Bacteria 3044
224 Ga0075433_10193644 3300006852 Bacteria 1808
225 Ga0075433_10354964 3300006852 Bacteria 1295
226 Ga0075433_10560791 3300006852 Bacteria 1004
227 Ga0075434_100021782 3300006871 Bacteria 6234
228 Ga0075434_100047586 3300006871 Bacteria 4256
229 Ga0075434_100056776 3300006871 Bacteria 3891
230 Ga0075434_100135066 3300006871 Bacteria 2486
231 Ga0075434_100209947 3300006871 Bacteria 1967
232 Ga0075434_100235536 3300006871 Bacteria 1851
233 Ga0075434_100235891 3300006871 Bacteria 1849
234 Ga0075434_100281077 3300006871 Bacteria 1684
235 Ga0075434_100634944 3300006871 Bacteria 1086
236 Ga0075429_100000014 3300006880 Bacteria 79603
237 Ga0075429_100001287 3300006880 Bacteria 20435
238 Ga0075429_100012908 3300006880 Bacteria 7248
239 Ga0075429_100016363 3300006880 Bacteria 6427
240 Ga0075429_100026333 3300006880 Bacteria 5048
241 Ga0075429_100037126 3300006880 Bacteria 4241
242 Ga0075429_100208957 3300006880 Bacteria 1710
243 Ga0075429_100233879 3300006880 Bacteria 1610
244 Ga0075429_100357569 3300006880 Bacteria 1279
245 Ga0068865_100493833 3300006881 Bacteria 1019
246 Ga0068865_100575861 3300006881 Bacteria 948
247 Ga0075436_100011714 3300006914 Bacteria 6019
248 Ga0075436_100020488 3300006914 Bacteria 4539
249 Ga0075436_100033909 3300006914 Bacteria 3518
250 Ga0075436_100047501 3300006914 Bacteria 2961
251 Ga0075436_100112309 3300006914 Bacteria 1903
252 Ga0075436_100177108 3300006914 Bacteria 1506
253 Ga0097620_100037661 3300006931 Bacteria 4854
254 Ga0097620_100201595 3300006931 Bacteria 2074
255 Ga0097620_100507018 3300006931 Bacteria 1302
256 Ga0099824_1007022 3300006942 Bacteria 15144
257 Ga0099822_1009294 3300006943 Bacteria 12400
258 Ga0075435_100066579 3300007076 Bacteria 2931
259 Ga0075435_100083556 3300007076 Bacteria 2625
260 Ga0075435_100112142 3300007076 Bacteria 2269
261 Ga0099794_10006090 3300007265 Bacteria 4871
262 Ga0099794_10045817 3300007265 Bacteria 2093
263 Ga0099794_10057983 3300007265 Bacteria 1877
264 Ga0099794_10134330 3300007265 Bacteria 1251
265 Ga0105240_10053725 3300009093 Bacteria 5054
266 Ga0105240_10294310 3300009093 Bacteria 1860
267 Ga0111539_10006885 3300009094 Bacteria 14602
268 Ga0111539_10016351 3300009094 Bacteria 9199
269 Ga0111539_10089708 3300009094 Bacteria 3613
270 Ga0105245_10782788 3300009098 Bacteria 991
271 Ga0114129_10000312 3300009147 Bacteria 56790
272 Ga0114129_10000495 3300009147 Bacteria 47768
273 Ga0114129_10000499 3300009147 Bacteria 47675
274 Ga0114129_10001148 3300009147 Bacteria 35055
275 Ga0114129_10033919 3300009147 Bacteria 7210
276 Ga0114129_10064303 3300009147 Bacteria 5119
277 Ga0114129_10075473 3300009147 Bacteria 4694
278 Ga0114129_10099435 3300009147 Bacteria 4026
279 Ga0114129_10125309 3300009147 Bacteria 3532
280 Ga0114129_10134905 3300009147 Bacteria 3387
281 Ga0114129_10243507 3300009147 Bacteria 2417
282 Ga0114129_10274334 3300009147 Bacteria 2255
283 Ga0114129_10318271 3300009147 Bacteria 2069
284 Ga0114129_10334023 3300009147 Bacteria 2011
285 Ga0114129_10668703 3300009147 Bacteria 1338
286 Ga0114129_10692601 3300009147 Bacteria 1310
287 Ga0105243_10084234 3300009148 Bacteria 2603
288 Ga0105243_10207163 3300009148 Bacteria 1724
289 Ga0105243_10268126 3300009148 Bacteria 1532
290 Ga0105243_10474004 3300009148 Bacteria 1180
291 Ga0105241_10004528 3300009174 Bacteria 10281
292 Ga0105241_10032631 3300009174 Bacteria 3905
293 Ga0105242_10034543 3300009176 Bacteria 4054
294 Ga0105242_10124527 3300009176 Bacteria 2217
295 Ga0105248_10533349 3300009177 Bacteria 1324
296 Ga0105238_10009913 3300009551 Bacteria 9550
297 Ga0105238_10152411 3300009551 Bacteria 2287
298 Ga0105249_10023224 3300009553 Bacteria 5563
299 Ga0105249_10268770 3300009553 Bacteria 1698
300 Ga0105035_102227 3300009988 Bacteria 1414
301 Ga0105239_10223944 3300010375 Bacteria 2109
302 Ga0105239_10451528 3300010375 Bacteria 1458
303 Ga0157370_10069916 3300013104 Bacteria 3315
304 Ga0157370_10239321 3300013104 Bacteria 1679
305 Ga0157369_10062721 3300013105 Bacteria 4005
306 Ga0157369_10358630 3300013105 Bacteria 1514
307 Ga0157369_10620372 3300013105 Bacteria 1116
308 Ga0171462_1021 3300013250 Bacteria 141297
309 Ga0157378_10135851 3300013297 Bacteria 2280
310 Ga0163162_10151029 3300013306 Bacteria 2440
311 Ga0163162_10272718 3300013306 Bacteria 1824
312 Ga0163162_10676336 3300013306 Bacteria 1155
313 Ga0157372_10002694 3300013307 Bacteria 19211
314 Ga0157372_10208041 3300013307 Bacteria 2267
315 Ga0157372_10461961 3300013307 Bacteria 1479
316 Ga0157375_10081679 3300013308 Bacteria 3272
317 Ga0157375_11068416 3300013308 Bacteria 944
318 Ga0157515_150309 3300013875 Archaea 869
319 Ga0163163_10354808 3300014325 Bacteria 1523
320 Ga0182008_10049381 3300014497 Bacteria 2089
321 Ga0157376_10905306 3300014969 Bacteria 900
322 Ga0163161_10061001 3300017792 Bacteria 2746
323 Ga0206356_10052660 3300020070 Bacteria 1879
324 Ga0206353_11152514 3300020082 Bacteria 3157
325 Ga0213872_10012842 3300021361 Bacteria 3930
326 Ga0213876_10001267 3300021384 Bacteria 15956
327 Ga0213876_10046438 3300021384 Bacteria 2296
328 Ga0213875_10001514 3300021388 Bacteria 14942
329 Ga0213875_10041336 3300021388 Bacteria 2169
330 Ga0213871_10030255 3300021441 Bacteria 1408
331 Ga0209233_1004054 3300025261 Bacteria 5067
332 Ga0209130_1000071 3300025284 Bacteria 178273
333 Ga0209130_1001163 3300025284 Bacteria 19005
334 Ga0209675_1000682 3300025291 Bacteria 23696
335 Ga0209025_1000328 3300025294 Bacteria 105594
336 Ga0209025_1009442 3300025294 Bacteria 6792
337 Ga0209758_1001871 3300025297 Bacteria 23059
338 Ga0209256_1000453 3300025299 Bacteria 62097
339 Ga0207426_1000235 3300025302 Bacteria 126601
340 Ga0207426_1007694 3300025302 Bacteria 4474
341 Ga0207426_1018722 3300025302 Bacteria 2436
342 Ga0207426_1038171 3300025302 Bacteria 1514
343 Ga0209257_1009440 3300025304 Bacteria 5222
344 Ga0207653_10006803 3300025885 Bacteria 3572
345 Ga0207653_10011782 3300025885 Bacteria 2728
346 Ga0207682_10026606 3300025893 Bacteria 2300
347 Ga0207642_10273493 3300025899 Bacteria 968
348 Ga0207699_10112155 3300025906 Bacteria 1749
349 Ga0207645_10000268 3300025907 Bacteria 43088
350 Ga0207643_10000144 3300025908 Bacteria 48174
351 Ga0207705_10145539 3300025909 Bacteria 1772
352 Ga0207684_10000474 3300025910 Bacteria 51941
353 Ga0207684_10049419 3300025910 Bacteria 3568
354 Ga0207684_10078456 3300025910 Bacteria 2808
355 Ga0207684_10087776 3300025910 Bacteria 2650
356 Ga0207684_10599668 3300025910 Bacteria 941
357 Ga0207654_10007511 3300025911 Bacteria 5495
358 Ga0207707_10000250 3300025912 Bacteria 59148
359 Ga0207707_10222483 3300025912 Bacteria 1643
360 Ga0207707_10353856 3300025912 Bacteria 1265
361 Ga0207695_10211114 3300025913 Bacteria 1852
362 Ga0207695_10242073 3300025913 Bacteria 1705
363 Ga0207693_10034898 3300025915 Bacteria 3967
364 Ga0207693_10169832 3300025915 Bacteria 1717
365 Ga0207660_10000341 3300025917 Bacteria 30131
366 Ga0207660_10012826 3300025917 Bacteria 5487
367 Ga0207660_10043871 3300025917 Bacteria 3144
368 Ga0207660_10086586 3300025917 Bacteria 2313
369 Ga0207660_10254706 3300025917 Bacteria 1386
370 Ga0207662_10025182 3300025918 Bacteria 3426
371 Ga0207662_10267858 3300025918 Bacteria 1126
372 Ga0207657_10012232 3300025919 Bacteria 8479
373 Ga0207657_10084831 3300025919 Bacteria 2654
374 Ga0207649_10103349 3300025920 Bacteria 1890
375 Ga0207652_10000757 3300025921 Bacteria 31021
376 Ga0207652_10004986 3300025921 Bacteria 10753
377 Ga0207646_10002578 3300025922 Bacteria 21396
378 Ga0207646_10016668 3300025922 Bacteria 6891
379 Ga0207646_10020279 3300025922 Bacteria 6162
380 Ga0207646_10104521 3300025922 Bacteria 2540
381 Ga0207646_10180982 3300025922 Bacteria 1904
382 Ga0207681_10031954 3300025923 Bacteria 3442
383 Ga0207694_10059196 3300025924 Bacteria 2979
384 Ga0207650_10005652 3300025925 Bacteria 8540
385 Ga0207700_10030298 3300025928 Bacteria 3829
386 Ga0207700_10109043 3300025928 Bacteria 2224
387 Ga0207644_10312978 3300025931 Bacteria 1268
388 Ga0207690_10004563 3300025932 Bacteria 8179
389 Ga0207706_10004278 3300025933 Bacteria 13432
390 Ga0207706_10015363 3300025933 Bacteria 6917
391 Ga0207706_10213637 3300025933 Bacteria 1690
392 Ga0207686_10011545 3300025934 Bacteria 4840
393 Ga0207686_10729581 3300025934 Bacteria 790
394 Ga0207709_10047777 3300025935 Bacteria 2604
395 Ga0207670_10063383 3300025936 Bacteria 2529
396 Ga0207704_10265460 3300025938 Bacteria 1297
397 Ga0207704_10437174 3300025938 Bacteria 1041
398 Ga0207704_10618227 3300025938 Bacteria 889
399 Ga0207665_10018644 3300025939 Bacteria 4558
400 Ga0207691_10060187 3300025940 Bacteria 3451
401 Ga0207691_10256157 3300025940 Bacteria 1509
402 Ga0207689_10000005 3300025942 Bacteria 135458
403 Ga0207689_10008846 3300025942 Bacteria 8742
404 Ga0207689_10060382 3300025942 Bacteria 3118
405 Ga0207661_10082695 3300025944 Bacteria 2655
406 Ga0207679_10000273 3300025945 Bacteria 38920
407 Ga0207679_10043239 3300025945 Bacteria 3243
408 Ga0207667_10001037 3300025949 Bacteria 35354
409 Ga0207667_10009236 3300025949 Bacteria 11640
410 Ga0207667_10184336 3300025949 Bacteria 2143
411 Ga0207712_10126919 3300025961 Unclassified 1938
412 Ga0207712_10390862 3300025961 Bacteria 1167
413 Ga0207640_10003690 3300025981 Bacteria 8254
414 Ga0207677_10110330 3300026023 Bacteria 2047
415 Ga0207703_10175155 3300026035 Bacteria 1890
416 Ga0207703_10216802 3300026035 Bacteria 1709
417 Ga0207639_10002730 3300026041 Bacteria 11844
418 Ga0207639_10007661 3300026041 Bacteria 7370
419 Ga0207678_10004745 3300026067 Bacteria 12212
420 Ga0207708_10334697 3300026075 Bacteria 1238
421 Ga0207708_10367024 3300026075 Bacteria 1184
422 Ga0207702_10000385 3300026078 Bacteria 50280
423 Ga0207702_10011216 3300026078 Bacteria 7473
424 Ga0207702_10276865 3300026078 Bacteria 1585
425 Ga0207641_10326461 3300026088 Bacteria 1456
426 Ga0207648_10000434 3300026089 Bacteria 46147
427 Ga0207648_10019305 3300026089 Bacteria 6152
428 Ga0207648_10132385 3300026089 Bacteria 2195
429 Ga0207648_10609629 3300026089 Bacteria 1007
430 Ga0207676_10110161 3300026095 Bacteria 2302
431 Ga0207674_10000673 3300026116 Bacteria 44363
432 Ga0207674_10010341 3300026116 Bacteria 10579
433 Ga0207674_10434666 3300026116 Bacteria 1268
434 Ga0207675_100050791 3300026118 Bacteria 3870
435 Ga0207675_100059843 3300026118 Bacteria 3555
436 Ga0207675_100203496 3300026118 Bacteria 1902
437 Ga0207675_100302472 3300026118 Bacteria 1558
438 Ga0207683_10093701 3300026121 Bacteria 2676
439 Ga0207698_10098969 3300026142 Bacteria 2411
440 Ga0207698_10133761 3300026142 Bacteria 2124
441 Ga0207698_10196498 3300026142 Bacteria 1802
442 Ga0209589_1000005 3300027357 Bacteria 530958
443 Ga0209489_100005 3300027361 Bacteria 530958
444 Ga0209700_100006 3300027363 Bacteria 530958
445 Ga0209995_1002297 3300027471 Bacteria 3014
446 Ga0209999_1001421 3300027543 Bacteria 4104
447 Ga0209970_1002488 3300027614 Bacteria 3133
448 Ga0209588_1103649 3300027671 Bacteria 915
449 Ga0209971_1002698 3300027682 Bacteria 4246
450 Ga0209966_1000430 3300027695 Bacteria 11969
451 Ga0209998_10000123 3300027717 Bacteria 30249
452 Ga0209974_10000444 3300027876 Bacteria 13736
453 Ga0207428_10001382 3300027907 Bacteria 25656
454 Ga0207428_10007386 3300027907 Bacteria 10020
455 Ga0268266_10032724 3300028379 Bacteria 4418
456 Ga0268266_10215300 3300028379 Bacteria 1763
457 Ga0268266_10639244 3300028379 Bacteria 1023
458 Ga0268265_10003299 3300028380 Bacteria 11692
459 Ga0268265_10008981 3300028380 Bacteria 6761
460 Ga0268265_10071382 3300028380 Bacteria 2704
461 Ga0268265_10121191 3300028380 Bacteria 2155
462 Ga0268264_10022305 3300028381 Bacteria 5171
463 Ga0268264_10041016 3300028381 Bacteria 3826
464 Ga0268264_10086913 3300028381 Bacteria 2687
465 Ga0268264_10126390 3300028381 Bacteria 2260
466 Ga0268264_10562599 3300028381 Bacteria 1120
467 Ga0265334_10067869 3300028573 Bacteria 1332
468 Ga0307515_10002860 3300028794 Bacteria 36720
469 Ga0307408_100014069 3300031548 Bacteria 5315
470 Ga0307514_10000225 3300031649 Bacteria 151002
471 Ga0307410_10020475 3300031852 Bacteria 4047
472 Ga0307416_100004672 3300032002 Bacteria 8289
473 Ga0373948_0009901 3300034817 Bacteria 1654
474 Ga0373959_0009702 3300034820 Bacteria 1668
475 Ga0373940_0042419 3300035088 Bacteria 1254
476 Ga0373949_0036575 3300035090 Bacteria 1191
477 Ga0373932_0025953 3300035112 Bacteria 1591
478 Ga0373941_0073816 3300035115 Bacteria 1138
479 Ga0373961_0043743 3300035241 Bacteria 1303
480 Ga0373931_0030939 3300035691 Bacteria 2758
481 Ga0373931_0194808 3300035691 Bacteria 1208
482 Ga0395899_0006315 3300037312 Bacteria 9173
483 Ga0395899_0024705 3300037312 Bacteria 4542
484 Ga0395899_0187578 3300037312 Bacteria 1448
485 Ga0395900_0007881 3300037418 Bacteria 10970
486 Ga0395900_0091151 3300037418 Bacteria 3132
487 Ga0395900_0138852 3300037418 Bacteria 2489
488 Ga0395900_0144124 3300037418 Bacteria 2437
489 Ga0395898_0002751 3300037466 Bacteria 20264
490 Ga0395898_0048502 3300037466 Bacteria 4164
491 Ga0395905_0079638 3300037471 Bacteria 3071
492 Ga0436364_0227330 3300037853 Bacteria 1942
493 Ga0436364_0318669 3300037853 Bacteria 2089
494 Ga0395901_0001952 3300038443 Bacteria 21231
495 Ga0395901_0050792 3300038443 Bacteria 4307
496 Ga0395901_0280638 3300038443 Bacteria 1730
497 Ga0242420_013675 3300038996 Bacteria 1385
498 Ga0436365_0823562 3300039437 Bacteria 2008
499 Ga0436360_0271151 3300039438 Bacteria 2238
500 Ga0436360_0295164 3300039438 Bacteria 14242
501 Ga0436360_0971002 3300039438 Bacteria 1198
502 Ga0436361_0310679 3300039447 Bacteria 11236
503 Ga0436361_0647554 3300039447 Bacteria 1643
504 Ga0436363_0338563 3300039450 Bacteria 1274
505 Ga0436363_0622226 3300039450 Bacteria 1154
506 Ga0436363_0984190 3300039450 Unclassified 1334
507 Ga0436362_0239532 3300039453 Bacteria 1235
508 Ga0439445_0094398 3300042004 Bacteria 845
509 Ga0439448_0002205 3300042005 Bacteria 5265
510 Ga0439455_0006076 3300042012 Bacteria 2487
511 Ga0439460_0068026 3300042461 Bacteria 1098
512 Ga0439460_0090077 3300042461 Bacteria 974
513 Ga0451577_0012446 3300042876 Bacteria 7990
514 Ga0451577_0044704 3300042876 Bacteria 3965
515 Ga0451577_0191220 3300042876 Bacteria 1846
516 Ga0453683_0070726 3300044673 Bacteria 2182
517 Ga0466963_0376593 3300044694 Bacteria 1000
518 Ga0453684_0027427 3300044712 Bacteria 8170
519 Ga0453684_0474274 3300044712 Bacteria 1389
520 Ga0466957_0168354 3300044842 Bacteria 1426
521 Ga0451576_0040286 3300045051 Bacteria 4946
522 Ga0451576_0064991 3300045051 Bacteria 3799
523 Ga0451576_0099093 3300045051 Bacteria 3032
524 Ga0451576_0191697 3300045051 Bacteria 2135
525 Ga0451576_0196097 3300045051 Bacteria 2109
526 Ga0451576_0236908 3300045051 Bacteria 1906
527 Ga0451576_0237967 3300045051 Bacteria 1901
528 Ga0451576_0406536 3300045051 Bacteria 1427
529 Ga0451576_0575409 3300045051 Bacteria 1183
530 Ga0451576_0907534 3300045051 Bacteria 924
531 Ga0495603_0055236 3300046455 Bacteria 2353
532 Ga0495603_0117585 3300046455 Unclassified 1550
533 Ga0495591_001856 3300046458 Bacteria 12439
534 Ga0495580_0032563 3300046472 Bacteria 3761
535 Ga0495583_0170107 3300046506 Bacteria 896
536 Ga0495610_0134937 3300046512 Bacteria 1068
537 Ga0495642_0007342 3300046528 Bacteria 4230
538 Ga0495659_0178877 3300046664 Bacteria 863
539 Ga0495669_0015620 3300046684 Bacteria 3252
540 Ga0495649_0139709 3300046694 Bacteria 1276
541 Ga0495679_006589 3300047446 Bacteria 4972
542 Ga0496102_0016559 3300048905 Bacteria 6443
543 Ga0496106_0137543 3300048909 Bacteria 1920
544 Ga0496106_0459290 3300048909 Bacteria 1023
545 Ga0496112_0079049 3300048915 Bacteria 3253
546 Ga0496121_0110745 3300048924 Bacteria 2095
547 Ga0496122_0006578 3300048925 Bacteria 13272
548 Ga0496123_0054463 3300048926 Bacteria 2633
549 Ga0496124_0023226 3300048927 Bacteria 5667
550 Ga0496125_0003788 3300048928 Bacteria 17975
551 Ga0496126_0177802 3300048929 Bacteria 1809
552 Ga0496126_0245102 3300048929 Bacteria 1495
553 Ga0496126_0249733 3300048929 Bacteria 1479
554 Ga0501033_0056471 3300049570 Bacteria 2902
555 Ga0501033_0370570 3300049570 Bacteria 1001
556 Ga0501034_0001140 3300049571 Bacteria 37002
557 Ga0501034_0001685 3300049571 Bacteria 28484
558 Ga0501034_0065722 3300049571 Bacteria 3640
559 Ga0501034_0224682 3300049571 Bacteria 1829
560 Ga0501036_0000740 3300049572 Bacteria 24134
561 Ga0501036_0013100 3300049572 Bacteria 6890
562 Ga0501036_0025039 3300049572 Bacteria 5033
563 Ga0501036_0274959 3300049572 Bacteria 1410
564 Ga0501036_0278751 3300049572 Bacteria 1399
565 Ga0501038_0279568 3300049574 Bacteria 1314
566 Ga0501038_0345198 3300049574 Bacteria 1160
567 Ga0501038_0361891 3300049574 Bacteria 1128
568 Ga0501039_0010087 3300049575 Bacteria 7197
569 Ga0501039_0014086 3300049575 Bacteria 6122
570 Ga0501039_0040458 3300049575 Bacteria 3599
571 Ga0501039_0120845 3300049575 Bacteria 2053
572 Ga0501039_0166194 3300049575 Bacteria 1735
573 Ga0501039_0192874 3300049575 Bacteria 1602
574 Ga0501039_0292464 3300049575 Bacteria 1281
575 Ga0501039_0409717 3300049575 Bacteria 1065
576 Ga0501040_0004045 3300049576 Bacteria 9533
577 Ga0501040_0052461 3300049576 Bacteria 2791
578 Ga0501040_0072442 3300049576 Bacteria 2379
579 Ga0501040_0078315 3300049576 Bacteria 2287
580 Ga0501040_0138454 3300049576 Bacteria 1714
581 Ga0501040_0343168 3300049576 Bacteria 1069
582 Ga0501041_0000154 3300049577 Bacteria 30297
583 Ga0501041_0001274 3300049577 Bacteria 13864
584 Ga0501041_0005047 3300049577 Bacteria 7687
585 Ga0501041_0046269 3300049577 Bacteria 2647
586 Ga0501041_0055929 3300049577 Bacteria 2410
587 Ga0501041_0056916 3300049577 Bacteria 2390
588 Ga0501041_0088041 3300049577 Bacteria 1917
589 Ga0501041_0091658 3300049577 Bacteria 1876
590 Ga0501041_0239981 3300049577 Bacteria 1139
591 Ga0501042_0003231 3300049578 Bacteria 10188
592 Ga0501042_0045957 3300049578 Bacteria 3112
593 Ga0501042_0055387 3300049578 Bacteria 2830
594 Ga0501042_0447690 3300049578 Bacteria 936
595 Ga0501043_0056121 3300049579 Bacteria 3094
596 Ga0501046_0001642 3300049580 Bacteria 21400
597 Ga0501046_0028313 3300049580 Bacteria 4564
598 Ga0501046_0037932 3300049580 Bacteria 3870
599 Ga0501046_0448791 3300049580 Bacteria 928
600 Ga0501047_0145500 3300049581 Bacteria 2247
601 Ga0501048_0026167 3300049582 Bacteria 4248
602 Ga0501048_0030937 3300049582 Bacteria 3874
603 Ga0501048_0057693 3300049582 Bacteria 2753
604 Ga0501048_0095691 3300049582 Bacteria 2094
605 Ga0501048_0103919 3300049582 Bacteria 2005
606 Ga0501048_0122537 3300049582 Bacteria 1837
607 Ga0501048_0325381 3300049582 Bacteria 1095
608 Ga0501068_0057900 3300049584 Bacteria 2350
609 Ga0501068_0066216 3300049584 Bacteria 2200
610 Ga0501068_0095113 3300049584 Bacteria 1842
611 Ga0501068_0095789 3300049584 Bacteria 1836
612 Ga0501069_0008517 3300049585 Bacteria 5393
613 Ga0501069_0131961 3300049585 Bacteria 1431
614 Ga0501070_0136797 3300049586 Bacteria 2023
615 Ga0501071_0000173 3300049587 Bacteria 28262
616 Ga0501071_0017840 3300049587 Bacteria 4904
617 Ga0501071_0381036 3300049587 Bacteria 1075
618 Ga0501071_0412615 3300049587 Bacteria 1032
619 Ga0501072_0002324 3300049588 Bacteria 14266
620 Ga0501072_0002838 3300049588 Bacteria 12999
621 Ga0501072_0003886 3300049588 Bacteria 11297
622 Ga0501072_0011898 3300049588 Bacteria 6646
623 Ga0501072_0033115 3300049588 Bacteria 4049
624 Ga0501072_0036083 3300049588 Bacteria 3875
625 Ga0501072_0046114 3300049588 Bacteria 3429
626 Ga0501072_0177719 3300049588 Bacteria 1698
627 Ga0501072_0218015 3300049588 Bacteria 1521
628 Ga0501072_0525630 3300049588 Bacteria 935
629 Ga0501073_0251943 3300049589 Bacteria 1219
630 Ga0501073_0279556 3300049589 Bacteria 1152
631 Ga0501074_0001623 3300049590 Bacteria 15249
632 Ga0501074_0015859 3300049590 Bacteria 5479
633 Ga0501074_0162737 3300049590 Bacteria 1594
634 Ga0501075_0001228 3300049591 Bacteria 16603
635 Ga0501075_0006614 3300049591 Bacteria 7987
636 Ga0501075_0010045 3300049591 Bacteria 6641
637 Ga0501075_0012957 3300049591 Bacteria 5940
638 Ga0501075_0019621 3300049591 Bacteria 4907
639 Ga0501075_0026074 3300049591 Bacteria 4299
640 Ga0501075_0137087 3300049591 Bacteria 1864
641 Ga0501075_0144598 3300049591 Bacteria 1812
642 Ga0501075_0159617 3300049591 Bacteria 1720
643 Ga0501075_0234951 3300049591 Bacteria 1398
644 Ga0501076_0000135 3300049592 Bacteria 41430
645 Ga0501076_0002854 3300049592 Bacteria 11953
646 Ga0501076_0006280 3300049592 Bacteria 8612
647 Ga0501076_0021310 3300049592 Bacteria 4970
648 Ga0501076_0021802 3300049592 Bacteria 4918
649 Ga0501076_0068475 3300049592 Bacteria 2835
650 Ga0501076_0099535 3300049592 Bacteria 2342
651 Ga0501076_0211112 3300049592 Bacteria 1586
652 Ga0501076_0231385 3300049592 Bacteria 1511
653 Ga0501076_0266322 3300049592 Bacteria 1403
654 Ga0501077_0005576 3300049593 Bacteria 7663
655 Ga0501077_0008116 3300049593 Bacteria 6490
656 Ga0501077_0045223 3300049593 Bacteria 2797
657 Ga0501077_0142985 3300049593 Bacteria 1517
658 Ga0501252_002363 3300049682 Bacteria 1867
659 Ga0501079_0000848 3300049741 Bacteria 20849
660 Ga0501079_0003115 3300049741 Bacteria 12153
661 Ga0501079_0011877 3300049741 Bacteria 6645
662 Ga0501079_0014082 3300049741 Bacteria 6097
663 Ga0501079_0132854 3300049741 Bacteria 1937
664 Ga0501079_0173721 3300049741 Bacteria 1680
665 Ga0501080_0036955 3300049742 Bacteria 4559
666 Ga0501080_0109983 3300049742 Bacteria 2554
667 Ga0501080_0132273 3300049742 Bacteria 2310
668 Ga0501080_0297651 3300049742 Bacteria 1464
669 Ga0501080_0405726 3300049742 Bacteria 1226
670 Ga0501081_0000390 3300049743 Bacteria 24205
671 Ga0501081_0004835 3300049743 Bacteria 8656
672 Ga0501081_0007124 3300049743 Bacteria 7267
673 Ga0501081_0007312 3300049743 Bacteria 7171
674 Ga0501081_0007773 3300049743 Bacteria 6952
675 Ga0501081_0018454 3300049743 Bacteria 4633
676 Ga0501081_0036919 3300049743 Bacteria 3333
677 Ga0501081_0044350 3300049743 Bacteria 3052
678 Ga0501081_0077906 3300049743 Bacteria 2317
679 Ga0501081_0210185 3300049743 Bacteria 1413
680 Ga0501081_0242158 3300049743 Bacteria 1315
681 Ga0501083_0043997 3300049744 Bacteria 3023
682 Ga0501083_0049385 3300049744 Bacteria 2836
683 Ga0501083_0086398 3300049744 Bacteria 2074
684 Ga0501083_0107373 3300049744 Bacteria 1837
685 Ga0501035_0005442 3300049822 Bacteria 12042
686 Ga0501035_0227768 3300049822 Bacteria 1589
687 Ga0501044_0035461 3300049823 Bacteria 5224
688 Ga0501044_0337049 3300049823 Bacteria 1430
689 Ga0501044_0889685 3300049823 Bacteria 766
690 Ga0501045_0000153 3300049824 Bacteria 36957
691 Ga0501045_0003761 3300049824 Bacteria 10438
692 Ga0501045_0013066 3300049824 Bacteria 5856
693 Ga0501045_0026662 3300049824 Bacteria 4158
694 Ga0501045_0070475 3300049824 Bacteria 2572
695 Ga0501045_0072551 3300049824 Bacteria 2535
696 Ga0501045_0118327 3300049824 Bacteria 1966
697 Ga0501045_0424025 3300049824 Bacteria 990
698 Ga0501045_0464633 3300049824 Bacteria 940
699 nmdc:mga03683_25069_c1 3300050489 Bacteria 2338
700 nmdc:mga03683_6935_c1 3300050489 Bacteria 3906
701 nmdc:mga03683_7969_c1 3300050489 Bacteria 3704
702 nmdc:mga03n38_68446_c1 3300050490 Bacteria 1637
703 nmdc:mga00v17_356875_c1 3300050491 Bacteria 950
704 nmdc:mga0yw44_379153_c1 3300050492 Bacteria 955
705 nmdc:mga0yw44_4280_c1 3300050492 Bacteria 6511
706 nmdc:mga0yw44_92068_c1 3300050492 Unclassified 1918
707 nmdc:mga0k408_15888_c1 3300050493 Bacteria 4168
708 nmdc:mga0k408_5510_c1 3300050493 Bacteria 6739
709 nmdc:mga0k408_86625_c2 3300050493 Bacteria 1538
710 nmdc:mga06z11_152879_c1 3300050494 Bacteria 1313
711 nmdc:mga06z11_187045_c1 3300050494 Bacteria 1197
712 nmdc:mga06z11_34651_c1 3300050494 Bacteria 2480
713 nmdc:mga06z11_41643_c1 3300050494 Bacteria 2299
714 nmdc:mga04h51_74556_c1 3300050495 Bacteria 1192
715 nmdc:mga07m45_63284_c1 3300050496 Bacteria 2098
716 nmdc:mga05p37_105117_c1 3300050507 Bacteria 3474
717 nmdc:mga05p37_19767_c1 3300050507 Bacteria 8148
718 nmdc:mga05p37_20275_c1 3300050507 Bacteria 8045
719 nmdc:mga05p37_211702_c1 3300050507 Bacteria 2343
720 nmdc:mga05p37_225839_c1 3300050507 Bacteria 2258
721 nmdc:mga05p37_319043_c1 3300050507 Bacteria 1840
722 nmdc:mga05p37_333546_c1 3300050507 Bacteria 1791
723 nmdc:mga05p37_338913_c1 3300050507 Bacteria 1774
724 nmdc:mga05p37_339490_c1 3300050507 Bacteria 1772
725 nmdc:mga05p37_3580_c1 3300050507 Bacteria 18153
726 nmdc:mga05p37_6041_c1 3300050507 Bacteria 14253
727 nmdc:mga05p37_70070_c1 3300050507 Bacteria 4313
728 nmdc:mga05p37_995467_c1 3300050507 Bacteria 891
729 nmdc:mga09592_13704_c1 3300050508 Bacteria 6624
730 nmdc:mga09592_1873_c1 3300050508 Bacteria 16943
731 nmdc:mga09592_19635_c1 3300050508 Bacteria 5549
732 nmdc:mga09592_201689_c1 3300050508 Bacteria 1723
733 nmdc:mga09592_233566_c1 3300050508 Bacteria 1593
734 nmdc:mga09592_340028_c1 3300050508 Bacteria 1299
735 nmdc:mga09592_375463_c1 3300050508 Unclassified 1230
736 nmdc:mga09592_410429_c1 3300050508 Bacteria 1170
737 nmdc:mga09592_698_c1 3300050508 Bacteria 25682
738 nmdc:mga0qj67_211891_c1 3300050509 Bacteria 1573
739 nmdc:mga0qj67_26761_c1 3300050509 Bacteria 4466
740 nmdc:mga0qj67_28307_c1 3300050509 Bacteria 4349
741 nmdc:mga0qj67_64838_c1 3300050509 Bacteria 2907
742 nmdc:mga0qj67_75201_c1 3300050509 Bacteria 2700
743 nmdc:mga0qj67_9465_c1 3300050509 Bacteria 7252
744 nmdc:mga06r32_126179_c1 3300050510 Bacteria 2528
745 nmdc:mga06r32_177_c2 3300050510 Bacteria 42810
746 nmdc:mga06r32_21819_c1 3300050510 Bacteria 5913
747 nmdc:mga06r32_28822_c1 3300050510 Bacteria 5197
748 nmdc:mga06r32_28865_c1 3300050510 Bacteria 5194
749 nmdc:mga06r32_296416_c1 3300050510 Unclassified 1603
750 nmdc:mga06r32_3203_c1 3300050510 Bacteria 14655
751 nmdc:mga06r32_3977_c1 3300050510 Bacteria 13249
752 nmdc:mga06r32_51244_c1 3300050510 Bacteria 3950
753 nmdc:mga06r32_607_c1 3300050510 Bacteria 31296
754 nmdc:mga06r32_97261_c1 3300050510 Bacteria 2884
755 nmdc:mga08y16_22564_c1 3300050511 Bacteria 6646
756 nmdc:mga08y16_332657_c1 3300050511 Unclassified 1562
757 nmdc:mga08y16_3338_c1 3300050511 Bacteria 16625
758 nmdc:mga08y16_384379_c1 3300050511 Bacteria 1438
759 nmdc:mga0n895_102283_c1 3300050512 Bacteria 2876
760 nmdc:mga0n895_131283_c1 3300050512 Bacteria 2530
761 nmdc:mga0n895_137069_c1 3300050512 Bacteria 2474
762 nmdc:mga0n895_175649_c1 3300050512 Bacteria 2173
763 nmdc:mga0n895_19871_c1 3300050512 Bacteria 6253
764 nmdc:mga0n895_23058_c1 3300050512 Bacteria 5846
765 nmdc:mga0n895_31187_c1 3300050512 Bacteria 5101
766 nmdc:mga0n895_640810_c1 3300050512 Bacteria 1062
767 nmdc:mga0rr50_151901_c1 3300050513 Bacteria 1872
768 nmdc:mga0rr50_25031_c1 3300050513 Bacteria 4144
769 nmdc:mga0rr50_47342_c1 3300050513 Bacteria 3172
770 nmdc:mga0rr50_87989_c1 3300050513 Bacteria 2412
771 nmdc:mga08x19_102637_c1 3300050514 Bacteria 1899
772 nmdc:mga08x19_30611_c1 3300050514 Bacteria 3383
773 nmdc:mga08x19_325116_c1 3300050514 Bacteria 1071
774 nmdc:mga08x19_41282_c1 3300050514 Bacteria 2938
775 nmdc:mga08x19_43508_c1 3300050514 Bacteria 2865
776 nmdc:mga0a205_117679_c1 3300050515 Bacteria 2556
777 nmdc:mga0a205_149209_c2 3300050515 Bacteria 1813
778 nmdc:mga0a205_1873_c1 3300050515 Bacteria 5504
779 nmdc:mga0a205_209357_c1 3300050515 Bacteria 1839
780 nmdc:mga0a205_454707_c1 3300050515 Bacteria 1140
781 nmdc:mga0a205_548789_c1 3300050515 Bacteria 1011
782 nmdc:mga0a205_5638_c1 3300050515 Bacteria 11279
783 nmdc:mga0a205_5653_c1 3300050515 Bacteria 11262
784 nmdc:mga0a205_68840_c2 3300050515 Bacteria 3063
785 nmdc:mga0a205_98488_c1 3300050515 Bacteria 2823
786 nmdc:mga0sz30_16023_c1 3300050516 Bacteria 2968
787 nmdc:mga0sz30_272_c1 3300050516 Bacteria 19782
788 nmdc:mga0sz30_29192_c1 3300050516 Bacteria 2272
789 Ga0500641_0000921 3300053096 Bacteria 10489
790 Ga0500568_0015427 3300053139 Bacteria 3422
791 Ga0500568_0033190 3300053139 Bacteria 2120
792 Ga0500616_0000049 3300053153 Bacteria 303396
793 Ga0500616_0003288 3300053153 Bacteria 12474
794 Ga0500552_000672 3300053733 Bacteria 3209
795 Ga0501084_0002524 3300054114 Bacteria 14739
796 Ga0501084_0006956 3300054114 Bacteria 9317
797 Ga0501084_0007572 3300054114 Bacteria 8952
798 Ga0501084_0017218 3300054114 Bacteria 6003
799 Ga0501084_0019931 3300054114 Bacteria 5590
800 Ga0501084_0032796 3300054114 Bacteria 4346
801 Ga0501084_0077367 3300054114 Bacteria 2789
802 Ga0501084_0174351 3300054114 Bacteria 1815
803 Ga0501084_0177246 3300054114 Bacteria 1799
804 Ga0501084_0451588 3300054114 Bacteria 1087
805 Ga0501084_0496376 3300054114 Bacteria 1031
806 Ga0501082_0002472 3300060353 Bacteria 16208
807 Ga0501082_0004029 3300060353 Bacteria 12824
808 Ga0501082_0005991 3300060353 Bacteria 10543
809 Ga0501082_0015900 3300060353 Bacteria 6471
810 Ga0501082_0023316 3300060353 Bacteria 5339
811 Ga0501082_0146411 3300060353 Bacteria 2051
812 Ga0501082_0174168 3300060353 Bacteria 1871
813 Ga0501082_0214455 3300060353 Bacteria 1675
814 Ga0501082_0226349 3300060353 Bacteria 1627
815 Ga0530510_0000111 3300061734 Bacteria 45793
816 Ga0530510_0007660 3300061734 Bacteria 7520
817 Ga0530510_0008725 3300061734 Bacteria 7089
818 Ga0530510_0022598 3300061734 Bacteria 4480
819 Ga0530510_0024089 3300061734 Bacteria 4342
820 Ga0530510_0035253 3300061734 Bacteria 3606
821 Ga0530510_0052534 3300061734 Bacteria 2945
822 Ga0530510_0119482 3300061734 Bacteria 1934
823 Ga0530510_0135924 3300061734 Bacteria 1810
824 Ga0530510_0412896 3300061734 Bacteria 1018

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100996886 Ga0068856_1009968861 213
2 3300026078 Ga0207702_10276865 Ga0207702_102768653 213
3 3300044673 Ga0453683_0070726 Ga0453683_0070726_14_664 214
4 3300049575 Ga0501039_0010087 Ga0501039_0010087_2779_3435 216
5 3300028794 Ga0307515_10002860 Ga0307515_100028603 221
6 3300005435 Ga0070714_100138327 Ga0070714_1001383272 223
7 3300035241 Ga0373961_0043743 Ga0373961_0043743_25_708 225
8 3300005546 Ga0070696_100355117 Ga0070696_1003551172 226
9 3300006880 Ga0075429_100037126 Ga0075429_1000371264 226
10 3300049744 Ga0501083_0086398 Ga0501083_0086398_672_1361 228
11 3300049582 Ga0501048_0026167 Ga0501048_0026167_1723_2427 229
12 iso_pu_bacteria 3005474847 3005482773 230
13 iso_pu_bacteria 2791355197 2793072877 232
14 iso_pu_bacteria 2885374607 2885382879 232
15 iso_pu_bacteria 2903748898 2903751460 232
16 iso_pu_bacteria 2906610324 2906612647 232
17 iso_pu_bacteria 2908739725 2908745894 232
18 iso_pu_bacteria 2922425934 2922433146 232
19 iso_pu_bacteria 8019555841 8019563623 232
20 iso_pu_bacteria 8019565922 8019573692 232
21 3300025302 Ga0207426_1018722 Ga0207426_10187222 234
22 iso_pu_bacteria 2835312727 2835316602 234
23 iso_pu_bacteria 2643221736 2644745051 235
24 iso_pu_bacteria 2841760612 2841766435 235
25 iso_pu_bacteria 2844104063 2844106202 235
26 iso_pu_bacteria 2851182111 2851186709 235
27 iso_pu_bacteria 2851246043 2851246558 235
28 iso_pu_bacteria 8057529695 8057531249 235
29 3300005344 Ga0070661_100372950 Ga0070661_1003729501 236
30 3300005535 Ga0070684_100083507 Ga0070684_1000835074 236
31 3300005563 Ga0068855_100060940 Ga0068855_1000609404 236
32 3300005614 Ga0068856_100029789 Ga0068856_1000297893 236
33 3300005616 Ga0068852_100131186 Ga0068852_1001311863 236
34 3300006237 Ga0097621_100240038 Ga0097621_1002400382 236
35 3300006942 Ga0099824_1007022 Ga0099824_10070225 236
36 3300006943 Ga0099822_1009294 Ga0099822_10092942 236
37 3300009093 Ga0105240_10053725 Ga0105240_100537255 236
38 3300009551 Ga0105238_10152411 Ga0105238_101524111 236
39 3300010375 Ga0105239_10223944 Ga0105239_102239443 236
40 3300013105 Ga0157369_10062721 Ga0157369_100627211 236
41 3300013307 Ga0157372_10461961 Ga0157372_104619612 236
42 3300021361 Ga0213872_10012842 Ga0213872_100128424 236
43 3300025261 Ga0209233_1004054 Ga0209233_10040542 236
44 3300025302 Ga0207426_1038171 Ga0207426_10381712 236
45 3300025913 Ga0207695_10211114 Ga0207695_102111141 236
46 3300025919 Ga0207657_10084831 Ga0207657_100848312 236
47 3300025944 Ga0207661_10082695 Ga0207661_100826953 236
48 3300025945 Ga0207679_10043239 Ga0207679_100432394 236
49 3300025949 Ga0207667_10184336 Ga0207667_101843362 236
50 3300026023 Ga0207677_10110330 Ga0207677_101103302 236
51 3300026078 Ga0207702_10011216 Ga0207702_100112165 236
52 3300026089 Ga0207648_10609629 Ga0207648_106096291 236
53 3300026121 Ga0207683_10093701 Ga0207683_100937013 236
54 3300026142 Ga0207698_10133761 Ga0207698_101337612 236
55 3300027357 Ga0209589_1000005 Ga0209589_100000527 236
56 3300027361 Ga0209489_100005 Ga0209489_10000527 236
57 3300027363 Ga0209700_100006 Ga0209700_10000627 236
58 3300037312 Ga0395899_0187578 Ga0395899_0187578_474_1184 236
59 3300037418 Ga0395900_0138852 Ga0395900_0138852_145_855 236
60 3300038443 Ga0395901_0050792 Ga0395901_0050792_3498_4208 236
61 3300039447 Ga0436361_0310679 Ga0436361_0310679_2698_3414 236
62 3300044694 Ga0466963_0376593 Ga0466963_0376593_252_962 236
63 3300044842 Ga0466957_0168354 Ga0466957_0168354_608_1318 236
64 3300048924 Ga0496121_0110745 Ga0496121_0110745_1039_1749 236
65 3300049571 Ga0501034_0001140 Ga0501034_0001140_17964_18674 236
66 3300053139 Ga0500568_0015427 Ga0500568_0015427_2642_3352 236
67 iso_pu_bacteria 2917699015 2917704997 236
68 3300005354 Ga0070675_100151200 Ga0070675_1001512002 237
69 3300005445 Ga0070708_100101537 Ga0070708_1001015373 237
70 3300005536 Ga0070697_100045380 Ga0070697_1000453801 237
71 3300005548 Ga0070665_100023733 Ga0070665_1000237334 237
72 3300005549 Ga0070704_100105200 Ga0070704_1001052004 237
73 3300005563 Ga0068855_100797259 Ga0068855_1007972592 237
74 3300005577 Ga0068857_100187741 Ga0068857_1001877412 237
75 3300005937 Ga0081455_10002921 Ga0081455_1000292115 237
76 3300005985 Ga0081539_10000987 Ga0081539_1000098721 237
77 3300006038 Ga0075365_10075004 Ga0075365_100750042 237
78 3300006038 Ga0075365_10398663 Ga0075365_103986632 237
79 3300006177 Ga0075362_10038829 Ga0075362_100388292 237
80 3300006195 Ga0075366_10011726 Ga0075366_100117265 237
81 3300006844 Ga0075428_100006328 Ga0075428_10000632811 237
82 3300006844 Ga0075428_100147622 Ga0075428_1001476222 237
83 3300006844 Ga0075428_100576434 Ga0075428_1005764342 237
84 3300006846 Ga0075430_100000574 Ga0075430_10000057426 237
85 3300006846 Ga0075430_100000927 Ga0075430_10000092714 237
86 3300006847 Ga0075431_100000175 Ga0075431_10000017523 237
87 3300006847 Ga0075431_100000339 Ga0075431_1000003392 237
88 3300006852 Ga0075433_10071747 Ga0075433_100717472 237
89 3300006871 Ga0075434_100235891 Ga0075434_1002358915 237
90 3300006880 Ga0075429_100000014 Ga0075429_10000001413 237
91 3300006880 Ga0075429_100233879 Ga0075429_1002338792 237
92 3300006914 Ga0075436_100047501 Ga0075436_1000475013 237
93 3300007265 Ga0099794_10057983 Ga0099794_100579832 237
94 3300009147 Ga0114129_10001148 Ga0114129_1000114814 237
95 3300009147 Ga0114129_10064303 Ga0114129_100643033 237
96 3300009147 Ga0114129_10668703 Ga0114129_106687032 237
97 3300013104 Ga0157370_10069916 Ga0157370_100699164 237
98 3300013105 Ga0157369_10358630 Ga0157369_103586301 237
99 3300014969 Ga0157376_10905306 Ga0157376_109053061 237
100 3300021384 Ga0213876_10001267 Ga0213876_1000126711 237
101 3300021384 Ga0213876_10046438 Ga0213876_100464383 237
102 3300021388 Ga0213875_10001514 Ga0213875_100015143 237
103 3300021388 Ga0213875_10041336 Ga0213875_100413362 237
104 3300025304 Ga0209257_1009440 Ga0209257_10094402 237
105 3300027671 Ga0209588_1103649 Ga0209588_11036492 237
106 3300028379 Ga0268266_10032724 Ga0268266_100327244 237
107 3300028379 Ga0268266_10215300 Ga0268266_102153003 237
108 3300037312 Ga0395899_0024705 Ga0395899_0024705_927_1640 237
109 3300037418 Ga0395900_0007881 Ga0395900_0007881_6680_7393 237
110 3300037418 Ga0395900_0091151 Ga0395900_0091151_762_1475 237
111 3300037466 Ga0395898_0002751 Ga0395898_0002751_17534_18247 237
112 3300037466 Ga0395898_0048502 Ga0395898_0048502_3339_4052 237
113 3300037853 Ga0436364_0227330 Ga0436364_0227330_712_1425 237
114 3300037853 Ga0436364_0318669 Ga0436364_0318669_475_1188 237
115 3300038443 Ga0395901_0280638 Ga0395901_0280638_807_1520 237
116 3300039437 Ga0436365_0823562 Ga0436365_0823562_1242_1955 237
117 3300039438 Ga0436360_0271151 Ga0436360_0271151_915_1634 237
118 3300039450 Ga0436363_0338563 Ga0436363_0338563_439_1152 237
119 3300039450 Ga0436363_0622226 Ga0436363_0622226_34_747 237
120 3300039450 Ga0436363_0984190 Ga0436363_0984190_309_1022 237
121 3300039453 Ga0436362_0239532 Ga0436362_0239532_188_901 237
122 3300049571 Ga0501034_0001685 Ga0501034_0001685_8054_8767 237
123 3300049571 Ga0501034_0065722 Ga0501034_0065722_105_818 237
124 3300049575 Ga0501039_0192874 Ga0501039_0192874_187_912 237
125 3300049577 Ga0501041_0088041 Ga0501041_0088041_120_845 237
126 3300049584 Ga0501068_0057900 Ga0501068_0057900_331_1044 237
127 3300049589 Ga0501073_0279556 Ga0501073_0279556_338_1084 237
128 3300049591 Ga0501075_0234951 Ga0501075_0234951_552_1277 237
129 3300049592 Ga0501076_0266322 Ga0501076_0266322_520_1236 237
130 3300049823 Ga0501044_0337049 Ga0501044_0337049_207_953 237
131 3300050491 nmdc:mga00v17_356875_c1 nmdc:mga00v17_356875_c1_164_877 237
132 3300050492 nmdc:mga0yw44_379153_c1 nmdc:mga0yw44_379153_c1_95_808 237
133 3300050493 nmdc:mga0k408_5510_c1 nmdc:mga0k408_5510_c1_3137_3850 237
134 3300050494 nmdc:mga06z11_34651_c1 nmdc:mga06z11_34651_c1_519_1232 237
135 3300050495 nmdc:mga04h51_74556_c1 nmdc:mga04h51_74556_c1_36_749 237
136 3300050507 nmdc:mga05p37_20275_c1 nmdc:mga05p37_20275_c1_1832_2545 237
137 3300050507 nmdc:mga05p37_333546_c1 nmdc:mga05p37_333546_c1_124_837 237
138 3300050507 nmdc:mga05p37_6041_c1 nmdc:mga05p37_6041_c1_11315_12028 237
139 3300050508 nmdc:mga09592_1873_c1 nmdc:mga09592_1873_c1_3831_4544 237
140 3300050508 nmdc:mga09592_201689_c1 nmdc:mga09592_201689_c1_331_1044 237
141 3300050508 nmdc:mga09592_233566_c1 nmdc:mga09592_233566_c1_624_1337 237
142 3300050509 nmdc:mga0qj67_75201_c1 nmdc:mga0qj67_75201_c1_1581_2294 237
143 3300050509 nmdc:mga0qj67_9465_c1 nmdc:mga0qj67_9465_c1_6468_7181 237
144 3300050510 nmdc:mga06r32_126179_c1 nmdc:mga06r32_126179_c1_1743_2462 237
145 3300050510 nmdc:mga06r32_21819_c1 nmdc:mga06r32_21819_c1_794_1507 237
146 3300050510 nmdc:mga06r32_28865_c1 nmdc:mga06r32_28865_c1_4240_4953 237
147 3300050511 nmdc:mga08y16_384379_c1 nmdc:mga08y16_384379_c1_174_887 237
148 3300050514 nmdc:mga08x19_41282_c1 nmdc:mga08x19_41282_c1_1204_1920 237
149 3300005334 Ga0068869_100059150 Ga0068869_1000591502 238
150 3300005336 Ga0070680_100024718 Ga0070680_1000247184 238
151 3300005336 Ga0070680_100076697 Ga0070680_1000766972 238
152 3300005353 Ga0070669_100004143 Ga0070669_10000414311 238
153 3300005355 Ga0070671_100352430 Ga0070671_1003524302 238
154 3300005440 Ga0070705_100220315 Ga0070705_1002203152 238
155 3300005444 Ga0070694_100046033 Ga0070694_1000460332 238
156 3300005444 Ga0070694_100228047 Ga0070694_1002280472 238
157 3300005445 Ga0070708_100002595 Ga0070708_10000259513 238
158 3300005445 Ga0070708_100083872 Ga0070708_1000838724 238
159 3300005457 Ga0070662_100505597 Ga0070662_1005055972 238
160 3300005467 Ga0070706_100054082 Ga0070706_1000540824 238
161 3300005467 Ga0070706_100384937 Ga0070706_1003849372 238
162 3300005468 Ga0070707_100337738 Ga0070707_1003377382 238
163 3300005471 Ga0070698_100152099 Ga0070698_1001520992 238
164 3300005518 Ga0070699_100002140 Ga0070699_1000021406 238
165 3300005518 Ga0070699_100022970 Ga0070699_1000229703 238
166 3300005518 Ga0070699_100031074 Ga0070699_1000310744 238
167 3300005536 Ga0070697_100000743 Ga0070697_10000074324 238
168 3300005539 Ga0068853_100003483 Ga0068853_1000034835 238
169 3300005543 Ga0070672_100099583 Ga0070672_1000995832 238
170 3300005545 Ga0070695_100215625 Ga0070695_1002156251 238
171 3300005546 Ga0070696_100094329 Ga0070696_1000943292 238
172 3300005546 Ga0070696_100181611 Ga0070696_1001816112 238
173 3300005548 Ga0070665_100301267 Ga0070665_1003012672 238
174 3300005549 Ga0070704_100051906 Ga0070704_1000519062 238
175 3300005577 Ga0068857_100015839 Ga0068857_1000158393 238
176 3300005577 Ga0068857_100222219 Ga0068857_1002222192 238
177 3300005615 Ga0070702_100257136 Ga0070702_1002571362 238
178 3300005617 Ga0068859_100507030 Ga0068859_1005070302 238
179 3300005718 Ga0068866_10026817 Ga0068866_100268172 238
180 3300005843 Ga0068860_100089118 Ga0068860_1000891184 238
181 3300005844 Ga0068862_100038664 Ga0068862_1000386642 238
182 3300005937 Ga0081455_10152553 Ga0081455_101525533 238
183 3300006051 Ga0075364_10147677 Ga0075364_101476772 238
184 3300006058 Ga0075432_10021510 Ga0075432_100215102 238
185 3300006177 Ga0075362_10051055 Ga0075362_100510552 238
186 3300006178 Ga0075367_10401428 Ga0075367_104014281 238
187 3300006186 Ga0075369_10011196 Ga0075369_100111963 238
188 3300006186 Ga0075369_10211558 Ga0075369_102115581 238
189 3300006844 Ga0075428_100004148 Ga0075428_10000414817 238
190 3300006844 Ga0075428_100356377 Ga0075428_1003563772 238
191 3300006847 Ga0075431_100000271 Ga0075431_10000027135 238
192 3300006847 Ga0075431_100052712 Ga0075431_1000527122 238
193 3300006852 Ga0075433_10021301 Ga0075433_100213018 238
194 3300006852 Ga0075433_10560791 Ga0075433_105607911 238
195 3300006871 Ga0075434_100021782 Ga0075434_1000217825 238
196 3300006871 Ga0075434_100056776 Ga0075434_1000567764 238
197 3300006871 Ga0075434_100281077 Ga0075434_1002810772 238
198 3300006880 Ga0075429_100012908 Ga0075429_1000129081 238
199 3300006880 Ga0075429_100208957 Ga0075429_1002089572 238
200 3300006880 Ga0075429_100357569 Ga0075429_1003575692 238
201 3300006881 Ga0068865_100493833 Ga0068865_1004938332 238
202 3300006881 Ga0068865_100575861 Ga0068865_1005758611 238
203 3300006914 Ga0075436_100011714 Ga0075436_1000117144 238
204 3300006931 Ga0097620_100507018 Ga0097620_1005070182 238
205 3300009094 Ga0111539_10016351 Ga0111539_100163512 238
206 3300009094 Ga0111539_10089708 Ga0111539_100897083 238
207 3300009147 Ga0114129_10000495 Ga0114129_1000049510 238
208 3300009147 Ga0114129_10000499 Ga0114129_1000049940 238
209 3300009147 Ga0114129_10318271 Ga0114129_103182713 238
210 3300009148 Ga0105243_10084234 Ga0105243_100842342 238
211 3300009148 Ga0105243_10474004 Ga0105243_104740041 238
212 3300009174 Ga0105241_10032631 Ga0105241_100326312 238
213 3300009176 Ga0105242_10034543 Ga0105242_100345434 238
214 3300009553 Ga0105249_10268770 Ga0105249_102687702 238
215 3300013297 Ga0157378_10135851 Ga0157378_101358512 238
216 3300013306 Ga0163162_10151029 Ga0163162_101510292 238
217 3300013308 Ga0157375_10081679 Ga0157375_100816792 238
218 3300025899 Ga0207642_10273493 Ga0207642_102734932 238
219 3300025910 Ga0207684_10000474 Ga0207684_1000047424 238
220 3300025910 Ga0207684_10049419 Ga0207684_100494192 238
221 3300025917 Ga0207660_10012826 Ga0207660_100128265 238
222 3300025917 Ga0207660_10043871 Ga0207660_100438712 238
223 3300025922 Ga0207646_10002578 Ga0207646_100025788 238
224 3300025923 Ga0207681_10031954 Ga0207681_100319543 238
225 3300025931 Ga0207644_10312978 Ga0207644_103129781 238
226 3300025933 Ga0207706_10213637 Ga0207706_102136372 238
227 3300025934 Ga0207686_10011545 Ga0207686_100115454 238
228 3300025935 Ga0207709_10047777 Ga0207709_100477772 238
229 3300025938 Ga0207704_10437174 Ga0207704_104371741 238
230 3300025940 Ga0207691_10060187 Ga0207691_100601873 238
231 3300025942 Ga0207689_10060382 Ga0207689_100603822 238
232 3300025961 Ga0207712_10126919 Ga0207712_101269193 238
233 3300025961 Ga0207712_10390862 Ga0207712_103908621 238
234 3300026041 Ga0207639_10007661 Ga0207639_100076615 238
235 3300026089 Ga0207648_10132385 Ga0207648_101323852 238
236 3300026116 Ga0207674_10010341 Ga0207674_100103416 238
237 3300026118 Ga0207675_100203496 Ga0207675_1002034962 238
238 3300026142 Ga0207698_10196498 Ga0207698_101964982 238
239 3300027907 Ga0207428_10007386 Ga0207428_1000738612 238
240 3300028379 Ga0268266_10639244 Ga0268266_106392441 238
241 3300028380 Ga0268265_10121191 Ga0268265_101211912 238
242 3300028381 Ga0268264_10086913 Ga0268264_100869132 238
243 3300028381 Ga0268264_10562599 Ga0268264_105625991 238
244 3300028573 Ga0265334_10067869 Ga0265334_100678692 238
245 3300031548 Ga0307408_100014069 Ga0307408_1000140694 238
246 3300032002 Ga0307416_100004672 Ga0307416_1000046723 238
247 3300034817 Ga0373948_0009901 Ga0373948_0009901_346_1086 238
248 3300035088 Ga0373940_0042419 Ga0373940_0042419_397_1137 238
249 3300035691 Ga0373931_0030939 Ga0373931_0030939_484_1224 238
250 3300037471 Ga0395905_0079638 Ga0395905_0079638_752_1471 238
251 3300038996 Ga0242420_013675 Ga0242420_013675_26_751 238
252 3300039438 Ga0436360_0971002 Ga0436360_0971002_134_850 238
253 3300042876 Ga0451577_0044704 Ga0451577_0044704_1582_2322 238
254 3300044712 Ga0453684_0474274 Ga0453684_0474274_650_1369 238
255 3300046455 Ga0495603_0055236 Ga0495603_0055236_893_1612 238
256 3300046528 Ga0495642_0007342 Ga0495642_0007342_2479_3198 238
257 3300046664 Ga0495659_0178877 Ga0495659_0178877_86_805 238
258 3300046684 Ga0495669_0015620 Ga0495669_0015620_1898_2617 238
259 3300048905 Ga0496102_0016559 Ga0496102_0016559_4542_5282 238
260 3300048909 Ga0496106_0137543 Ga0496106_0137543_1016_1756 238
261 3300049570 Ga0501033_0370570 Ga0501033_0370570_64_795 238
262 3300049572 Ga0501036_0000740 Ga0501036_0000740_21552_22268 238
263 3300049572 Ga0501036_0013100 Ga0501036_0013100_2713_3435 238
264 3300049572 Ga0501036_0274959 Ga0501036_0274959_54_785 238
265 3300049572 Ga0501036_0278751 Ga0501036_0278751_130_846 238
266 3300049574 Ga0501038_0345198 Ga0501038_0345198_381_1097 238
267 3300049575 Ga0501039_0014086 Ga0501039_0014086_2665_3381 238
268 3300049575 Ga0501039_0120845 Ga0501039_0120845_1085_1801 238
269 3300049575 Ga0501039_0409717 Ga0501039_0409717_25_756 238
270 3300049576 Ga0501040_0004045 Ga0501040_0004045_1327_2043 238
271 3300049576 Ga0501040_0078315 Ga0501040_0078315_1406_2128 238
272 3300049577 Ga0501041_0000154 Ga0501041_0000154_23996_24712 238
273 3300049577 Ga0501041_0005047 Ga0501041_0005047_972_1694 238
274 3300049577 Ga0501041_0046269 Ga0501041_0046269_655_1377 238
275 3300049578 Ga0501042_0003231 Ga0501042_0003231_3539_4255 238
276 3300049578 Ga0501042_0045957 Ga0501042_0045957_2293_3015 238
277 3300049578 Ga0501042_0447690 Ga0501042_0447690_118_840 238
278 3300049580 Ga0501046_0001642 Ga0501046_0001642_15717_16433 238
279 3300049580 Ga0501046_0037932 Ga0501046_0037932_2156_2887 238
280 3300049582 Ga0501048_0030937 Ga0501048_0030937_3107_3829 238
281 3300049582 Ga0501048_0057693 Ga0501048_0057693_1776_2492 238
282 3300049582 Ga0501048_0103919 Ga0501048_0103919_1003_1725 238
283 3300049582 Ga0501048_0325381 Ga0501048_0325381_315_1031 238
284 3300049584 Ga0501068_0066216 Ga0501068_0066216_622_1344 238
285 3300049586 Ga0501070_0136797 Ga0501070_0136797_656_1372 238
286 3300049587 Ga0501071_0000173 Ga0501071_0000173_24006_24722 238
287 3300049587 Ga0501071_0017840 Ga0501071_0017840_3990_4721 238
288 3300049587 Ga0501071_0381036 Ga0501071_0381036_87_809 238
289 3300049588 Ga0501072_0002324 Ga0501072_0002324_1010_1726 238
290 3300049588 Ga0501072_0002838 Ga0501072_0002838_3954_4676 238
291 3300049588 Ga0501072_0011898 Ga0501072_0011898_413_1159 238
292 3300049588 Ga0501072_0046114 Ga0501072_0046114_2345_3076 238
293 3300049590 Ga0501074_0015859 Ga0501074_0015859_1595_2311 238
294 3300049591 Ga0501075_0001228 Ga0501075_0001228_7455_8177 238
295 3300049591 Ga0501075_0006614 Ga0501075_0006614_6045_6761 238
296 3300049591 Ga0501075_0159617 Ga0501075_0159617_509_1255 238
297 3300049592 Ga0501076_0000135 Ga0501076_0000135_18302_19024 238
298 3300049592 Ga0501076_0002854 Ga0501076_0002854_5422_6138 238
299 3300049592 Ga0501076_0021802 Ga0501076_0021802_3919_4635 238
300 3300049592 Ga0501076_0068475 Ga0501076_0068475_1612_2343 238
301 3300049592 Ga0501076_0231385 Ga0501076_0231385_45_767 238
302 3300049593 Ga0501077_0005576 Ga0501077_0005576_6206_6922 238
303 3300049593 Ga0501077_0008116 Ga0501077_0008116_4938_5654 238
304 3300049682 Ga0501252_002363 Ga0501252_002363_525_1241 238
305 3300049741 Ga0501079_0003115 Ga0501079_0003115_8901_9617 238
306 3300049741 Ga0501079_0011877 Ga0501079_0011877_3632_4348 238
307 3300049741 Ga0501079_0132854 Ga0501079_0132854_981_1703 238
308 3300049742 Ga0501080_0036955 Ga0501080_0036955_3270_3992 238
309 3300049742 Ga0501080_0132273 Ga0501080_0132273_1235_1966 238
310 3300049743 Ga0501081_0004835 Ga0501081_0004835_5657_6379 238
311 3300049743 Ga0501081_0007773 Ga0501081_0007773_1536_2252 238
312 3300049743 Ga0501081_0044350 Ga0501081_0044350_815_1537 238
313 3300049743 Ga0501081_0077906 Ga0501081_0077906_859_1590 238
314 3300049743 Ga0501081_0210185 Ga0501081_0210185_375_1097 238
315 3300049822 Ga0501035_0005442 Ga0501035_0005442_2369_3085 238
316 3300049822 Ga0501035_0227768 Ga0501035_0227768_163_885 238
317 3300049824 Ga0501045_0000153 Ga0501045_0000153_5878_6594 238
318 3300049824 Ga0501045_0013066 Ga0501045_0013066_1265_1987 238
319 3300049824 Ga0501045_0026662 Ga0501045_0026662_2210_2941 238
320 3300049824 Ga0501045_0070475 Ga0501045_0070475_1650_2372 238
321 3300050489 nmdc:mga03683_6935_c1 nmdc:mga03683_6935_c1_545_1261 238
322 3300050494 nmdc:mga06z11_41643_c1 nmdc:mga06z11_41643_c1_1482_2198 238
323 3300050496 nmdc:mga07m45_63284_c1 nmdc:mga07m45_63284_c1_360_1076 238
324 3300050507 nmdc:mga05p37_105117_c1 nmdc:mga05p37_105117_c1_10_732 238
325 3300050507 nmdc:mga05p37_319043_c1 nmdc:mga05p37_319043_c1_941_1660 238
326 3300050507 nmdc:mga05p37_3580_c1 nmdc:mga05p37_3580_c1_10449_11168 238
327 3300050508 nmdc:mga09592_13704_c1 nmdc:mga09592_13704_c1_98_817 238
328 3300050508 nmdc:mga09592_340028_c1 nmdc:mga09592_340028_c1_365_1084 238
329 3300050508 nmdc:mga09592_410429_c1 nmdc:mga09592_410429_c1_61_780 238
330 3300050509 nmdc:mga0qj67_211891_c1 nmdc:mga0qj67_211891_c1_420_1136 238
331 3300050510 nmdc:mga06r32_3977_c1 nmdc:mga06r32_3977_c1_4064_4783 238
332 3300050510 nmdc:mga06r32_97261_c1 nmdc:mga06r32_97261_c1_2084_2800 238
333 3300050511 nmdc:mga08y16_332657_c1 nmdc:mga08y16_332657_c1_732_1460 238
334 3300050511 nmdc:mga08y16_3338_c1 nmdc:mga08y16_3338_c1_6658_7377 238
335 3300050512 nmdc:mga0n895_102283_c1 nmdc:mga0n895_102283_c1_987_1706 238
336 3300050512 nmdc:mga0n895_19871_c1 nmdc:mga0n895_19871_c1_3811_4527 238
337 3300050512 nmdc:mga0n895_640810_c1 nmdc:mga0n895_640810_c1_36_755 238
338 3300050513 nmdc:mga0rr50_47342_c1 nmdc:mga0rr50_47342_c1_784_1503 238
339 3300050514 nmdc:mga08x19_30611_c1 nmdc:mga08x19_30611_c1_656_1375 238
340 3300050514 nmdc:mga08x19_43508_c1 nmdc:mga08x19_43508_c1_1804_2520 238
341 3300050515 nmdc:mga0a205_149209_c2 nmdc:mga0a205_149209_c2_50_766 238
342 3300050515 nmdc:mga0a205_548789_c1 nmdc:mga0a205_548789_c1_223_942 238
343 3300050515 nmdc:mga0a205_5638_c1 nmdc:mga0a205_5638_c1_3155_3874 238
344 3300050516 nmdc:mga0sz30_272_c1 nmdc:mga0sz30_272_c1_9100_9816 238
345 3300053153 Ga0500616_0000049 Ga0500616_0000049_257796_258512 238
346 3300054114 Ga0501084_0007572 Ga0501084_0007572_5153_5875 238
347 3300054114 Ga0501084_0019931 Ga0501084_0019931_1480_2196 238
348 3300054114 Ga0501084_0077367 Ga0501084_0077367_1762_2493 238
349 3300054114 Ga0501084_0451588 Ga0501084_0451588_77_823 238
350 3300054114 Ga0501084_0496376 Ga0501084_0496376_119_841 238
351 3300060353 Ga0501082_0002472 Ga0501082_0002472_290_1006 238
352 3300060353 Ga0501082_0004029 Ga0501082_0004029_2730_3452 238
353 3300060353 Ga0501082_0023316 Ga0501082_0023316_1691_2407 238
354 3300060353 Ga0501082_0146411 Ga0501082_0146411_292_1014 238
355 3300060353 Ga0501082_0174168 Ga0501082_0174168_1074_1820 238
356 3300061734 Ga0530510_0000111 Ga0530510_0000111_18247_18969 238
357 3300061734 Ga0530510_0007660 Ga0530510_0007660_721_1437 238
358 3300061734 Ga0530510_0412896 Ga0530510_0412896_16_762 238
359 iso_pu_bacteria 2844533157 2844539196 238
360 3300003187 JGI25151J46595_10058202 JGI25151J46595_100582022 239
361 3300004625 Ga0055543_1019236 Ga0055543_10192362 239
362 3300005262 Ga0065165_1000048 Ga0065165_1000048110 239
363 3300005293 Ga0065715_10118382 Ga0065715_101183822 239
364 3300005327 Ga0070658_10001208 Ga0070658_1000120818 239
365 3300005328 Ga0070676_10001167 Ga0070676_100011674 239
366 3300005330 Ga0070690_100046364 Ga0070690_1000463642 239
367 3300005331 Ga0070670_100006723 Ga0070670_1000067232 239
368 3300005333 Ga0070677_10055435 Ga0070677_100554353 239
369 3300005334 Ga0068869_100003093 Ga0068869_1000030938 239
370 3300005336 Ga0070680_100000881 Ga0070680_10000088116 239
371 3300005336 Ga0070680_100240392 Ga0070680_1002403922 239
372 3300005337 Ga0070682_100001651 Ga0070682_1000016518 239
373 3300005338 Ga0068868_100157278 Ga0068868_1001572783 239
374 3300005339 Ga0070660_100001614 Ga0070660_10000161414 239
375 3300005339 Ga0070660_100025586 Ga0070660_1000255863 239
376 3300005340 Ga0070689_100089964 Ga0070689_1000899641 239
377 3300005341 Ga0070691_10010959 Ga0070691_100109595 239
378 3300005341 Ga0070691_10016601 Ga0070691_100166015 239
379 3300005344 Ga0070661_100001126 Ga0070661_10000112614 239
380 3300005345 Ga0070692_10000047 Ga0070692_100000474 239
381 3300005364 Ga0070673_100375905 Ga0070673_1003759052 239
382 3300005406 Ga0070703_10001203 Ga0070703_100012031 239
383 3300005436 Ga0070713_100047920 Ga0070713_1000479202 239
384 3300005440 Ga0070705_100000623 Ga0070705_10000062315 239
385 3300005441 Ga0070700_100018903 Ga0070700_1000189032 239
386 3300005444 Ga0070694_100000022 Ga0070694_10000002221 239
387 3300005444 Ga0070694_100000244 Ga0070694_10000024427 239
388 3300005445 Ga0070708_100025356 Ga0070708_1000253564 239
389 3300005445 Ga0070708_100036349 Ga0070708_1000363496 239
390 3300005445 Ga0070708_100188995 Ga0070708_1001889954 239
391 3300005445 Ga0070708_100224455 Ga0070708_1002244553 239
392 3300005445 Ga0070708_100288687 Ga0070708_1002886873 239
393 3300005455 Ga0070663_100008205 Ga0070663_1000082053 239
394 3300005457 Ga0070662_100096758 Ga0070662_1000967583 239
395 3300005458 Ga0070681_10004747 Ga0070681_100047472 239
396 3300005459 Ga0068867_100072657 Ga0068867_1000726572 239
397 3300005467 Ga0070706_100003723 Ga0070706_10000372315 239
398 3300005467 Ga0070706_100034717 Ga0070706_1000347174 239
399 3300005467 Ga0070706_100050813 Ga0070706_1000508133 239
400 3300005468 Ga0070707_100018242 Ga0070707_1000182425 239
401 3300005468 Ga0070707_100075704 Ga0070707_1000757042 239
402 3300005468 Ga0070707_100213781 Ga0070707_1002137813 239
403 3300005471 Ga0070698_100003867 Ga0070698_1000038678 239
404 3300005471 Ga0070698_100029931 Ga0070698_1000299312 239
405 3300005471 Ga0070698_100162427 Ga0070698_1001624271 239
406 3300005518 Ga0070699_100007483 Ga0070699_1000074837 239
407 3300005518 Ga0070699_100019236 Ga0070699_1000192367 239
408 3300005518 Ga0070699_100119439 Ga0070699_1001194393 239
409 3300005530 Ga0070679_100005357 Ga0070679_1000053575 239
410 3300005535 Ga0070684_100100822 Ga0070684_1001008222 239
411 3300005536 Ga0070697_100008556 Ga0070697_1000085563 239
412 3300005536 Ga0070697_100022147 Ga0070697_1000221477 239
413 3300005536 Ga0070697_100152159 Ga0070697_1001521592 239
414 3300005536 Ga0070697_100225132 Ga0070697_1002251322 239
415 3300005536 Ga0070697_100269805 Ga0070697_1002698052 239
416 3300005539 Ga0068853_100001043 Ga0068853_10000104314 239
417 3300005545 Ga0070695_100000263 Ga0070695_10000026327 239
418 3300005545 Ga0070695_100000944 Ga0070695_10000094415 239
419 3300005547 Ga0070693_100008567 Ga0070693_1000085676 239
420 3300005549 Ga0070704_100004243 Ga0070704_10000424310 239
421 3300005549 Ga0070704_100147296 Ga0070704_1001472962 239
422 3300005563 Ga0068855_100000101 Ga0068855_10000010126 239
423 3300005563 Ga0068855_100007903 Ga0068855_1000079032 239
424 3300005564 Ga0070664_100021688 Ga0070664_1000216885 239
425 3300005577 Ga0068857_100118819 Ga0068857_1001188193 239
426 3300005578 Ga0068854_100000873 Ga0068854_10000087312 239
427 3300005615 Ga0070702_100030196 Ga0070702_1000301964 239
428 3300005616 Ga0068852_100141361 Ga0068852_1001413613 239
429 3300005617 Ga0068859_100037661 Ga0068859_1000376612 239
430 3300005618 Ga0068864_100050707 Ga0068864_1000507074 239
431 3300005719 Ga0068861_100023552 Ga0068861_1000235525 239
432 3300005840 Ga0068870_10000613 Ga0068870_1000061314 239
433 3300005841 Ga0068863_100004816 Ga0068863_1000048167 239
434 3300005842 Ga0068858_100112957 Ga0068858_1001129572 239
435 3300005842 Ga0068858_100137006 Ga0068858_1001370063 239
436 3300005843 Ga0068860_100003258 Ga0068860_1000032584 239
437 3300005843 Ga0068860_100085725 Ga0068860_1000857253 239
438 3300005844 Ga0068862_100001978 Ga0068862_10000197815 239
439 3300005844 Ga0068862_100799684 Ga0068862_1007996841 239
440 3300005937 Ga0081455_10000576 Ga0081455_1000057641 239
441 3300005937 Ga0081455_10038375 Ga0081455_100383754 239
442 3300005937 Ga0081455_10068407 Ga0081455_100684074 239
443 3300006028 Ga0070717_10247408 Ga0070717_102474082 239
444 3300006048 Ga0075363_100098168 Ga0075363_1000981682 239
445 3300006173 Ga0070716_100029371 Ga0070716_1000293712 239
446 3300006175 Ga0070712_100189853 Ga0070712_1001898532 239
447 3300006177 Ga0075362_10002293 Ga0075362_100022936 239
448 3300006177 Ga0075362_10031783 Ga0075362_100317833 239
449 3300006177 Ga0075362_10050819 Ga0075362_100508192 239
450 3300006177 Ga0075362_10059779 Ga0075362_100597793 239
451 3300006178 Ga0075367_10021536 Ga0075367_100215364 239
452 3300006178 Ga0075367_10056350 Ga0075367_100563502 239
453 3300006178 Ga0075367_10127635 Ga0075367_101276352 239
454 3300006178 Ga0075367_10291797 Ga0075367_102917972 239
455 3300006186 Ga0075369_10004309 Ga0075369_100043096 239
456 3300006195 Ga0075366_10144679 Ga0075366_101446792 239
457 3300006195 Ga0075366_10194890 Ga0075366_101948901 239
458 3300006844 Ga0075428_100001995 Ga0075428_10000199512 239
459 3300006846 Ga0075430_100150717 Ga0075430_1001507172 239
460 3300006847 Ga0075431_100001571 Ga0075431_1000015714 239
461 3300006847 Ga0075431_100144139 Ga0075431_1001441394 239
462 3300006847 Ga0075431_100448801 Ga0075431_1004488012 239
463 3300006852 Ga0075433_10193644 Ga0075433_101936441 239
464 3300006871 Ga0075434_100047586 Ga0075434_1000475863 239
465 3300006871 Ga0075434_100209947 Ga0075434_1002099472 239
466 3300006914 Ga0075436_100020488 Ga0075436_1000204884 239
467 3300006914 Ga0075436_100033909 Ga0075436_1000339092 239
468 3300006914 Ga0075436_100112309 Ga0075436_1001123092 239
469 3300006914 Ga0075436_100177108 Ga0075436_1001771082 239
470 3300006931 Ga0097620_100037661 Ga0097620_1000376612 239
471 3300007076 Ga0075435_100066579 Ga0075435_1000665792 239
472 3300007265 Ga0099794_10006090 Ga0099794_100060906 239
473 3300007265 Ga0099794_10045817 Ga0099794_100458172 239
474 3300007265 Ga0099794_10134330 Ga0099794_101343302 239
475 3300009093 Ga0105240_10294310 Ga0105240_102943102 239
476 3300009098 Ga0105245_10782788 Ga0105245_107827882 239
477 3300009147 Ga0114129_10000312 Ga0114129_1000031238 239
478 3300009147 Ga0114129_10274334 Ga0114129_102743343 239
479 3300009174 Ga0105241_10004528 Ga0105241_100045285 239
480 3300009988 Ga0105035_102227 Ga0105035_1022271 239
481 3300010375 Ga0105239_10451528 Ga0105239_104515283 239
482 3300013104 Ga0157370_10239321 Ga0157370_102393212 239
483 3300013105 Ga0157369_10620372 Ga0157369_106203722 239
484 3300013307 Ga0157372_10002694 Ga0157372_1000269410 239
485 3300013308 Ga0157375_11068416 Ga0157375_110684162 239
486 3300013875 Ga0157515_150309 Ga0157515_1503092 239
487 3300014325 Ga0163163_10354808 Ga0163163_103548081 239
488 3300014497 Ga0182008_10049381 Ga0182008_100493812 239
489 3300020070 Ga0206356_10052660 Ga0206356_100526602 239
490 3300020082 Ga0206353_11152514 Ga0206353_111525144 239
491 3300021441 Ga0213871_10030255 Ga0213871_100302552 239
492 3300025284 Ga0209130_1000071 Ga0209130_100007192 239
493 3300025291 Ga0209675_1000682 Ga0209675_10006825 239
494 3300025294 Ga0209025_1009442 Ga0209025_10094426 239
495 3300025302 Ga0207426_1007694 Ga0207426_10076942 239
496 3300025885 Ga0207653_10006803 Ga0207653_100068031 239
497 3300025885 Ga0207653_10011782 Ga0207653_100117822 239
498 3300025893 Ga0207682_10026606 Ga0207682_100266062 239
499 3300025906 Ga0207699_10112155 Ga0207699_101121553 239
500 3300025907 Ga0207645_10000268 Ga0207645_1000026838 239
501 3300025908 Ga0207643_10000144 Ga0207643_1000014443 239
502 3300025909 Ga0207705_10145539 Ga0207705_101455392 239
503 3300025910 Ga0207684_10078456 Ga0207684_100784562 239
504 3300025910 Ga0207684_10087776 Ga0207684_100877763 239
505 3300025911 Ga0207654_10007511 Ga0207654_100075112 239
506 3300025912 Ga0207707_10000250 Ga0207707_100002502 239
507 3300025912 Ga0207707_10222483 Ga0207707_102224833 239
508 3300025912 Ga0207707_10353856 Ga0207707_103538562 239
509 3300025913 Ga0207695_10242073 Ga0207695_102420732 239
510 3300025915 Ga0207693_10169832 Ga0207693_101698323 239
511 3300025917 Ga0207660_10000341 Ga0207660_1000034122 239
512 3300025917 Ga0207660_10086586 Ga0207660_100865863 239
513 3300025917 Ga0207660_10254706 Ga0207660_102547062 239
514 3300025918 Ga0207662_10025182 Ga0207662_100251822 239
515 3300025919 Ga0207657_10012232 Ga0207657_100122325 239
516 3300025920 Ga0207649_10103349 Ga0207649_101033493 239
517 3300025921 Ga0207652_10000757 Ga0207652_1000075728 239
518 3300025921 Ga0207652_10004986 Ga0207652_100049863 239
519 3300025922 Ga0207646_10016668 Ga0207646_100166682 239
520 3300025922 Ga0207646_10020279 Ga0207646_100202795 239
521 3300025922 Ga0207646_10104521 Ga0207646_101045212 239
522 3300025922 Ga0207646_10180982 Ga0207646_101809824 239
523 3300025925 Ga0207650_10005652 Ga0207650_1000565210 239
524 3300025928 Ga0207700_10109043 Ga0207700_101090433 239
525 3300025932 Ga0207690_10004563 Ga0207690_100045636 239
526 3300025933 Ga0207706_10004278 Ga0207706_100042787 239
527 3300025934 Ga0207686_10729581 Ga0207686_107295811 239
528 3300025936 Ga0207670_10063383 Ga0207670_100633832 239
529 3300025938 Ga0207704_10265460 Ga0207704_102654601 239
530 3300025939 Ga0207665_10018644 Ga0207665_100186442 239
531 3300025940 Ga0207691_10256157 Ga0207691_102561572 239
532 3300025942 Ga0207689_10000005 Ga0207689_1000000541 239
533 3300025945 Ga0207679_10000273 Ga0207679_1000027322 239
534 3300025949 Ga0207667_10001037 Ga0207667_1000103710 239
535 3300025949 Ga0207667_10009236 Ga0207667_100092362 239
536 3300025981 Ga0207640_10003690 Ga0207640_100036909 239
537 3300026035 Ga0207703_10216802 Ga0207703_102168022 239
538 3300026041 Ga0207639_10002730 Ga0207639_1000273012 239
539 3300026067 Ga0207678_10004745 Ga0207678_100047459 239
540 3300026075 Ga0207708_10367024 Ga0207708_103670241 239
541 3300026078 Ga0207702_10000385 Ga0207702_1000038535 239
542 3300026088 Ga0207641_10326461 Ga0207641_103264612 239
543 3300026089 Ga0207648_10000434 Ga0207648_1000043423 239
544 3300026095 Ga0207676_10110161 Ga0207676_101101612 239
545 3300026116 Ga0207674_10000673 Ga0207674_100006738 239
546 3300026118 Ga0207675_100050791 Ga0207675_1000507915 239
547 3300026142 Ga0207698_10098969 Ga0207698_100989692 239
548 3300028380 Ga0268265_10003299 Ga0268265_1000329912 239
549 3300028381 Ga0268264_10022305 Ga0268264_100223053 239
550 3300028381 Ga0268264_10041016 Ga0268264_100410165 239
551 3300031649 Ga0307514_10000225 Ga0307514_1000022563 239
552 3300031852 Ga0307410_10020475 Ga0307410_100204753 239
553 3300034820 Ga0373959_0009702 Ga0373959_0009702_475_1200 239
554 3300035090 Ga0373949_0036575 Ga0373949_0036575_234_959 239
555 3300035112 Ga0373932_0025953 Ga0373932_0025953_102_821 239
556 3300035115 Ga0373941_0073816 Ga0373941_0073816_387_1106 239
557 3300037312 Ga0395899_0006315 Ga0395899_0006315_7618_8337 239
558 3300037418 Ga0395900_0144124 Ga0395900_0144124_1097_1816 239
559 3300038443 Ga0395901_0001952 Ga0395901_0001952_17456_18175 239
560 3300039438 Ga0436360_0295164 Ga0436360_0295164_2484_3203 239
561 3300039447 Ga0436361_0647554 Ga0436361_0647554_353_1072 239
562 3300042004 Ga0439445_0094398 Ga0439445_0094398_103_831 239
563 3300042005 Ga0439448_0002205 Ga0439448_0002205_2133_2858 239
564 3300042461 Ga0439460_0090077 Ga0439460_0090077_229_948 239
565 3300042876 Ga0451577_0191220 Ga0451577_0191220_667_1392 239
566 3300045051 Ga0451576_0196097 Ga0451576_0196097_1089_1814 239
567 3300045051 Ga0451576_0236908 Ga0451576_0236908_396_1115 239
568 3300045051 Ga0451576_0406536 Ga0451576_0406536_201_926 239
569 3300045051 Ga0451576_0575409 Ga0451576_0575409_365_1090 239
570 3300046472 Ga0495580_0032563 Ga0495580_0032563_903_1628 239
571 3300048909 Ga0496106_0459290 Ga0496106_0459290_40_765 239
572 3300048915 Ga0496112_0079049 Ga0496112_0079049_1290_2015 239
573 3300048929 Ga0496126_0177802 Ga0496126_0177802_1047_1772 239
574 3300049571 Ga0501034_0224682 Ga0501034_0224682_999_1727 239
575 3300049577 Ga0501041_0091658 Ga0501041_0091658_911_1630 239
576 3300049580 Ga0501046_0448791 Ga0501046_0448791_127_846 239
577 3300049585 Ga0501069_0131961 Ga0501069_0131961_372_1097 239
578 3300049588 Ga0501072_0033115 Ga0501072_0033115_421_1140 239
579 3300049591 Ga0501075_0019621 Ga0501075_0019621_586_1305 239
580 3300049591 Ga0501075_0137087 Ga0501075_0137087_969_1688 239
581 3300049592 Ga0501076_0211112 Ga0501076_0211112_17_736 239
582 3300049593 Ga0501077_0142985 Ga0501077_0142985_357_1076 239
583 3300049741 Ga0501079_0173721 Ga0501079_0173721_878_1597 239
584 3300049823 Ga0501044_0035461 Ga0501044_0035461_2122_2859 239
585 3300049824 Ga0501045_0464633 Ga0501045_0464633_107_826 239
586 3300050489 nmdc:mga03683_25069_c1 nmdc:mga03683_25069_c1_883_1602 239
587 3300050489 nmdc:mga03683_7969_c1 nmdc:mga03683_7969_c1_2616_3341 239
588 3300050490 nmdc:mga03n38_68446_c1 nmdc:mga03n38_68446_c1_682_1401 239
589 3300050492 nmdc:mga0yw44_4280_c1 nmdc:mga0yw44_4280_c1_4946_5683 239
590 3300050492 nmdc:mga0yw44_92068_c1 nmdc:mga0yw44_92068_c1_495_1214 239
591 3300050493 nmdc:mga0k408_15888_c1 nmdc:mga0k408_15888_c1_2660_3379 239
592 3300050493 nmdc:mga0k408_86625_c2 nmdc:mga0k408_86625_c2_393_1112 239
593 3300050494 nmdc:mga06z11_152879_c1 nmdc:mga06z11_152879_c1_103_822 239
594 3300050494 nmdc:mga06z11_187045_c1 nmdc:mga06z11_187045_c1_18_737 239
595 3300050507 nmdc:mga05p37_338913_c1 nmdc:mga05p37_338913_c1_28_753 239
596 3300050507 nmdc:mga05p37_339490_c1 nmdc:mga05p37_339490_c1_347_1072 239
597 3300050509 nmdc:mga0qj67_28307_c1 nmdc:mga0qj67_28307_c1_1110_1835 239
598 3300050510 nmdc:mga06r32_3203_c1 nmdc:mga06r32_3203_c1_591_1316 239
599 3300050512 nmdc:mga0n895_175649_c1 nmdc:mga0n895_175649_c1_440_1165 239
600 3300050512 nmdc:mga0n895_31187_c1 nmdc:mga0n895_31187_c1_482_1207 239
601 3300050513 nmdc:mga0rr50_87989_c1 nmdc:mga0rr50_87989_c1_1627_2352 239
602 3300050514 nmdc:mga08x19_102637_c1 nmdc:mga08x19_102637_c1_560_1279 239
603 3300050514 nmdc:mga08x19_325116_c1 nmdc:mga08x19_325116_c1_153_878 239
604 3300050515 nmdc:mga0a205_209357_c1 nmdc:mga0a205_209357_c1_1009_1734 239
605 3300050515 nmdc:mga0a205_98488_c1 nmdc:mga0a205_98488_c1_1617_2342 239
606 3300050516 nmdc:mga0sz30_16023_c1 nmdc:mga0sz30_16023_c1_1511_2230 239
607 3300050516 nmdc:mga0sz30_29192_c1 nmdc:mga0sz30_29192_c1_652_1371 239
608 3300053096 Ga0500641_0000921 Ga0500641_0000921_6427_7152 239
609 3300053153 Ga0500616_0003288 Ga0500616_0003288_6524_7243 239
610 3300053733 Ga0500552_000672 Ga0500552_000672_1429_2148 239
611 3300054114 Ga0501084_0174351 Ga0501084_0174351_896_1615 239
612 3300061734 Ga0530510_0022598 Ga0530510_0022598_1083_1808 239
613 3300061734 Ga0530510_0035253 Ga0530510_0035253_2147_2866 239
614 3300061734 Ga0530510_0052534 Ga0530510_0052534_1809_2528 239
615 3300003322 rootL2_10139955 rootL2_101399551 240
616 3300003323 rootH1_10131162 rootH1_101311622 240
617 3300003775 Ga0055524_1020715 Ga0055524_10207152 240
618 3300005289 Ga0065704_10081250 Ga0065704_100812502 240
619 3300005341 Ga0070691_10206103 Ga0070691_102061032 240
620 3300005444 Ga0070694_100006281 Ga0070694_1000062818 240
621 3300005444 Ga0070694_100027237 Ga0070694_1000272372 240
622 3300005457 Ga0070662_100051562 Ga0070662_1000515624 240
623 3300005468 Ga0070707_100472222 Ga0070707_1004722222 240
624 3300005471 Ga0070698_100066704 Ga0070698_1000667042 240
625 3300005545 Ga0070695_100000505 Ga0070695_10000050516 240
626 3300005545 Ga0070695_100010464 Ga0070695_1000104645 240
627 3300005549 Ga0070704_100048617 Ga0070704_1000486172 240
628 3300005577 Ga0068857_100439823 Ga0068857_1004398233 240
629 3300005719 Ga0068861_100115035 Ga0068861_1001150353 240
630 3300005844 Ga0068862_100015771 Ga0068862_1000157712 240
631 3300005844 Ga0068862_100409642 Ga0068862_1004096422 240
632 3300005937 Ga0081455_10000178 Ga0081455_1000017810 240
633 3300005981 Ga0081538_10020424 Ga0081538_100204244 240
634 3300005983 Ga0081540_1067359 Ga0081540_10673591 240
635 3300006173 Ga0070716_100126622 Ga0070716_1001266222 240
636 3300006844 Ga0075428_100423421 Ga0075428_1004234213 240
637 3300006847 Ga0075431_100000380 Ga0075431_1000003806 240
638 3300006852 Ga0075433_10024066 Ga0075433_100240661 240
639 3300006852 Ga0075433_10053746 Ga0075433_100537464 240
640 3300006852 Ga0075433_10354964 Ga0075433_103549642 240
641 3300006871 Ga0075434_100135066 Ga0075434_1001350661 240
642 3300006871 Ga0075434_100235536 Ga0075434_1002355362 240
643 3300006871 Ga0075434_100634944 Ga0075434_1006349441 240
644 3300007076 Ga0075435_100083556 Ga0075435_1000835564 240
645 3300009094 Ga0111539_10006885 Ga0111539_1000688511 240
646 3300009147 Ga0114129_10033919 Ga0114129_100339196 240
647 3300009147 Ga0114129_10334023 Ga0114129_103340232 240
648 3300009147 Ga0114129_10692601 Ga0114129_106926011 240
649 3300009148 Ga0105243_10207163 Ga0105243_102071633 240
650 3300009176 Ga0105242_10124527 Ga0105242_101245271 240
651 3300013250 Ga0171462_1021 Ga0171462_102196 240
652 3300013306 Ga0163162_10676336 Ga0163162_106763362 240
653 3300013307 Ga0157372_10208041 Ga0157372_102080414 240
654 3300017792 Ga0163161_10061001 Ga0163161_100610012 240
655 3300025299 Ga0209256_1000453 Ga0209256_100045332 240
656 3300025910 Ga0207684_10599668 Ga0207684_105996681 240
657 3300025933 Ga0207706_10015363 Ga0207706_100153637 240
658 3300025942 Ga0207689_10008846 Ga0207689_100088465 240
659 3300026089 Ga0207648_10019305 Ga0207648_100193053 240
660 3300026118 Ga0207675_100302472 Ga0207675_1003024722 240
661 3300027471 Ga0209995_1002297 Ga0209995_10022975 240
662 3300027543 Ga0209999_1001421 Ga0209999_10014215 240
663 3300027614 Ga0209970_1002488 Ga0209970_10024884 240
664 3300027682 Ga0209971_1002698 Ga0209971_10026985 240
665 3300027695 Ga0209966_1000430 Ga0209966_10004307 240
666 3300027717 Ga0209998_10000123 Ga0209998_1000012312 240
667 3300027876 Ga0209974_10000444 Ga0209974_100004445 240
668 3300027907 Ga0207428_10001382 Ga0207428_100013824 240
669 3300028380 Ga0268265_10008981 Ga0268265_100089816 240
670 3300028380 Ga0268265_10071382 Ga0268265_100713822 240
671 3300028381 Ga0268264_10126390 Ga0268264_101263902 240
672 3300042012 Ga0439455_0006076 Ga0439455_0006076_1678_2406 240
673 3300042461 Ga0439460_0068026 Ga0439460_0068026_292_1020 240
674 3300042876 Ga0451577_0012446 Ga0451577_0012446_1825_2556 240
675 3300044712 Ga0453684_0027427 Ga0453684_0027427_6076_6807 240
676 3300045051 Ga0451576_0040286 Ga0451576_0040286_2704_3432 240
677 3300045051 Ga0451576_0064991 Ga0451576_0064991_2265_2999 240
678 3300045051 Ga0451576_0099093 Ga0451576_0099093_1758_2483 240
679 3300045051 Ga0451576_0191697 Ga0451576_0191697_490_1221 240
680 3300045051 Ga0451576_0237967 Ga0451576_0237967_671_1402 240
681 3300045051 Ga0451576_0907534 Ga0451576_0907534_15_743 240
682 3300046455 Ga0495603_0117585 Ga0495603_0117585_748_1473 240
683 3300046458 Ga0495591_001856 Ga0495591_001856_10709_11434 240
684 3300047446 Ga0495679_006589 Ga0495679_006589_2447_3172 240
685 3300048925 Ga0496122_0006578 Ga0496122_0006578_1687_2415 240
686 3300048926 Ga0496123_0054463 Ga0496123_0054463_218_946 240
687 3300048927 Ga0496124_0023226 Ga0496124_0023226_3247_3975 240
688 3300048928 Ga0496125_0003788 Ga0496125_0003788_7329_8057 240
689 3300048929 Ga0496126_0245102 Ga0496126_0245102_484_1212 240
690 3300048929 Ga0496126_0249733 Ga0496126_0249733_571_1296 240
691 3300049570 Ga0501033_0056471 Ga0501033_0056471_468_1196 240
692 3300049574 Ga0501038_0279568 Ga0501038_0279568_445_1173 240
693 3300049575 Ga0501039_0040458 Ga0501039_0040458_1472_2200 240
694 3300049575 Ga0501039_0166194 Ga0501039_0166194_709_1431 240
695 3300049576 Ga0501040_0052461 Ga0501040_0052461_488_1216 240
696 3300049576 Ga0501040_0343168 Ga0501040_0343168_189_929 240
697 3300049577 Ga0501041_0001274 Ga0501041_0001274_4435_5163 240
698 3300049577 Ga0501041_0056916 Ga0501041_0056916_1043_1774 240
699 3300049579 Ga0501043_0056121 Ga0501043_0056121_318_1046 240
700 3300049580 Ga0501046_0028313 Ga0501046_0028313_19_747 240
701 3300049581 Ga0501047_0145500 Ga0501047_0145500_1406_2134 240
702 3300049582 Ga0501048_0122537 Ga0501048_0122537_615_1343 240
703 3300049584 Ga0501068_0095113 Ga0501068_0095113_665_1393 240
704 3300049584 Ga0501068_0095789 Ga0501068_0095789_208_939 240
705 3300049587 Ga0501071_0412615 Ga0501071_0412615_194_925 240
706 3300049588 Ga0501072_0003886 Ga0501072_0003886_6559_7284 240
707 3300049588 Ga0501072_0218015 Ga0501072_0218015_770_1501 240
708 3300049588 Ga0501072_0525630 Ga0501072_0525630_68_808 240
709 3300049589 Ga0501073_0251943 Ga0501073_0251943_213_938 240
710 3300049590 Ga0501074_0001623 Ga0501074_0001623_7369_8097 240
711 3300049590 Ga0501074_0162737 Ga0501074_0162737_440_1168 240
712 3300049591 Ga0501075_0010045 Ga0501075_0010045_833_1564 240
713 3300049591 Ga0501075_0144598 Ga0501075_0144598_939_1667 240
714 3300049592 Ga0501076_0006280 Ga0501076_0006280_4840_5571 240
715 3300049593 Ga0501077_0045223 Ga0501077_0045223_1659_2390 240
716 3300049741 Ga0501079_0000848 Ga0501079_0000848_16530_17258 240
717 3300049742 Ga0501080_0109983 Ga0501080_0109983_89_820 240
718 3300049742 Ga0501080_0297651 Ga0501080_0297651_49_771 240
719 3300049742 Ga0501080_0405726 Ga0501080_0405726_469_1197 240
720 3300049743 Ga0501081_0000390 Ga0501081_0000390_4373_5101 240
721 3300049743 Ga0501081_0007124 Ga0501081_0007124_1229_1960 240
722 3300049743 Ga0501081_0036919 Ga0501081_0036919_843_1565 240
723 3300049743 Ga0501081_0242158 Ga0501081_0242158_431_1153 240
724 3300049744 Ga0501083_0043997 Ga0501083_0043997_262_990 240
725 3300049744 Ga0501083_0107373 Ga0501083_0107373_437_1162 240
726 3300049823 Ga0501044_0889685 Ga0501044_0889685_29_754 240
727 3300049824 Ga0501045_0003761 Ga0501045_0003761_5216_5944 240
728 3300049824 Ga0501045_0072551 Ga0501045_0072551_767_1498 240
729 3300049824 Ga0501045_0424025 Ga0501045_0424025_157_888 240
730 3300050507 nmdc:mga05p37_19767_c1 nmdc:mga05p37_19767_c1_4428_5150 240
731 3300050507 nmdc:mga05p37_995467_c1 nmdc:mga05p37_995467_c1_61_792 240
732 3300050509 nmdc:mga0qj67_26761_c1 nmdc:mga0qj67_26761_c1_3016_3750 240
733 3300050510 nmdc:mga06r32_177_c2 nmdc:mga06r32_177_c2_12947_13681 240
734 3300050511 nmdc:mga08y16_22564_c1 nmdc:mga08y16_22564_c1_4663_5394 240
735 3300050512 nmdc:mga0n895_131283_c1 nmdc:mga0n895_131283_c1_50_784 240
736 3300050512 nmdc:mga0n895_137069_c1 nmdc:mga0n895_137069_c1_1250_1981 240
737 3300050513 nmdc:mga0rr50_151901_c1 nmdc:mga0rr50_151901_c1_1074_1805 240
738 3300050515 nmdc:mga0a205_117679_c1 nmdc:mga0a205_117679_c1_126_857 240
739 3300050515 nmdc:mga0a205_1873_c1 nmdc:mga0a205_1873_c1_227_958 240
740 3300050515 nmdc:mga0a205_5653_c1 nmdc:mga0a205_5653_c1_10196_10927 240
741 3300054114 Ga0501084_0002524 Ga0501084_0002524_6358_7086 240
742 3300054114 Ga0501084_0006956 Ga0501084_0006956_3563_4294 240
743 3300054114 Ga0501084_0032796 Ga0501084_0032796_102_827 240
744 3300060353 Ga0501082_0005991 Ga0501082_0005991_7345_8073 240
745 3300060353 Ga0501082_0214455 Ga0501082_0214455_338_1063 240
746 3300061734 Ga0530510_0024089 Ga0530510_0024089_3382_4110 240
747 3300005345 Ga0070692_10165761 Ga0070692_101657612 241
748 3300005438 Ga0070701_10258458 Ga0070701_102584582 241
749 3300005440 Ga0070705_100359418 Ga0070705_1003594181 241
750 3300005444 Ga0070694_100248545 Ga0070694_1002485452 241
751 3300005445 Ga0070708_100608172 Ga0070708_1006081721 241
752 3300005467 Ga0070706_100594883 Ga0070706_1005948832 241
753 3300005468 Ga0070707_100490014 Ga0070707_1004900142 241
754 3300005536 Ga0070697_100246282 Ga0070697_1002462822 241
755 3300005617 Ga0068859_100201618 Ga0068859_1002016181 241
756 3300005842 Ga0068858_100475634 Ga0068858_1004756342 241
757 3300005844 Ga0068862_100034436 Ga0068862_1000344365 241
758 3300006175 Ga0070712_100003200 Ga0070712_10000320011 241
759 3300006846 Ga0075430_100025756 Ga0075430_1000257563 241
760 3300006847 Ga0075431_100016272 Ga0075431_10001627210 241
761 3300006847 Ga0075431_100050089 Ga0075431_1000500893 241
762 3300006847 Ga0075431_100061328 Ga0075431_1000613286 241
763 3300006847 Ga0075431_100433948 Ga0075431_1004339482 241
764 3300006852 Ga0075433_10015415 Ga0075433_100154154 241
765 3300006880 Ga0075429_100001287 Ga0075429_1000012877 241
766 3300006880 Ga0075429_100016363 Ga0075429_1000163635 241
767 3300006880 Ga0075429_100026333 Ga0075429_1000263336 241
768 3300006931 Ga0097620_100201595 Ga0097620_1002015952 241
769 3300007076 Ga0075435_100112142 Ga0075435_1001121422 241
770 3300009147 Ga0114129_10075473 Ga0114129_100754737 241
771 3300009147 Ga0114129_10099435 Ga0114129_100994352 241
772 3300009147 Ga0114129_10125309 Ga0114129_101253092 241
773 3300009147 Ga0114129_10134905 Ga0114129_101349053 241
774 3300009147 Ga0114129_10243507 Ga0114129_102435073 241
775 3300009148 Ga0105243_10268126 Ga0105243_102681261 241
776 3300009177 Ga0105248_10533349 Ga0105248_105333492 241
777 3300009551 Ga0105238_10009913 Ga0105238_1000991310 241
778 3300009553 Ga0105249_10023224 Ga0105249_100232247 241
779 3300013306 Ga0163162_10272718 Ga0163162_102727182 241
780 3300025915 Ga0207693_10034898 Ga0207693_100348984 241
781 3300025918 Ga0207662_10267858 Ga0207662_102678582 241
782 3300025924 Ga0207694_10059196 Ga0207694_100591962 241
783 3300025928 Ga0207700_10030298 Ga0207700_100302984 241
784 3300025938 Ga0207704_10618227 Ga0207704_106182271 241
785 3300026035 Ga0207703_10175155 Ga0207703_101751551 241
786 3300026075 Ga0207708_10334697 Ga0207708_103346972 241
787 3300026116 Ga0207674_10434666 Ga0207674_104346661 241
788 3300026118 Ga0207675_100059843 Ga0207675_1000598433 241
789 3300035691 Ga0373931_0194808 Ga0373931_0194808_211_936 241
790 3300049572 Ga0501036_0025039 Ga0501036_0025039_1382_2107 241
791 3300049574 Ga0501038_0361891 Ga0501038_0361891_345_1070 241
792 3300049575 Ga0501039_0292464 Ga0501039_0292464_143_871 241
793 3300049576 Ga0501040_0072442 Ga0501040_0072442_518_1243 241
794 3300049576 Ga0501040_0138454 Ga0501040_0138454_741_1469 241
795 3300049577 Ga0501041_0055929 Ga0501041_0055929_575_1300 241
796 3300049577 Ga0501041_0239981 Ga0501041_0239981_84_812 241
797 3300049578 Ga0501042_0055387 Ga0501042_0055387_581_1306 241
798 3300049582 Ga0501048_0095691 Ga0501048_0095691_1021_1746 241
799 3300049585 Ga0501069_0008517 Ga0501069_0008517_352_1077 241
800 3300049588 Ga0501072_0036083 Ga0501072_0036083_1090_1818 241
801 3300049588 Ga0501072_0177719 Ga0501072_0177719_50_775 241
802 3300049591 Ga0501075_0012957 Ga0501075_0012957_4754_5479 241
803 3300049591 Ga0501075_0026074 Ga0501075_0026074_3053_3778 241
804 3300049592 Ga0501076_0021310 Ga0501076_0021310_786_1511 241
805 3300049592 Ga0501076_0099535 Ga0501076_0099535_468_1193 241
806 3300049741 Ga0501079_0014082 Ga0501079_0014082_1575_2300 241
807 3300049743 Ga0501081_0007312 Ga0501081_0007312_5493_6218 241
808 3300049743 Ga0501081_0018454 Ga0501081_0018454_1406_2131 241
809 3300049744 Ga0501083_0049385 Ga0501083_0049385_1874_2599 241
810 3300049824 Ga0501045_0118327 Ga0501045_0118327_149_874 241
811 3300050507 nmdc:mga05p37_211702_c1 nmdc:mga05p37_211702_c1_808_1533 241
812 3300050507 nmdc:mga05p37_225839_c1 nmdc:mga05p37_225839_c1_1244_1981 241
813 3300050507 nmdc:mga05p37_70070_c1 nmdc:mga05p37_70070_c1_2882_3607 241
814 3300050508 nmdc:mga09592_19635_c1 nmdc:mga09592_19635_c1_1645_2382 241
815 3300050508 nmdc:mga09592_375463_c1 nmdc:mga09592_375463_c1_133_858 241
816 3300050508 nmdc:mga09592_698_c1 nmdc:mga09592_698_c1_7721_8446 241
817 3300050509 nmdc:mga0qj67_64838_c1 nmdc:mga0qj67_64838_c1_1152_1877 241
818 3300050510 nmdc:mga06r32_28822_c1 nmdc:mga06r32_28822_c1_2341_3078 241
819 3300050510 nmdc:mga06r32_296416_c1 nmdc:mga06r32_296416_c1_814_1539 241
820 3300050510 nmdc:mga06r32_51244_c1 nmdc:mga06r32_51244_c1_2950_3675 241
821 3300050510 nmdc:mga06r32_607_c1 nmdc:mga06r32_607_c1_6220_6945 241
822 3300050512 nmdc:mga0n895_23058_c1 nmdc:mga0n895_23058_c1_1606_2340 241
823 3300050513 nmdc:mga0rr50_25031_c1 nmdc:mga0rr50_25031_c1_1236_1970 241
824 3300050515 nmdc:mga0a205_454707_c1 nmdc:mga0a205_454707_c1_282_1019 241
825 3300050515 nmdc:mga0a205_68840_c2 nmdc:mga0a205_68840_c2_1042_1767 241
826 3300054114 Ga0501084_0017218 Ga0501084_0017218_3826_4551 241
827 3300054114 Ga0501084_0177246 Ga0501084_0177246_41_766 241
828 3300060353 Ga0501082_0015900 Ga0501082_0015900_4818_5543 241
829 3300060353 Ga0501082_0226349 Ga0501082_0226349_874_1602 241
830 3300061734 Ga0530510_0008725 Ga0530510_0008725_5567_6292 241
831 3300061734 Ga0530510_0119482 Ga0530510_0119482_144_872 241
832 3300061734 Ga0530510_0135924 Ga0530510_0135924_802_1527 241
833 3300003187 JGI25151J46595_10000795 JGI25151J46595_1000079510 242
834 3300003316 rootH1_10059295 rootH1_100592952 242
835 3300025284 Ga0209130_1001163 Ga0209130_10011638 242
836 3300025294 Ga0209025_1000328 Ga0209025_100032810 242
837 3300025297 Ga0209758_1001871 Ga0209758_10018719 242
838 3300025302 Ga0207426_1000235 Ga0207426_100023594 242
839 3300046506 Ga0495583_0170107 Ga0495583_0170107_108_836 242
840 3300046512 Ga0495610_0134937 Ga0495610_0134937_246_974 242
841 3300046694 Ga0495649_0139709 Ga0495649_0139709_161_889 242
842 3300053139 Ga0500568_0033190 Ga0500568_0033190_165_893 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

190

233

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.9031 3 238
2zzg-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.9018 3 238
2zze-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form 0.9002 3 238
2zzg-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.8999 3 238
2e1b-assembly1.cif.gz_A crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii 0.892 1 237
ID Description Score Start End Superfamily
2e1bA02 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.881 87 237 3.30.980.10
2e1bA02 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8684 87 237 3.30.980.10
af_Q4DQ33_587_768_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8648 87 240 3.30.980.10
2ztgA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8636 3 85 2.40.30.130
af_A0A2R8QSU7_595_766_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8564 87 238 3.30.980.10
ID Description Score Start End GO Terms
AF-A0A3N5HQQ0-F1-model_v4 Alanyl-tRNA editing protein 0.9733 1 146 GO:0000166
GO:0002161
GO:0046872
AF-A0A535EAG5-F1-model_v4 Alanyl-tRNA editing protein 0.9721 110 242 GO:0004812
GO:0005524
GO:0043039
AF-A0A1H5MHD4-F1-model_v4 deleted 0.972 3 238
AF-A0A848UEE3-F1-model_v4 Alanyl-tRNA editing protein 0.9678 29 238 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A7Z0B9X1-F1-model_v4 Misacylated tRNA(Ala) deacylase (EC 3.1.1.-) 0.9674 1 239 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map