F482329

General Info

Members Datasets Scaffolds Average Seq Length
823 528 659 236

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100290513|Ga0068855_1002905132
Length 280
Sequence MTFAATVLTLYPEMFPGPLGLSLAGRAREEGTWDLETVQIRDFAADKHRTVDDTPAGGGAGMVLRVDVLAKAIDYAREAIDIRIRSSRAKSRDAGAADGVSTSLDTNGEGGAGSVPVIAMTPRGKPLTQARVRELAAGPGVIVLCGRFEGFDERIFAARGVEEVSVGDIVLSGGEPAALMLLDACIRLLPGVMGAASSGAEESFENGLLEYPHYTRPAEWEGRTIPEVLRSGDHAKIAAWRKLQSEVDTRLRRPDLWERHDGARVQSASGARRETKDLDQ

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
6 2512875024 Mesorhizobium loti R88b Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
9 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
10 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
11 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
12 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
13 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
14 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
15 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
16 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
17 2643221662 Devosia sp. Root413D1 Isolate Unclassified
18 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
19 2738543024 Aminobacter sp. AP02 Isolate Unclassified
20 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
21 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
22 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
23 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
24 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
25 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
26 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
27 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
28 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
29 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
30 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
31 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
32 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
33 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
34 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
35 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
36 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
37 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
38 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
39 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
40 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
41 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
42 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
43 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
44 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
45 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
46 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
47 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
48 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
49 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
50 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
51 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
52 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
53 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
54 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
55 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
56 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
57 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
58 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
59 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
60 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
61 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
62 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
63 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
64 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
65 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
66 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
67 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
68 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
69 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
70 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
71 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
72 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
73 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
74 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
75 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
76 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
77 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
78 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
79 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
80 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
81 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
82 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
83 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
84 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
85 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
86 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
87 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
88 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
89 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
90 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
91 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
92 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
93 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
94 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
95 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
96 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
97 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
98 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
99 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
100 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
101 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
102 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
103 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
104 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
105 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
106 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
107 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
108 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
109 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
110 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
111 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
112 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
113 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
114 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
115 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
116 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
117 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
118 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
119 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
120 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
121 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
122 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
123 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
124 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
125 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
126 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
127 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
128 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
129 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
130 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
131 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
132 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
133 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
134 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
135 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
136 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
137 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
138 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
139 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
140 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
141 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
142 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
143 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
144 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
145 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
146 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
147 3004167301 Mesorhizobium loti 582 Isolate Unclassified
148 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
149 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
150 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
151 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
152 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
153 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
154 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
155 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
156 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
157 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
158 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
159 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
160 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
161 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
162 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
163 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
164 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
165 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
166 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
168 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
169 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
170 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
173 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
174 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
175 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
176 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
177 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
178 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
179 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
180 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
181 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
182 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
183 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
184 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
185 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
186 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
187 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
188 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
189 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
190 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
191 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
192 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
193 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
194 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
195 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
196 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
197 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
198 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
199 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
200 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
201 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
202 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
205 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
206 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
207 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
208 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
209 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
210 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
211 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
212 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
213 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
214 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
215 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
216 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
217 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
218 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
219 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
220 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
221 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
224 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
225 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
228 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
231 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
232 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
233 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
234 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
235 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
236 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
237 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
238 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
239 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
240 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
241 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
242 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
243 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
244 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
245 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
246 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
247 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
248 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
249 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
250 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
251 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
252 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
253 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
254 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
255 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
256 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
257 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
258 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
259 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
260 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
261 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
262 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
263 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
264 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
265 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
267 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
268 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
271 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
272 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
273 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
274 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
275 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
276 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
277 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
278 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
279 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
280 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
281 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
282 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
283 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
284 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
285 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
286 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
287 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
288 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
289 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
290 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
291 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
292 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
295 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
296 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
297 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
299 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
300 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
301 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
304 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
373 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
376 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
377 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
378 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
379 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
380 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
381 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
382 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
383 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
384 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
385 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
386 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
387 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
388 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
389 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
390 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
391 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
394 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
395 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
396 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
397 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
398 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
399 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
400 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
401 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
402 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
403 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
404 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
405 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
406 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
407 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
408 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
409 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
410 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
411 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
412 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
413 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
416 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
417 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
418 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
419 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
420 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
421 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
422 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
423 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
424 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
429 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
434 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
435 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
436 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
437 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
438 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
439 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
452 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
453 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
469 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
470 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
473 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
474 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
475 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
476 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
477 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
478 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
479 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
480 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
481 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
482 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
483 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
484 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
485 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
488 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
489 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
490 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
491 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
492 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
493 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
494 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
495 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
496 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
497 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
498 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
499 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
500 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
501 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
502 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
503 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
504 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
505 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
506 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
507 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
508 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
509 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
510 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
511 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
512 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
513 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
514 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
515 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
516 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
517 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
518 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
519 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
520 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
521 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
522 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
523 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
524 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
525 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
526 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
527 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
528 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.95
Metatranscriptomes 0.12
Isolates 19.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 16.16
Rhizoplane 5.1
Rhizosphere 66.46
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001434 3300001904 Bacteria 4370
2 JGI24741J21665_1000020 3300001915 Bacteria 37657
3 JGI24752J21851_1002297 3300001976 Bacteria 2549
4 JGI24746J21847_1011509 3300001977 Bacteria 1300
5 JGI24740J21852_10009521 3300001979 Bacteria 3798
6 JGI24739J22299_10001733 3300001989 Bacteria 8298
7 JGI24737J22298_10002227 3300001990 Bacteria 6914
8 JGI24737J22298_10006157 3300001990 Bacteria 4110
9 JGI24737J22298_10006332 3300001990 Bacteria 4047
10 JGI24738J21930_10000749 3300002075 Bacteria 9345
11 JGI24738J21930_10014815 3300002075 Bacteria 1668
12 JGI24749J21850_1000037 3300002076 Bacteria 24773
13 JGI24034J26672_10006184 3300002239 Bacteria 1725
14 JGI25157J39369_1001721 3300002741 Bacteria 7336
15 JGI25406J46586_10000167 3300003203 Bacteria 29176
16 JGI25165J46597_1000052 3300003214 Bacteria 236064
17 JGI25153J46596_10000006 3300003215 Bacteria 447760
18 Ga0055536_1006426 3300003781 Bacteria 5493
19 Ga0055530_10000522 3300003791 Bacteria 33291
20 Ga0055531_10005448 3300003794 Bacteria 7448
21 Ga0065704_10077887 3300005289 Bacteria 4591
22 Ga0065704_10101542 3300005289 Bacteria 2234
23 Ga0070658_10028412 3300005327 Bacteria 4489
24 Ga0070676_10045792 3300005328 Bacteria 2548
25 Ga0070683_100012785 3300005329 Bacteria 7302
26 Ga0070690_100060095 3300005330 Bacteria 2445
27 Ga0070670_100000792 3300005331 Bacteria 24611
28 Ga0070670_100024711 3300005331 Bacteria 5167
29 Ga0070677_10000238 3300005333 Bacteria 19104
30 Ga0070677_10010859 3300005333 Bacteria 3127
31 Ga0068869_100077158 3300005334 Bacteria 2478
32 Ga0070666_10001688 3300005335 Bacteria 13469
33 Ga0070680_100012436 3300005336 Bacteria 6614
34 Ga0070682_100005303 3300005337 Bacteria 7171
35 Ga0070682_100126816 3300005337 Bacteria 1721
36 Ga0068868_100019864 3300005338 Bacteria 5039
37 Ga0068868_100106201 3300005338 Bacteria 2277
38 Ga0070660_100002943 3300005339 Bacteria 11718
39 Ga0070660_100268274 3300005339 Bacteria 1394
40 Ga0070689_100003122 3300005340 Bacteria 10942
41 Ga0070691_10000070 3300005341 Bacteria 28614
42 Ga0070691_10135955 3300005341 Bacteria 1249
43 Ga0070687_100001000 3300005343 Bacteria 9633
44 Ga0070687_100448485 3300005343 Bacteria 858
45 Ga0070661_100000668 3300005344 Bacteria 25151
46 Ga0070661_100000697 3300005344 Bacteria 24630
47 Ga0070692_10000024 3300005345 Bacteria 29214
48 Ga0070668_100000068 3300005347 Bacteria 64209
49 Ga0070668_100001091 3300005347 Bacteria 19133
50 Ga0070669_100003333 3300005353 Bacteria 11547
51 Ga0070675_100001968 3300005354 Bacteria 15203
52 Ga0070675_100100760 3300005354 Bacteria 2433
53 Ga0070671_100001553 3300005355 Bacteria 17294
54 Ga0070671_100026086 3300005355 Bacteria 4800
55 Ga0070671_100043860 3300005355 Bacteria 3717
56 Ga0070671_100077222 3300005355 Bacteria 2783
57 Ga0070674_100004629 3300005356 Bacteria 7861
58 Ga0070674_100009057 3300005356 Bacteria 5950
59 Ga0070674_100257880 3300005356 Bacteria 1372
60 Ga0070673_100005461 3300005364 Bacteria 8140
61 Ga0070673_100201978 3300005364 Bacteria 1712
62 Ga0070673_100968301 3300005364 Bacteria 791
63 Ga0070688_100002260 3300005365 Bacteria 9728
64 Ga0070688_100197022 3300005365 Bacteria 1407
65 Ga0070659_100002640 3300005366 Bacteria 12754
66 Ga0070659_100427745 3300005366 Bacteria 1120
67 Ga0070667_100000290 3300005367 Bacteria 56841
68 Ga0070667_100000480 3300005367 Bacteria 40910
69 Ga0070667_100001713 3300005367 Bacteria 19600
70 Ga0070703_10054652 3300005406 Bacteria 1288
71 Ga0070709_10003174 3300005434 Bacteria 8812
72 Ga0070709_10012916 3300005434 Bacteria 4681
73 Ga0070714_100023409 3300005435 Bacteria 5073
74 Ga0070714_100284098 3300005435 Bacteria 1538
75 Ga0070713_100019976 3300005436 Bacteria 5128
76 Ga0070711_100000117 3300005439 Bacteria 41545
77 Ga0070705_100000313 3300005440 Bacteria 28689
78 Ga0070700_100207674 3300005441 Bacteria 1380
79 Ga0070694_100000845 3300005444 Bacteria 17237
80 Ga0070663_100001391 3300005455 Bacteria 13222
81 Ga0070663_100040898 3300005455 Bacteria 3248
82 Ga0070678_100000130 3300005456 Bacteria 30149
83 Ga0070678_100007175 3300005456 Bacteria 6592
84 Ga0070678_100029766 3300005456 Bacteria 3744
85 Ga0070662_100004052 3300005457 Bacteria 9202
86 Ga0070662_100344142 3300005457 Bacteria 1220
87 Ga0070681_10035084 3300005458 Bacteria 5039
88 Ga0070681_10638268 3300005458 Bacteria 980
89 Ga0068867_100143690 3300005459 Bacteria 1867
90 Ga0070685_10048639 3300005466 Bacteria 2443
91 Ga0070679_100206265 3300005530 Bacteria 1930
92 Ga0070684_100021766 3300005535 Bacteria 5340
93 Ga0070697_100001143 3300005536 Bacteria 20096
94 Ga0070697_100542921 3300005536 Bacteria 1019
95 Ga0068853_100004638 3300005539 Bacteria 10655
96 Ga0068853_100175392 3300005539 Bacteria 1941
97 Ga0068853_100680149 3300005539 Bacteria 981
98 Ga0070672_100002673 3300005543 Bacteria 11400
99 Ga0070686_100001769 3300005544 Bacteria 12073
100 Ga0070686_100025610 3300005544 Bacteria 3552
101 Ga0070686_100592980 3300005544 Bacteria 872
102 Ga0070695_100001227 3300005545 Bacteria 14082
103 Ga0070695_100396804 3300005545 Bacteria 1045
104 Ga0070696_100005647 3300005546 Bacteria 8358
105 Ga0070693_100000264 3300005547 Bacteria 24687
106 Ga0070665_100000535 3300005548 Bacteria 53560
107 Ga0070665_100002389 3300005548 Bacteria 20706
108 Ga0070665_100012076 3300005548 Bacteria 8713
109 Ga0070665_100028878 3300005548 Bacteria 5583
110 Ga0070665_100228730 3300005548 Bacteria 1860
111 Ga0070665_100335667 3300005548 Bacteria 1516
112 Ga0070665_100449775 3300005548 Bacteria 1298
113 Ga0070704_100066633 3300005549 Bacteria 2597
114 Ga0068855_100005350 3300005563 Bacteria 15657
115 Ga0068855_100024228 3300005563 Bacteria 7265
116 Ga0068855_100290513 3300005563 Bacteria 1812
117 Ga0068857_100002705 3300005577 Bacteria 14546
118 Ga0068857_100736301 3300005577 Bacteria 938
119 Ga0068854_100019054 3300005578 Bacteria 4618
120 Ga0068856_100008926 3300005614 Bacteria 9751
121 Ga0070702_100001185 3300005615 Bacteria 10512
122 Ga0068852_100182067 3300005616 Bacteria 1977
123 Ga0068859_100005823 3300005617 Bacteria 12519
124 Ga0068859_100012193 3300005617 Bacteria 8640
125 Ga0068859_100030808 3300005617 Bacteria 5383
126 Ga0068859_100225103 3300005617 Bacteria 1964
127 Ga0068859_100329930 3300005617 Bacteria 1620
128 Ga0068864_100000063 3300005618 Bacteria 119845
129 Ga0068864_100066286 3300005618 Bacteria 3134
130 Ga0068864_100491146 3300005618 Bacteria 1180
131 Ga0068866_10008721 3300005718 Bacteria 4286
132 Ga0068861_100023306 3300005719 Bacteria 4464
133 Ga0068851_10048337 3300005834 Bacteria 2156
134 Ga0068851_10056413 3300005834 Bacteria 2003
135 Ga0068863_100000001 3300005841 Bacteria 581116
136 Ga0068863_100000062 3300005841 Bacteria 119845
137 Ga0068863_100003765 3300005841 Bacteria 15006
138 Ga0068863_100017272 3300005841 Bacteria 6922
139 Ga0068858_100026100 3300005842 Bacteria 5432
140 Ga0068860_100066297 3300005843 Bacteria 3429
141 Ga0068860_100247972 3300005843 Bacteria 1733
142 Ga0068862_100000069 3300005844 Bacteria 122535
143 Ga0068862_100027598 3300005844 Bacteria 4779
144 Ga0068862_100115373 3300005844 Bacteria 2362
145 Ga0068862_100728167 3300005844 Bacteria 963
146 Ga0081455_10055012 3300005937 Bacteria 3388
147 Ga0081540_1098829 3300005983 Bacteria 1262
148 Ga0081539_10001073 3300005985 Bacteria 49846
149 Ga0075365_10082476 3300006038 Bacteria 2180
150 Ga0075365_10124826 3300006038 Bacteria 1778
151 Ga0075365_10166232 3300006038 Bacteria 1539
152 Ga0075365_10255096 3300006038 Bacteria 1233
153 Ga0075365_10394511 3300006038 Bacteria 976
154 Ga0075368_10042328 3300006042 Bacteria 1792
155 Ga0075363_100043911 3300006048 Bacteria 2366
156 Ga0075364_10116579 3300006051 Bacteria 1786
157 Ga0070715_10029967 3300006163 Bacteria 2195
158 Ga0070716_100000136 3300006173 Bacteria 29543
159 Ga0070712_100003026 3300006175 Bacteria 10403
160 Ga0070712_100103266 3300006175 Bacteria 2113
161 Ga0070712_100305893 3300006175 Bacteria 1288
162 Ga0075367_10038757 3300006178 Bacteria 2775
163 Ga0075366_10001911 3300006195 Bacteria 10534
164 Ga0075366_10012251 3300006195 Bacteria 4861
165 Ga0075366_10141343 3300006195 Bacteria 1455
166 Ga0075366_10260752 3300006195 Bacteria 1058
167 Ga0097621_100054116 3300006237 Bacteria 3272
168 Ga0068871_100049904 3300006358 Bacteria 3384
169 Ga0075428_100242240 3300006844 Bacteria 1945
170 Ga0075431_100031456 3300006847 Bacteria 5466
171 Ga0075431_100448577 3300006847 Bacteria 1286
172 Ga0075433_10059720 3300006852 Bacteria 3336
173 Ga0075434_100072316 3300006871 Bacteria 3441
174 Ga0075429_100025308 3300006880 Bacteria 5151
175 Ga0068865_100014630 3300006881 Bacteria 4990
176 Ga0068865_100108244 3300006881 Bacteria 2045
177 Ga0075436_100011629 3300006914 Bacteria 6040
178 Ga0097620_100005823 3300006931 Bacteria 12519
179 Ga0097620_100012193 3300006931 Bacteria 8640
180 Ga0097620_100030807 3300006931 Bacteria 5383
181 Ga0097620_100329945 3300006931 Bacteria 1620
182 Ga0075435_100109185 3300007076 Bacteria 2299
183 Ga0105251_10001006 3300009011 Bacteria 24692
184 Ga0105250_10018971 3300009092 Bacteria 2782
185 Ga0105240_10020029 3300009093 Bacteria 8931
186 Ga0105240_10228412 3300009093 Bacteria 2164
187 Ga0111539_10819853 3300009094 Bacteria 1083
188 Ga0105245_10008501 3300009098 Bacteria 8954
189 Ga0105245_10012824 3300009098 Bacteria 7303
190 Ga0105247_10000799 3300009101 Bacteria 24136
191 Ga0105247_10054565 3300009101 Bacteria 2465
192 Ga0114129_10179394 3300009147 Bacteria 2883
193 Ga0114129_10205703 3300009147 Bacteria 2663
194 Ga0114129_10349864 3300009147 Bacteria 1958
195 Ga0114129_10723021 3300009147 Bacteria 1277
196 Ga0105243_10000038 3300009148 Bacteria 174351
197 Ga0105243_10015360 3300009148 Bacteria 5792
198 Ga0105243_10291739 3300009148 Bacteria 1474
199 Ga0105241_10000478 3300009174 Bacteria 30203
200 Ga0105241_10000626 3300009174 Bacteria 26576
201 Ga0105242_10001227 3300009176 Bacteria 20231
202 Ga0105248_10000536 3300009177 Bacteria 43208
203 Ga0105248_10007144 3300009177 Bacteria 12244
204 Ga0105237_10000914 3300009545 Bacteria 39684
205 Ga0105237_10075553 3300009545 Bacteria 3361
206 Ga0105237_10271370 3300009545 Bacteria 1699
207 Ga0105238_10089930 3300009551 Bacteria 3057
208 Ga0105238_10479438 3300009551 Bacteria 1243
209 Ga0105249_10000160 3300009553 Bacteria 81883
210 Ga0105249_10010997 3300009553 Bacteria 7950
211 Ga0105249_10243157 3300009553 Bacteria 1780
212 Ga0105249_10306378 3300009553 Bacteria 1595
213 Ga0105148_100750 3300009978 Bacteria 2467
214 Ga0105239_10010452 3300010375 Bacteria 10379
215 Ga0105239_10407953 3300010375 Bacteria 1538
216 Ga0105246_10000610 3300011119 Bacteria 19889
217 Ga0105246_10001156 3300011119 Bacteria 15320
218 Ga0105246_10067023 3300011119 Bacteria 2515
219 Ga0105246_10390621 3300011119 Bacteria 1152
220 Ga0157373_10035437 3300013100 Bacteria 3583
221 Ga0157373_10040703 3300013100 Bacteria 3325
222 Ga0157371_10042262 3300013102 Bacteria 3249
223 Ga0157371_10200889 3300013102 Bacteria 1429
224 Ga0157370_10607000 3300013104 Bacteria 1002
225 Ga0157369_10003587 3300013105 Bacteria 18436
226 Ga0157369_10006519 3300013105 Bacteria 13523
227 Ga0157374_10001990 3300013296 Bacteria 17150
228 Ga0157378_10001108 3300013297 Bacteria 24518
229 Ga0163162_10003707 3300013306 Bacteria 14641
230 Ga0163162_10019223 3300013306 Bacteria 6699
231 Ga0163162_10139568 3300013306 Bacteria 2536
232 Ga0157372_10017151 3300013307 Bacteria 7773
233 Ga0157375_10159662 3300013308 Bacteria 2396
234 Ga0163163_10043887 3300014325 Bacteria 4385
235 Ga0157380_10000217 3300014326 Bacteria 34251
236 Ga0157380_10014827 3300014326 Bacteria 5709
237 Ga0157380_10183414 3300014326 Bacteria 1841
238 Ga0157380_10230765 3300014326 Bacteria 1662
239 Ga0157380_10281309 3300014326 Bacteria 1522
240 Ga0157377_10005353 3300014745 Bacteria 6023
241 Ga0157379_10005061 3300014968 Bacteria 11301
242 Ga0157379_10060843 3300014968 Bacteria 3377
243 Ga0157376_10007270 3300014969 Bacteria 7886
244 Ga0163161_10003299 3300017792 Bacteria 11334
245 Ga0163161_10008607 3300017792 Bacteria 7053
246 Ga0163161_10011472 3300017792 Bacteria 6148
247 Ga0206356_10071980 3300020070 Bacteria 2536
248 Ga0213876_10051205 3300021384 Bacteria 2182
249 Ga0213875_10000033 3300021388 Bacteria 170944
250 Ga0213875_10005479 3300021388 Bacteria 6802
251 Ga0209147_100735 3300025229 Bacteria 16276
252 Ga0209026_1000032 3300025250 Bacteria 322378
253 Ga0209759_1000142 3300025256 Bacteria 124090
254 Ga0209233_1000118 3300025261 Bacteria 236172
255 Ga0209675_1000838 3300025291 Bacteria 20134
256 Ga0209676_1001387 3300025292 Bacteria 23537
257 Ga0209758_1000001 3300025297 Bacteria 1981790
258 Ga0209050_1000017 3300025298 Bacteria 728928
259 Ga0209050_1004877 3300025298 Bacteria 8791
260 Ga0209257_1001118 3300025304 Bacteria 34674
261 Ga0209257_1008283 3300025304 Bacteria 5965
262 Ga0207656_10049493 3300025321 Bacteria 1812
263 Ga0207713_1017945 3300025735 Bacteria 3521
264 Ga0207653_10015748 3300025885 Bacteria 2373
265 Ga0207682_10018183 3300025893 Bacteria 2747
266 Ga0207692_10004280 3300025898 Bacteria 5645
267 Ga0207642_10008573 3300025899 Bacteria 3516
268 Ga0207710_10002843 3300025900 Bacteria 7886
269 Ga0207688_10002766 3300025901 Bacteria 9508
270 Ga0207680_10004688 3300025903 Bacteria 6495
271 Ga0207647_10017058 3300025904 Bacteria 4944
272 Ga0207647_10023940 3300025904 Bacteria 4032
273 Ga0207647_10081963 3300025904 Bacteria 1933
274 Ga0207699_10000734 3300025906 Bacteria 15646
275 Ga0207645_10010138 3300025907 Bacteria 6480
276 Ga0207645_10059441 3300025907 Bacteria 2441
277 Ga0207705_10003758 3300025909 Bacteria 11564
278 Ga0207705_10054556 3300025909 Bacteria 2880
279 Ga0207654_10024995 3300025911 Bacteria 3217
280 Ga0207654_10249204 3300025911 Bacteria 1190
281 Ga0207707_10510287 3300025912 Bacteria 1025
282 Ga0207695_10033960 3300025913 Bacteria 5553
283 Ga0207695_10470363 3300025913 Bacteria 1139
284 Ga0207695_10680158 3300025913 Bacteria 910
285 Ga0207671_10006068 3300025914 Bacteria 10888
286 Ga0207671_10021469 3300025914 Bacteria 4899
287 Ga0207671_10106264 3300025914 Bacteria 2131
288 Ga0207693_10003855 3300025915 Bacteria 12774
289 Ga0207693_10306164 3300025915 Bacteria 1244
290 Ga0207663_10013874 3300025916 Bacteria 4394
291 Ga0207662_10002913 3300025918 Bacteria 8678
292 Ga0207662_10053984 3300025918 Bacteria 2395
293 Ga0207657_10000347 3300025919 Bacteria 49144
294 Ga0207657_10031188 3300025919 Bacteria 4831
295 Ga0207649_10368930 3300025920 Bacteria 1067
296 Ga0207652_10393602 3300025921 Bacteria 1250
297 Ga0207646_10279574 3300025922 Bacteria 1508
298 Ga0207681_10020111 3300025923 Bacteria 4226
299 Ga0207694_10034937 3300025924 Bacteria 3854
300 Ga0207694_10077292 3300025924 Bacteria 2608
301 Ga0207650_10000986 3300025925 Bacteria 21395
302 Ga0207650_10009110 3300025925 Bacteria 6784
303 Ga0207659_10032390 3300025926 Bacteria 3587
304 Ga0207687_10013570 3300025927 Bacteria 5319
305 Ga0207687_10359341 3300025927 Bacteria 1188
306 Ga0207664_10020281 3300025929 Bacteria 4924
307 Ga0207664_10644584 3300025929 Bacteria 952
308 Ga0207644_10000544 3300025931 Bacteria 24497
309 Ga0207644_10011172 3300025931 Bacteria 5933
310 Ga0207644_10028609 3300025931 Bacteria 3860
311 Ga0207644_10056559 3300025931 Bacteria 2831
312 Ga0207644_10150615 3300025931 Bacteria 1800
313 Ga0207690_10020812 3300025932 Bacteria 4059
314 Ga0207690_10031983 3300025932 Bacteria 3372
315 Ga0207706_10000441 3300025933 Bacteria 44360
316 Ga0207706_10002879 3300025933 Bacteria 16670
317 Ga0207706_10163068 3300025933 Bacteria 1959
318 Ga0207706_10219030 3300025933 Bacteria 1667
319 Ga0207706_10509368 3300025933 Bacteria 1038
320 Ga0207686_10386450 3300025934 Bacteria 1063
321 Ga0207709_10000031 3300025935 Bacteria 329046
322 Ga0207709_10030534 3300025935 Bacteria 3136
323 Ga0207670_10008141 3300025936 Bacteria 5900
324 Ga0207669_10000057 3300025937 Bacteria 56270
325 Ga0207669_10009139 3300025937 Bacteria 4703
326 Ga0207669_10068181 3300025937 Bacteria 2220
327 Ga0207704_10375054 3300025938 Bacteria 1115
328 Ga0207665_10000533 3300025939 Bacteria 25620
329 Ga0207665_10157735 3300025939 Bacteria 1630
330 Ga0207691_10001403 3300025940 Bacteria 24078
331 Ga0207711_10000017 3300025941 Bacteria 441730
332 Ga0207711_10013750 3300025941 Bacteria 6720
333 Ga0207711_10146220 3300025941 Bacteria 2130
334 Ga0207689_10095073 3300025942 Bacteria 2447
335 Ga0207689_10235438 3300025942 Bacteria 1514
336 Ga0207661_10031344 3300025944 Bacteria 4106
337 Ga0207679_10021428 3300025945 Bacteria 4382
338 Ga0207679_10223257 3300025945 Bacteria 1586
339 Ga0207667_10045455 3300025949 Bacteria 4650
340 Ga0207667_10063290 3300025949 Bacteria 3865
341 Ga0207651_10014429 3300025960 Bacteria 4561
342 Ga0207651_10606704 3300025960 Bacteria 957
343 Ga0207712_10000222 3300025961 Bacteria 56073
344 Ga0207712_10006640 3300025961 Bacteria 7304
345 Ga0207668_10000056 3300025972 Bacteria 93913
346 Ga0207668_10020070 3300025972 Bacteria 4238
347 Ga0207668_10213178 3300025972 Bacteria 1546
348 Ga0207640_10025974 3300025981 Bacteria 3552
349 Ga0207640_10032087 3300025981 Bacteria 3254
350 Ga0207640_10361993 3300025981 Bacteria 1169
351 Ga0207658_10000133 3300025986 Bacteria 78402
352 Ga0207658_10003592 3300025986 Bacteria 10960
353 Ga0207658_10568958 3300025986 Bacteria 1015
354 Ga0207677_10080172 3300026023 Bacteria 2338
355 Ga0207677_10102986 3300026023 Bacteria 2106
356 Ga0207703_10053726 3300026035 Bacteria 3274
357 Ga0207639_10009135 3300026041 Bacteria 6832
358 Ga0207639_10010547 3300026041 Bacteria 6399
359 Ga0207639_10022775 3300026041 Bacteria 4515
360 Ga0207639_10424020 3300026041 Bacteria 1203
361 Ga0207678_10000271 3300026067 Bacteria 47011
362 Ga0207678_10000371 3300026067 Bacteria 40938
363 Ga0207678_10312033 3300026067 Bacteria 1352
364 Ga0207708_10000444 3300026075 Bacteria 32197
365 Ga0207702_10002479 3300026078 Bacteria 17436
366 Ga0207702_10031560 3300026078 Bacteria 4415
367 Ga0207641_10000001 3300026088 Bacteria 1180841
368 Ga0207641_10000022 3300026088 Bacteria 279334
369 Ga0207641_10017511 3300026088 Bacteria 5866
370 Ga0207641_10156085 3300026088 Bacteria 2070
371 Ga0207648_10019567 3300026089 Bacteria 6110
372 Ga0207648_10230588 3300026089 Bacteria 1647
373 Ga0207676_10000056 3300026095 Bacteria 124484
374 Ga0207676_10030709 3300026095 Bacteria 4036
375 Ga0207676_10048276 3300026095 Bacteria 3304
376 Ga0207676_10051185 3300026095 Bacteria 3223
377 Ga0207674_10001576 3300026116 Bacteria 29373
378 Ga0207675_100000203 3300026118 Bacteria 55051
379 Ga0207683_10000221 3300026121 Bacteria 50019
380 Ga0207683_10400755 3300026121 Bacteria 1262
381 Ga0207698_10006086 3300026142 Bacteria 7507
382 Ga0268266_10000457 3300028379 Bacteria 59586
383 Ga0268266_10001370 3300028379 Bacteria 29379
384 Ga0268266_10125646 3300028379 Bacteria 2288
385 Ga0268266_10202436 3300028379 Bacteria 1817
386 Ga0268265_10000044 3300028380 Bacteria 182545
387 Ga0268265_10025408 3300028380 Bacteria 4203
388 Ga0268265_10105545 3300028380 Bacteria 2286
389 Ga0268264_10018445 3300028381 Bacteria 5707
390 Ga0268264_10027808 3300028381 Bacteria 4623
391 Ga0307517_10042818 3300028786 Bacteria 4842
392 Ga0265340_10021513 3300031247 Bacteria 3308
393 Ga0307513_10128762 3300031456 Bacteria 2481
394 Ga0307408_100026409 3300031548 Bacteria 3989
395 Ga0307405_10045074 3300031731 Bacteria 2700
396 Ga0307413_10001504 3300031824 Bacteria 8914
397 Ga0307407_10091734 3300031903 Bacteria 1864
398 Ga0307412_10388292 3300031911 Bacteria 1132
399 Ga0307416_100112109 3300032002 Bacteria 2406
400 Ga0307416_100214883 3300032002 Bacteria 1838
401 Ga0307416_100300820 3300032002 Bacteria 1594
402 Ga0307414_10173781 3300032004 Bacteria 1725
403 Ga0307414_10178573 3300032004 Bacteria 1705
404 Ga0307414_10409363 3300032004 Bacteria 1180
405 Ga0307411_10027478 3300032005 Bacteria 3444
406 Ga0307411_10193337 3300032005 Bacteria 1555
407 Ga0307415_100249546 3300032126 Bacteria 1441
408 Ga0307415_100347879 3300032126 Bacteria 1246
409 Ga0373950_0005613 3300034818 Bacteria 1881
410 Ga0373923_0106647 3300035111 Bacteria 1240
411 Ga0373932_0002892 3300035112 Bacteria 4239
412 Ga0373954_0053889 3300035118 Bacteria 1891
413 Ga0373956_0062578 3300035119 Bacteria 1687
414 Ga0373960_0018279 3300035121 Bacteria 1826
415 Ga0373931_0008322 3300035691 Bacteria 4912
416 Ga0373937_0038800 3300036401 Bacteria 4340
417 Ga0373937_0144566 3300036401 Bacteria 2226
418 Ga0373925_0042979 3300037068 Bacteria 3353
419 Ga0395899_0000430 3300037312 Bacteria 48341
420 Ga0395900_0000086 3300037418 Bacteria 171749
421 Ga0395900_0067581 3300037418 Bacteria 3672
422 Ga0395900_0099409 3300037418 Bacteria 2988
423 Ga0395900_0229777 3300037418 Bacteria 1866
424 Ga0395898_0000901 3300037466 Bacteria 47807
425 Ga0395905_0000614 3300037471 Bacteria 47761
426 Ga0395905_0017970 3300037471 Bacteria 6714
427 Ga0436364_0979303 3300037853 Bacteria 39415
428 Ga0436364_1338082 3300037853 Bacteria 27858
429 Ga0395901_0000449 3300038443 Bacteria 47853
430 Ga0395901_0014587 3300038443 Bacteria 7988
431 Ga0395901_0204127 3300038443 Bacteria 2071
432 Ga0436365_0789836 3300039437 Bacteria 1112
433 Ga0436365_0804346 3300039437 Bacteria 2089
434 Ga0436365_1355696 3300039437 Bacteria 6053
435 Ga0436363_1066328 3300039450 Bacteria 1284
436 Ga0451789_1348687 3300041443 Bacteria 946
437 Ga0451800_1091503 3300041459 Bacteria 911
438 Ga0466972_0154466 3300044658 Bacteria 1078
439 Ga0466965_0404704 3300044683 Bacteria 754
440 Ga0453684_0072417 3300044712 Bacteria 4350
441 Ga0495627_000167 3300046453 Bacteria 74800
442 Ga0495603_0411026 3300046455 Bacteria 776
443 Ga0495638_0000011 3300046460 Bacteria 442453
444 Ga0495638_0006475 3300046460 Bacteria 8514
445 Ga0495638_0075581 3300046460 Bacteria 2053
446 Ga0495638_0180574 3300046460 Bacteria 1204
447 Ga0495650_0000492 3300046471 Bacteria 59983
448 Ga0495585_0014575 3300046492 Bacteria 4576
449 Ga0495583_0000138 3300046506 Bacteria 123486
450 Ga0495583_0000251 3300046506 Bacteria 88803
451 Ga0495610_0065825 3300046512 Bacteria 1709
452 Ga0495620_0120879 3300046515 Bacteria 1032
453 Ga0495628_0131467 3300046516 Bacteria 1914
454 Ga0495632_0000938 3300046519 Bacteria 25529
455 Ga0495643_0001928 3300046522 Bacteria 17473
456 Ga0495643_0075187 3300046522 Bacteria 1768
457 Ga0495643_0196594 3300046522 Bacteria 970
458 Ga0495648_0000036 3300046524 Bacteria 195997
459 Ga0495648_0004646 3300046524 Bacteria 11648
460 Ga0495587_0149570 3300046536 Bacteria 1331
461 Ga0495668_0000007 3300046616 Bacteria 552902
462 Ga0495634_0284350 3300046642 Bacteria 1004
463 Ga0495625_0000553 3300046660 Bacteria 54796
464 Ga0495625_0037557 3300046660 Bacteria 3553
465 Ga0495635_0377828 3300046663 Bacteria 943
466 Ga0495669_0008207 3300046684 Bacteria 4384
467 Ga0495671_0000054 3300046692 Bacteria 115885
468 Ga0495600_0000641 3300046809 Bacteria 18077
469 Ga0495673_0000158 3300047469 Bacteria 116122
470 Ga0495673_0027162 3300047469 Bacteria 2727
471 Ga0495602_0165080 3300048088 Bacteria 1725
472 Ga0496100_0111987 3300048903 Bacteria 1897
473 Ga0496101_0021025 3300048904 Bacteria 4478
474 Ga0496101_0033374 3300048904 Bacteria 3630
475 Ga0496101_0035354 3300048904 Bacteria 3534
476 Ga0496101_0084240 3300048904 Bacteria 2354
477 Ga0496102_0072856 3300048905 Bacteria 3157
478 Ga0496102_0203018 3300048905 Bacteria 1868
479 Ga0496103_0152437 3300048906 Bacteria 1481
480 Ga0496103_0161843 3300048906 Bacteria 1435
481 Ga0496104_0022464 3300048907 Bacteria 5795
482 Ga0496104_0056425 3300048907 Bacteria 3714
483 Ga0496104_0064083 3300048907 Bacteria 3487
484 Ga0496104_0114913 3300048907 Bacteria 2582
485 Ga0496105_0011723 3300048908 Bacteria 6937
486 Ga0496105_0024045 3300048908 Bacteria 4948
487 Ga0496106_0127115 3300048909 Bacteria 1996
488 Ga0496107_0100260 3300048910 Bacteria 2123
489 Ga0496108_0048752 3300048911 Bacteria 3541
490 Ga0496108_0092011 3300048911 Bacteria 2578
491 Ga0496108_0298577 3300048911 Bacteria 1403
492 Ga0496108_0713479 3300048911 Bacteria 869
493 Ga0496109_0094332 3300048912 Bacteria 2770
494 Ga0496109_0296106 3300048912 Bacteria 1525
495 Ga0496109_0325677 3300048912 Bacteria 1450
496 Ga0496110_0009334 3300048913 Bacteria 7936
497 Ga0496110_0064083 3300048913 Bacteria 3247
498 Ga0496111_0021769 3300048914 Bacteria 4479
499 Ga0496111_0252747 3300048914 Bacteria 1308
500 Ga0496112_0005800 3300048915 Bacteria 10742
501 Ga0496112_0016155 3300048915 Bacteria 6983
502 Ga0496112_0040197 3300048915 Bacteria 4572
503 Ga0496112_0049894 3300048915 Bacteria 4102
504 Ga0496112_0141211 3300048915 Bacteria 2378
505 Ga0496113_0008633 3300048916 Bacteria 6647
506 Ga0496113_0237603 3300048916 Bacteria 1453
507 Ga0496114_0021787 3300048917 Bacteria 5215
508 Ga0496115_0023976 3300048918 Bacteria 4739
509 Ga0496115_0091962 3300048918 Bacteria 2479
510 Ga0496117_0009524 3300048920 Bacteria 9020
511 Ga0496118_0020768 3300048921 Bacteria 5812
512 Ga0496119_0053130 3300048922 Bacteria 2477
513 Ga0496120_0005636 3300048923 Bacteria 9919
514 Ga0496120_0104411 3300048923 Bacteria 1491
515 Ga0496122_0009142 3300048925 Bacteria 10501
516 Ga0496123_0016411 3300048926 Bacteria 6017
517 Ga0496124_0001397 3300048927 Bacteria 36152
518 Ga0496124_0030412 3300048927 Bacteria 4793
519 Ga0496124_0089860 3300048927 Bacteria 2507
520 Ga0496124_0147353 3300048927 Bacteria 1851
521 Ga0496126_0127437 3300048929 Bacteria 2202
522 Ga0495682_0020538 3300049460 Bacteria 2479
523 Ga0501031_0111761 3300049568 Bacteria 1784
524 Ga0501031_0301914 3300049568 Bacteria 1038
525 Ga0501032_0020198 3300049569 Bacteria 4643
526 Ga0501033_0017722 3300049570 Bacteria 5378
527 Ga0501033_0167547 3300049570 Bacteria 1579
528 Ga0501034_0008076 3300049571 Bacteria 11161
529 Ga0501034_0031600 3300049571 Bacteria 5378
530 Ga0501034_0040265 3300049571 Bacteria 4730
531 Ga0501034_0418731 3300049571 Bacteria 1261
532 Ga0501036_0043648 3300049572 Bacteria 3797
533 Ga0501036_0071904 3300049572 Bacteria 2925
534 Ga0501036_0380011 3300049572 Bacteria 1179
535 Ga0501037_0042496 3300049573 Bacteria 3339
536 Ga0501037_0084498 3300049573 Bacteria 2299
537 Ga0501038_0071456 3300049574 Bacteria 2943
538 Ga0501038_0196821 3300049574 Bacteria 1619
539 Ga0501038_0716965 3300049574 Bacteria 748
540 Ga0501039_0020531 3300049575 Bacteria 5062
541 Ga0501039_0537816 3300049575 Bacteria 917
542 Ga0501040_0006012 3300049576 Bacteria 7854
543 Ga0501040_0013184 3300049576 Bacteria 5437
544 Ga0501040_0039284 3300049576 Bacteria 3218
545 Ga0501040_0053368 3300049576 Bacteria 2768
546 Ga0501041_0022085 3300049577 Bacteria 3810
547 Ga0501041_0129762 3300049577 Bacteria 1570
548 Ga0501042_0026279 3300049578 Bacteria 4092
549 Ga0501042_0342588 3300049578 Bacteria 1081
550 Ga0501043_0027397 3300049579 Bacteria 4473
551 Ga0501043_0074314 3300049579 Bacteria 2670
552 Ga0501046_0000033 3300049580 Bacteria 174675
553 Ga0501046_0016707 3300049580 Bacteria 6139
554 Ga0501046_0025507 3300049580 Bacteria 4837
555 Ga0501046_0144071 3300049580 Bacteria 1800
556 Ga0501047_0041016 3300049581 Bacteria 4473
557 Ga0501047_0387613 3300049581 Bacteria 1231
558 Ga0501047_0572922 3300049581 Bacteria 952
559 Ga0501048_0016006 3300049582 Bacteria 5530
560 Ga0501048_0031328 3300049582 Bacteria 3847
561 Ga0501048_0187373 3300049582 Bacteria 1466
562 Ga0501068_0012935 3300049584 Bacteria 4742
563 Ga0501068_0013380 3300049584 Bacteria 4668
564 Ga0501069_0038025 3300049585 Bacteria 2656
565 Ga0501070_0461617 3300049586 Bacteria 1023
566 Ga0501070_0495128 3300049586 Bacteria 982
567 Ga0501071_0164905 3300049587 Bacteria 1657
568 Ga0501071_0334464 3300049587 Bacteria 1151
569 Ga0501071_0792359 3300049587 Bacteria 730
570 Ga0501072_0030772 3300049588 Bacteria 4199
571 Ga0501072_0076905 3300049588 Bacteria 2641
572 Ga0501072_0192510 3300049588 Bacteria 1626
573 Ga0501072_0386466 3300049588 Bacteria 1110
574 Ga0501073_0026085 3300049589 Bacteria 4187
575 Ga0501073_0128210 3300049589 Bacteria 1759
576 Ga0501073_0255101 3300049589 Bacteria 1211
577 Ga0501074_0034169 3300049590 Bacteria 3686
578 Ga0501074_0060955 3300049590 Bacteria 2718
579 Ga0501074_0323809 3300049590 Bacteria 1094
580 Ga0501075_0067512 3300049591 Bacteria 2700
581 Ga0501075_0100624 3300049591 Bacteria 2195
582 Ga0501076_0047848 3300049592 Bacteria 3382
583 Ga0501076_0052128 3300049592 Bacteria 3240
584 Ga0501076_0088884 3300049592 Bacteria 2483
585 Ga0501077_0011993 3300049593 Bacteria 5423
586 Ga0501077_0102213 3300049593 Bacteria 1816
587 Ga0501223_000230 3300049663 Bacteria 14369
588 Ga0501235_003856 3300049669 Bacteria 3237
589 Ga0501225_0000080 3300049705 Bacteria 30728
590 Ga0501225_0018412 3300049705 Bacteria 1936
591 Ga0501225_0039065 3300049705 Bacteria 1308
592 Ga0501079_0082311 3300049741 Bacteria 2489
593 Ga0501079_0112779 3300049741 Bacteria 2113
594 Ga0501079_0176670 3300049741 Bacteria 1665
595 Ga0501079_0402486 3300049741 Bacteria 1074
596 Ga0501079_0672590 3300049741 Bacteria 815
597 Ga0501080_0002809 3300049742 Bacteria 15307
598 Ga0501080_0316647 3300049742 Bacteria 1413
599 Ga0501081_0005965 3300049743 Bacteria 7888
600 Ga0501081_0011068 3300049743 Bacteria 5900
601 Ga0501081_0099027 3300049743 Bacteria 2059
602 Ga0501081_0117007 3300049743 Bacteria 1896
603 Ga0501083_0026184 3300049744 Bacteria 4033
604 Ga0501035_0025372 3300049822 Bacteria 5434
605 Ga0501035_0029884 3300049822 Bacteria 4969
606 Ga0501035_0190442 3300049822 Bacteria 1763
607 Ga0501035_0324676 3300049822 Bacteria 1292
608 Ga0501035_0727227 3300049822 Bacteria 798
609 Ga0501044_0033064 3300049823 Bacteria 5434
610 Ga0501045_0022603 3300049824 Bacteria 4504
611 Ga0501045_0035905 3300049824 Bacteria 3599
612 Ga0501045_0165446 3300049824 Bacteria 1647
613 nmdc:mga03n38_11638_c1 3300050490 Bacteria 3286
614 nmdc:mga00v17_278592_c1 3300050491 Bacteria 1085
615 nmdc:mga0yw44_144014_c1 3300050492 Bacteria 1550
616 nmdc:mga0yw44_226882_c1 3300050492 Bacteria 1239
617 nmdc:mga0yw44_24883_c1 3300050492 Bacteria 3395
618 nmdc:mga0yw44_59240_c1 3300050492 Bacteria 2342
619 nmdc:mga0k408_352386_c1 3300050493 Bacteria 877
620 nmdc:mga06z11_37456_c1 3300050494 Bacteria 2402
621 nmdc:mga06z11_75776_c1 3300050494 Bacteria 1792
622 nmdc:mga07m45_74995_c1 3300050496 Bacteria 1927
623 nmdc:mga07m45_87014_c1 3300050496 Bacteria 1788
624 nmdc:mga09592_131361_c1 3300050508 Bacteria 2155
625 nmdc:mga0qj67_257581_c1 3300050509 Bacteria 1415
626 nmdc:mga06r32_122939_c1 3300050510 Bacteria 2561
627 nmdc:mga06r32_78872_c1 3300050510 Bacteria 3202
628 nmdc:mga08y16_127183_c1 3300050511 Bacteria 2651
629 nmdc:mga0n895_189356_c1 3300050512 Bacteria 2089
630 nmdc:mga0n895_426707_c1 3300050512 Bacteria 1340
631 nmdc:mga0rr50_20821_c1 3300050513 Bacteria 4464
632 nmdc:mga0a205_249275_c1 3300050515 Bacteria 1656
633 nmdc:mga0sz30_85908_c1 3300050516 Bacteria 1365
634 Ga0495601_0149578 3300053077 Bacteria 1524
635 Ga0500610_0160457 3300053079 Bacteria 1119
636 Ga0495655_0064330 3300053083 Bacteria 1009
637 Ga0495655_0079630 3300053083 Bacteria 934
638 Ga0495595_0114175 3300053084 Bacteria 1312
639 Ga0495619_0013696 3300053085 Bacteria 5112
640 Ga0500643_008114 3300053087 Bacteria 4159
641 Ga0500646_0132432 3300053090 Bacteria 811
642 Ga0500555_000408 3300053103 Bacteria 17901
643 Ga0500593_000443 3300053117 Bacteria 16325
644 Ga0500568_0000005 3300053139 Bacteria 614296
645 Ga0500568_0000131 3300053139 Bacteria 67970
646 Ga0500620_000396 3300053155 Bacteria 8062
647 Ga0500627_0063679 3300053158 Bacteria 1625
648 Ga0500627_0220688 3300053158 Bacteria 846
649 Ga0500636_0004813 3300053177 Bacteria 7660
650 Ga0500587_000386 3300053739 Bacteria 5071
651 Ga0501084_0020964 3300054114 Bacteria 5450
652 Ga0501084_0032100 3300054114 Bacteria 4392
653 Ga0501084_0055882 3300054114 Bacteria 3303
654 Ga0501084_0351475 3300054114 Bacteria 1245
655 Ga0501084_0821507 3300054114 Bacteria 783
656 Ga0501082_0057130 3300060353 Bacteria 3362
657 Ga0501082_0077754 3300060353 Bacteria 2861
658 Ga0501082_0141462 3300060353 Bacteria 2088
659 Ga0530510_0059609 3300061734 Bacteria 2761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8004727605 8004729149 207
2 3300037312 Ga0395899_0000430 Ga0395899_0000430_17773_18420 212
3 3300037418 Ga0395900_0000086 Ga0395900_0000086_17773_18420 212
4 3300037466 Ga0395898_0000901 Ga0395898_0000901_17773_18420 212
5 3300037471 Ga0395905_0000614 Ga0395905_0000614_29342_29989 212
6 3300038443 Ga0395901_0000449 Ga0395901_0000449_29306_29953 212
7 3300049587 Ga0501071_0792359 Ga0501071_0792359_67_711 213
8 iso_pu_bacteria 2958137437 2958140378 213
9 iso_pu_bacteria 2906386501 2906386994 215
10 3300050509 nmdc:mga0qj67_257581_c1 nmdc:mga0qj67_257581_c1_23_682 216
11 3300050510 nmdc:mga06r32_122939_c1 nmdc:mga06r32_122939_c1_27_686 216
12 3300044683 Ga0466965_0404704 Ga0466965_0404704_20_712 217
13 3300049573 Ga0501037_0042496 Ga0501037_0042496_10_672 217
14 3300050494 nmdc:mga06z11_37456_c1 nmdc:mga06z11_37456_c1_19_681 217
15 iso_pu_bacteria 2852653556 2852653973 217
16 iso_pu_bacteria 2970619444 2970623898 217
17 3300049574 Ga0501038_0716965 Ga0501038_0716965_78_737 218
18 3300049822 Ga0501035_0727227 Ga0501035_0727227_118_777 218
19 3300049581 Ga0501047_0572922 Ga0501047_0572922_31_702 219
20 iso_pu_bacteria 2643221662 2644345853 219
21 iso_pu_bacteria 2937891427 2937894403 221
22 iso_pu_bacteria 2513237351 2514586656 222
23 3300050493 nmdc:mga0k408_352386_c1 nmdc:mga0k408_352386_c1_43_723 223
24 3300005617 Ga0068859_100329930 Ga0068859_1003299302 224
25 3300006931 Ga0097620_100329945 Ga0097620_1003299452 224
26 iso_pu_bacteria 2599185301 2599936983 224
27 iso_pu_bacteria 2922185730 2922189986 224
28 iso_pu_bacteria 2968117919 2968122325 224
29 iso_pu_bacteria 2979742915 2979751876 224
30 iso_pu_bacteria 2503198000 2503199046 225
31 iso_pu_bacteria 2508501123 2509117686 225
32 iso_pu_bacteria 2509276022 2509393997 225
33 iso_pu_bacteria 2512875016 2512933554 225
34 iso_pu_bacteria 2512875024 2512961693 225
35 iso_pu_bacteria 2513237164 2514035624 225
36 iso_pu_bacteria 2588253730 2588519632 225
37 iso_pu_bacteria 2738543024 2739306056 225
38 iso_pu_bacteria 2874139085 2874139431 225
39 iso_pu_bacteria 2874168670 2874170686 225
40 iso_pu_bacteria 2876363079 2876364192 225
41 iso_pu_bacteria 2888337043 2888343731 225
42 iso_pu_bacteria 2903448605 2903453704 225
43 iso_pu_bacteria 2903521522 2903525648 225
44 iso_pu_bacteria 2903528002 2903532805 225
45 iso_pu_bacteria 2937848649 2937851652 225
46 iso_pu_bacteria 2958064165 2958065713 225
47 iso_pu_bacteria 2963644680 2963645650 225
48 iso_pu_bacteria 2968083720 2968085014 225
49 iso_pu_bacteria 2977922695 2977929508 225
50 iso_pu_bacteria 2989771324 2989771548 225
51 iso_pu_bacteria 3000135777 3000137714 225
52 iso_pu_bacteria 3004211236 3004218362 225
53 iso_pu_bacteria 3004218560 3004219541 225
54 iso_pu_bacteria 3004289098 3004289836 225
55 iso_pu_bacteria 637000159 637076659 225
56 iso_pu_bacteria 8055617313 8055618245 225
57 iso_pu_bacteria 2510065059 2510318332 226
58 iso_pu_bacteria 2597489875 2597811930 226
59 iso_pu_bacteria 2643221595 2643988509 226
60 iso_pu_bacteria 2643221627 2644154574 226
61 iso_pu_bacteria 2687453392 2688596316 226
62 iso_pu_bacteria 2844009547 2844011145 226
63 iso_pu_bacteria 2847686936 2847690250 226
64 iso_pu_bacteria 2856328259 2856329807 226
65 iso_pu_bacteria 2856334872 2856336609 226
66 iso_pu_bacteria 2869249662 2869256323 226
67 iso_pu_bacteria 2869264136 2869267489 226
68 iso_pu_bacteria 2869271264 2869271957 226
69 iso_pu_bacteria 2871451962 2871459197 226
70 iso_pu_bacteria 2871459585 2871464886 226
71 iso_pu_bacteria 2871466892 2871472361 226
72 iso_pu_bacteria 2874102143 2874104888 226
73 iso_pu_bacteria 2874131515 2874137000 226
74 iso_pu_bacteria 2874162495 2874166806 226
75 iso_pu_bacteria 2876392853 2876399229 226
76 iso_pu_bacteria 2876399893 2876402455 226
77 iso_pu_bacteria 2876406927 2876410423 226
78 iso_pu_bacteria 2878774303 2878776656 226
79 iso_pu_bacteria 2878781027 2878785619 226
80 iso_pu_bacteria 2881161766 2881165328 226
81 iso_pu_bacteria 2885326080 2885330905 226
82 iso_pu_bacteria 2904659560 2904665756 226
83 iso_pu_bacteria 2906328253 2906333889 226
84 iso_pu_bacteria 2906363423 2906366417 226
85 iso_pu_bacteria 2906370794 2906377444 226
86 iso_pu_bacteria 2906378014 2906384998 226
87 iso_pu_bacteria 2906393657 2906400506 226
88 iso_pu_bacteria 2906408224 2906411097 226
89 iso_pu_bacteria 2922151315 2922158489 226
90 iso_pu_bacteria 2922172374 2922176703 226
91 iso_pu_bacteria 2922178524 2922180400 226
92 iso_pu_bacteria 2924748358 2924751080 226
93 iso_pu_bacteria 2924762789 2924768566 226
94 iso_pu_bacteria 2958115193 2958120422 226
95 iso_pu_bacteria 2958122699 2958128059 226
96 iso_pu_bacteria 2958158011 2958162706 226
97 iso_pu_bacteria 2961114664 2961121099 226
98 iso_pu_bacteria 2965025482 2965026648 226
99 iso_pu_bacteria 2965040258 2965041476 226
100 iso_pu_bacteria 2965047637 2965053612 226
101 iso_pu_bacteria 2965062239 2965067793 226
102 iso_pu_bacteria 2965089291 2965095222 226
103 iso_pu_bacteria 2965102966 2965109243 226
104 iso_pu_bacteria 2968097103 2968100250 226
105 iso_pu_bacteria 2968110612 2968117249 226
106 iso_pu_bacteria 2968128360 2968129655 226
107 iso_pu_bacteria 2970489779 2970490811 226
108 iso_pu_bacteria 2970510686 2970511100 226
109 iso_pu_bacteria 2970547951 2970551978 226
110 iso_pu_bacteria 2977872689 2977874311 226
111 iso_pu_bacteria 2977915119 2977916843 226
112 iso_pu_bacteria 2977935797 2977938925 226
113 iso_pu_bacteria 2977950692 2977953576 226
114 iso_pu_bacteria 2977957713 2977961341 226
115 iso_pu_bacteria 2979779861 2979784468 226
116 iso_pu_bacteria 2979793036 2979798346 226
117 iso_pu_bacteria 2987645492 2987648562 226
118 iso_pu_bacteria 2987666974 2987673295 226
119 iso_pu_bacteria 2987673487 2987673725 226
120 iso_pu_bacteria 3004167301 3004173647 226
121 iso_pu_bacteria 3004195979 3004200191 226
122 iso_pu_bacteria 649633066 649870869 226
123 iso_pu_bacteria 8004300914 8004303087 226
124 iso_pu_bacteria 8004695233 8004703094 226
125 iso_pu_bacteria 8004703790 8004706421 226
126 3300025934 Ga0207686_10386450 Ga0207686_103864502 227
127 3300031247 Ga0265340_10021513 Ga0265340_100215134 227
128 3300049741 Ga0501079_0672590 Ga0501079_0672590_114_800 227
129 3300053139 Ga0500568_0000131 Ga0500568_0000131_30664_31356 227
130 iso_pu_bacteria 2856364286 2856365056 227
131 iso_pu_bacteria 2857349434 2857353266 227
132 iso_pu_bacteria 2869169390 2869175900 227
133 iso_pu_bacteria 2869234852 2869241044 227
134 iso_pu_bacteria 2869256925 2869260636 227
135 iso_pu_bacteria 2869285874 2869286320 227
136 iso_pu_bacteria 2871429161 2871430289 227
137 iso_pu_bacteria 2871435913 2871443269 227
138 iso_pu_bacteria 2871481445 2871485875 227
139 iso_pu_bacteria 2874109183 2874113996 227
140 iso_pu_bacteria 2874116593 2874123092 227
141 iso_pu_bacteria 2874146452 2874146706 227
142 iso_pu_bacteria 2874155637 2874155780 227
143 iso_pu_bacteria 2876386047 2876388565 227
144 iso_pu_bacteria 2876413966 2876414109 227
145 iso_pu_bacteria 2876420981 2876427348 227
146 iso_pu_bacteria 2878730984 2878733884 227
147 iso_pu_bacteria 2878745973 2878746485 227
148 iso_pu_bacteria 2882632389 2882640357 227
149 iso_pu_bacteria 2903492973 2903499675 227
150 iso_pu_bacteria 2906308376 2906308886 227
151 iso_pu_bacteria 2906321335 2906322166 227
152 iso_pu_bacteria 2906401398 2906405346 227
153 iso_pu_bacteria 2924710171 2924710696 227
154 iso_pu_bacteria 2924733363 2924737252 227
155 iso_pu_bacteria 2924741084 2924746547 227
156 iso_pu_bacteria 2937813078 2937822225 227
157 iso_pu_bacteria 2937861824 2937863556 227
158 iso_pu_bacteria 2958108152 2958111071 227
159 iso_pu_bacteria 2958130278 2958130719 227
160 iso_pu_bacteria 2958179912 2958180058 227
161 iso_pu_bacteria 2961077736 2961077885 227
162 iso_pu_bacteria 2961183825 2961184839 227
163 iso_pu_bacteria 2968138860 2968144192 227
164 iso_pu_bacteria 2970532167 2970539004 227
165 iso_pu_bacteria 2970627176 2970630113 227
166 iso_pu_bacteria 2977843712 2977844278 227
167 iso_pu_bacteria 2977851361 2977855402 227
168 iso_pu_bacteria 2977942078 2977942401 227
169 iso_pu_bacteria 2987636660 2987641858 227
170 iso_pu_bacteria 2996386984 2996389852 227
171 iso_pu_bacteria 3004203850 3004209330 227
172 iso_pu_bacteria 3004232784 3004236243 227
173 iso_pu_bacteria 3004268573 3004269397 227
174 iso_pu_bacteria 8004312739 8004313354 227
175 iso_pu_bacteria 8004387939 8004388520 227
176 iso_pu_bacteria 8004714634 8004715142 227
177 3300006847 Ga0075431_100448577 Ga0075431_1004485772 228
178 3300009093 Ga0105240_10228412 Ga0105240_102284122 228
179 3300025913 Ga0207695_10680158 Ga0207695_106801582 228
180 3300048905 Ga0496102_0072856 Ga0496102_0072856_1166_1861 228
181 3300048926 Ga0496123_0016411 Ga0496123_0016411_377_1072 228
182 3300048927 Ga0496124_0001397 Ga0496124_0001397_974_1669 228
183 3300049575 Ga0501039_0537816 Ga0501039_0537816_18_713 228
184 3300002741 JGI25157J39369_1001721 JGI25157J39369_10017218 229
185 3300003203 JGI25406J46586_10000167 JGI25406J46586_1000016722 229
186 3300005985 Ga0081539_10001073 Ga0081539_1000107336 229
187 3300006038 Ga0075365_10166232 Ga0075365_101662322 229
188 3300006038 Ga0075365_10394511 Ga0075365_103945112 229
189 3300006042 Ga0075368_10042328 Ga0075368_100423282 229
190 3300006048 Ga0075363_100043911 Ga0075363_1000439113 229
191 3300006051 Ga0075364_10116579 Ga0075364_101165792 229
192 3300006175 Ga0070712_100305893 Ga0070712_1003058932 229
193 3300009551 Ga0105238_10479438 Ga0105238_104794382 229
194 3300010375 Ga0105239_10407953 Ga0105239_104079532 229
195 3300025250 Ga0209026_1000032 Ga0209026_100003297 229
196 3300025256 Ga0209759_1000142 Ga0209759_1000142100 229
197 3300025904 Ga0207647_10081963 Ga0207647_100819632 229
198 3300025913 Ga0207695_10470363 Ga0207695_104703632 229
199 3300025915 Ga0207693_10306164 Ga0207693_103061642 229
200 3300025920 Ga0207649_10368930 Ga0207649_103689302 229
201 3300025927 Ga0207687_10359341 Ga0207687_103593412 229
202 3300037068 Ga0373925_0042979 Ga0373925_0042979_2196_2894 229
203 3300046460 Ga0495638_0006475 Ga0495638_0006475_4815_5513 229
204 3300046460 Ga0495638_0075581 Ga0495638_0075581_627_1325 229
205 3300046512 Ga0495610_0065825 Ga0495610_0065825_170_868 229
206 3300046515 Ga0495620_0120879 Ga0495620_0120879_95_793 229
207 3300046522 Ga0495643_0196594 Ga0495643_0196594_32_730 229
208 3300046642 Ga0495634_0284350 Ga0495634_0284350_236_934 229
209 3300046660 Ga0495625_0037557 Ga0495625_0037557_1666_2364 229
210 3300048922 Ga0496119_0053130 Ga0496119_0053130_1649_2347 229
211 3300048927 Ga0496124_0089860 Ga0496124_0089860_1513_2211 229
212 3300048929 Ga0496126_0127437 Ga0496126_0127437_458_1156 229
213 3300049578 Ga0501042_0342588 Ga0501042_0342588_273_968 229
214 3300050492 nmdc:mga0yw44_144014_c1 nmdc:mga0yw44_144014_c1_690_1388 229
215 3300050492 nmdc:mga0yw44_24883_c1 nmdc:mga0yw44_24883_c1_1582_2280 229
216 3300053079 Ga0500610_0160457 Ga0500610_0160457_39_737 229
217 3300053083 Ga0495655_0064330 Ga0495655_0064330_32_730 229
218 3300053083 Ga0495655_0079630 Ga0495655_0079630_15_713 229
219 3300053155 Ga0500620_000396 Ga0500620_000396_4030_4728 229
220 3300003214 JGI25165J46597_1000052 JGI25165J46597_1000052230 230
221 3300005355 Ga0070671_100043860 Ga0070671_1000438605 230
222 3300005365 Ga0070688_100197022 Ga0070688_1001970222 230
223 3300005435 Ga0070714_100284098 Ga0070714_1002840982 230
224 3300005548 Ga0070665_100028878 Ga0070665_1000288786 230
225 3300005844 Ga0068862_100728167 Ga0068862_1007281671 230
226 3300006038 Ga0075365_10124826 Ga0075365_101248261 230
227 3300006038 Ga0075365_10255096 Ga0075365_102550962 230
228 3300006178 Ga0075367_10038757 Ga0075367_100387573 230
229 3300009147 Ga0114129_10205703 Ga0114129_102057034 230
230 3300009553 Ga0105249_10306378 Ga0105249_103063782 230
231 3300014326 Ga0157380_10183414 Ga0157380_101834142 230
232 3300021384 Ga0213876_10051205 Ga0213876_100512052 230
233 3300021388 Ga0213875_10000033 Ga0213875_1000003362 230
234 3300025261 Ga0209233_1000118 Ga0209233_100011837 230
235 3300025929 Ga0207664_10644584 Ga0207664_106445841 230
236 3300025939 Ga0207665_10157735 Ga0207665_101577353 230
237 3300025972 Ga0207668_10213178 Ga0207668_102131782 230
238 3300026095 Ga0207676_10030709 Ga0207676_100307095 230
239 3300028379 Ga0268266_10125646 Ga0268266_101256462 230
240 3300037418 Ga0395900_0229777 Ga0395900_0229777_738_1439 230
241 3300037853 Ga0436364_1338082 Ga0436364_1338082_20512_21213 230
242 3300038443 Ga0395901_0204127 Ga0395901_0204127_150_851 230
243 3300039437 Ga0436365_0804346 Ga0436365_0804346_896_1597 230
244 3300048904 Ga0496101_0035354 Ga0496101_0035354_1275_2000 230
245 3300048907 Ga0496104_0064083 Ga0496104_0064083_2059_2784 230
246 3300048911 Ga0496108_0298577 Ga0496108_0298577_380_1105 230
247 3300048915 Ga0496112_0141211 Ga0496112_0141211_897_1598 230
248 3300048923 Ga0496120_0005636 Ga0496120_0005636_6007_6708 230
249 3300049568 Ga0501031_0111761 Ga0501031_0111761_1003_1749 230
250 3300049569 Ga0501032_0020198 Ga0501032_0020198_846_1547 230
251 3300049570 Ga0501033_0017722 Ga0501033_0017722_3097_3798 230
252 3300049571 Ga0501034_0008076 Ga0501034_0008076_1274_1975 230
253 3300049571 Ga0501034_0031600 Ga0501034_0031600_1581_2282 230
254 3300049571 Ga0501034_0040265 Ga0501034_0040265_3145_3891 230
255 3300049572 Ga0501036_0071904 Ga0501036_0071904_1581_2282 230
256 3300049573 Ga0501037_0084498 Ga0501037_0084498_612_1313 230
257 3300049574 Ga0501038_0071456 Ga0501038_0071456_1581_2282 230
258 3300049575 Ga0501039_0020531 Ga0501039_0020531_846_1547 230
259 3300049576 Ga0501040_0039284 Ga0501040_0039284_1856_2557 230
260 3300049577 Ga0501041_0129762 Ga0501041_0129762_642_1343 230
261 3300049579 Ga0501043_0027397 Ga0501043_0027397_2192_2893 230
262 3300049580 Ga0501046_0025507 Ga0501046_0025507_1981_2682 230
263 3300049581 Ga0501047_0041016 Ga0501047_0041016_1581_2282 230
264 3300049582 Ga0501048_0016006 Ga0501048_0016006_2272_2973 230
265 3300049584 Ga0501068_0012935 Ga0501068_0012935_2461_3162 230
266 3300049585 Ga0501069_0038025 Ga0501069_0038025_1671_2372 230
267 3300049587 Ga0501071_0164905 Ga0501071_0164905_322_1023 230
268 3300049588 Ga0501072_0076905 Ga0501072_0076905_1753_2454 230
269 3300049589 Ga0501073_0026085 Ga0501073_0026085_2765_3466 230
270 3300049590 Ga0501074_0034169 Ga0501074_0034169_2559_3260 230
271 3300049705 Ga0501225_0018412 Ga0501225_0018412_1128_1826 230
272 3300049742 Ga0501080_0002809 Ga0501080_0002809_3058_3759 230
273 3300049744 Ga0501083_0026184 Ga0501083_0026184_1704_2405 230
274 3300049822 Ga0501035_0025372 Ga0501035_0025372_3097_3798 230
275 3300049822 Ga0501035_0324676 Ga0501035_0324676_257_958 230
276 3300049823 Ga0501044_0033064 Ga0501044_0033064_1637_2338 230
277 3300049824 Ga0501045_0022603 Ga0501045_0022603_1980_2681 230
278 3300050490 nmdc:mga03n38_11638_c1 nmdc:mga03n38_11638_c1_1909_2610 230
279 3300050491 nmdc:mga00v17_278592_c1 nmdc:mga00v17_278592_c1_232_933 230
280 3300050492 nmdc:mga0yw44_226882_c1 nmdc:mga0yw44_226882_c1_320_1021 230
281 3300050494 nmdc:mga06z11_75776_c1 nmdc:mga06z11_75776_c1_545_1246 230
282 3300050496 nmdc:mga07m45_74995_c1 nmdc:mga07m45_74995_c1_661_1362 230
283 3300050496 nmdc:mga07m45_87014_c1 nmdc:mga07m45_87014_c1_605_1306 230
284 3300053158 Ga0500627_0063679 Ga0500627_0063679_26_727 230
285 3300053158 Ga0500627_0220688 Ga0500627_0220688_84_785 230
286 iso_pu_bacteria 2869162929 2869167180 230
287 3300005341 Ga0070691_10135955 Ga0070691_101359552 231
288 3300005544 Ga0070686_100592980 Ga0070686_1005929801 231
289 3300005548 Ga0070665_100449775 Ga0070665_1004497752 231
290 3300005617 Ga0068859_100225103 Ga0068859_1002251032 231
291 3300005843 Ga0068860_100066297 Ga0068860_1000662974 231
292 3300006881 Ga0068865_100014630 Ga0068865_1000146304 231
293 3300009148 Ga0105243_10291739 Ga0105243_102917392 231
294 3300011119 Ga0105246_10067023 Ga0105246_100670234 231
295 3300013306 Ga0163162_10139568 Ga0163162_101395682 231
296 3300014326 Ga0157380_10281309 Ga0157380_102813093 231
297 3300017792 Ga0163161_10011472 Ga0163161_100114726 231
298 3300025907 Ga0207645_10010138 Ga0207645_100101382 231
299 3300025937 Ga0207669_10009139 Ga0207669_100091392 231
300 3300025942 Ga0207689_10235438 Ga0207689_102354382 231
301 3300025981 Ga0207640_10361993 Ga0207640_103619932 231
302 3300026067 Ga0207678_10312033 Ga0207678_103120331 231
303 3300026089 Ga0207648_10230588 Ga0207648_102305882 231
304 3300036401 Ga0373937_0144566 Ga0373937_0144566_992_1696 231
305 3300044658 Ga0466972_0154466 Ga0466972_0154466_176_880 231
306 3300046455 Ga0495603_0411026 Ga0495603_0411026_37_741 231
307 3300046663 Ga0495635_0377828 Ga0495635_0377828_142_846 231
308 3300048088 Ga0495602_0165080 Ga0495602_0165080_40_744 231
309 3300048907 Ga0496104_0056425 Ga0496104_0056425_2574_3272 231
310 3300048912 Ga0496109_0094332 Ga0496109_0094332_137_835 231
311 3300048918 Ga0496115_0023976 Ga0496115_0023976_3490_4188 231
312 3300049568 Ga0501031_0301914 Ga0501031_0301914_152_850 231
313 3300049570 Ga0501033_0167547 Ga0501033_0167547_675_1373 231
314 3300049571 Ga0501034_0418731 Ga0501034_0418731_152_856 231
315 3300049572 Ga0501036_0043648 Ga0501036_0043648_3025_3723 231
316 3300049572 Ga0501036_0380011 Ga0501036_0380011_154_858 231
317 3300049576 Ga0501040_0013184 Ga0501040_0013184_2540_3238 231
318 3300049576 Ga0501040_0053368 Ga0501040_0053368_1981_2685 231
319 3300049577 Ga0501041_0022085 Ga0501041_0022085_2105_2803 231
320 3300049578 Ga0501042_0026279 Ga0501042_0026279_2425_3123 231
321 3300049580 Ga0501046_0016707 Ga0501046_0016707_4921_5625 231
322 3300049581 Ga0501047_0387613 Ga0501047_0387613_151_855 231
323 3300049582 Ga0501048_0187373 Ga0501048_0187373_676_1374 231
324 3300049584 Ga0501068_0013380 Ga0501068_0013380_69_773 231
325 3300049586 Ga0501070_0495128 Ga0501070_0495128_229_927 231
326 3300049587 Ga0501071_0334464 Ga0501071_0334464_267_971 231
327 3300049588 Ga0501072_0192510 Ga0501072_0192510_587_1291 231
328 3300049588 Ga0501072_0386466 Ga0501072_0386466_322_1020 231
329 3300049590 Ga0501074_0323809 Ga0501074_0323809_247_951 231
330 3300049591 Ga0501075_0067512 Ga0501075_0067512_1616_2314 231
331 3300049591 Ga0501075_0100624 Ga0501075_0100624_1145_1849 231
332 3300049592 Ga0501076_0052128 Ga0501076_0052128_100_804 231
333 3300049592 Ga0501076_0088884 Ga0501076_0088884_493_1191 231
334 3300049593 Ga0501077_0011993 Ga0501077_0011993_776_1480 231
335 3300049741 Ga0501079_0082311 Ga0501079_0082311_1435_2139 231
336 3300049741 Ga0501079_0112779 Ga0501079_0112779_1343_2041 231
337 3300049742 Ga0501080_0316647 Ga0501080_0316647_149_853 231
338 3300049743 Ga0501081_0005965 Ga0501081_0005965_6403_7107 231
339 3300049743 Ga0501081_0011068 Ga0501081_0011068_2625_3323 231
340 3300049743 Ga0501081_0117007 Ga0501081_0117007_912_1616 231
341 3300049824 Ga0501045_0035905 Ga0501045_0035905_426_1124 231
342 3300049824 Ga0501045_0165446 Ga0501045_0165446_324_1028 231
343 3300053085 Ga0495619_0013696 Ga0495619_0013696_3720_4424 231
344 3300054114 Ga0501084_0020964 Ga0501084_0020964_2379_3083 231
345 3300054114 Ga0501084_0032100 Ga0501084_0032100_1167_1865 231
346 3300060353 Ga0501082_0077754 Ga0501082_0077754_86_784 231
347 3300060353 Ga0501082_0141462 Ga0501082_0141462_995_1699 231
348 3300061734 Ga0530510_0059609 Ga0530510_0059609_24_722 231
349 iso_pu_bacteria 2852680915 2852682627 231
350 iso_pu_bacteria 2937980651 2937982618 231
351 3300005338 Ga0068868_100019864 Ga0068868_1000198643 232
352 3300005355 Ga0070671_100077222 Ga0070671_1000772223 232
353 3300005364 Ga0070673_100201978 Ga0070673_1002019783 232
354 3300005364 Ga0070673_100968301 Ga0070673_1009683011 232
355 3300005544 Ga0070686_100025610 Ga0070686_1000256104 232
356 3300005618 Ga0068864_100066286 Ga0068864_1000662864 232
357 3300005983 Ga0081540_1098829 Ga0081540_10988292 232
358 3300006358 Ga0068871_100049904 Ga0068871_1000499044 232
359 3300006871 Ga0075434_100072316 Ga0075434_1000723165 232
360 3300009098 Ga0105245_10012824 Ga0105245_100128242 232
361 3300025927 Ga0207687_10013570 Ga0207687_100135702 232
362 3300025931 Ga0207644_10056559 Ga0207644_100565593 232
363 3300026023 Ga0207677_10080172 Ga0207677_100801722 232
364 3300026095 Ga0207676_10048276 Ga0207676_100482764 232
365 3300044712 Ga0453684_0072417 Ga0453684_0072417_1307_2062 232
366 3300049580 Ga0501046_0000033 Ga0501046_0000033_18351_19079 232
367 3300049586 Ga0501070_0461617 Ga0501070_0461617_271_981 232
368 3300049741 Ga0501079_0402486 Ga0501079_0402486_231_938 232
369 3300049822 Ga0501035_0029884 Ga0501035_0029884_3442_4152 232
370 3300001977 JGI24746J21847_1011509 JGI24746J21847_10115092 233
371 3300001990 JGI24737J22298_10006157 JGI24737J22298_100061572 233
372 3300002075 JGI24738J21930_10014815 JGI24738J21930_100148152 233
373 3300002239 JGI24034J26672_10006184 JGI24034J26672_100061842 233
374 3300005327 Ga0070658_10028412 Ga0070658_100284125 233
375 3300005329 Ga0070683_100012785 Ga0070683_1000127854 233
376 3300005330 Ga0070690_100060095 Ga0070690_1000600952 233
377 3300005331 Ga0070670_100024711 Ga0070670_1000247113 233
378 3300005333 Ga0070677_10010859 Ga0070677_100108594 233
379 3300005334 Ga0068869_100077158 Ga0068869_1000771583 233
380 3300005335 Ga0070666_10001688 Ga0070666_100016885 233
381 3300005336 Ga0070680_100012436 Ga0070680_1000124362 233
382 3300005337 Ga0070682_100005303 Ga0070682_1000053033 233
383 3300005338 Ga0068868_100106201 Ga0068868_1001062013 233
384 3300005339 Ga0070660_100002943 Ga0070660_10000294310 233
385 3300005340 Ga0070689_100003122 Ga0070689_10000312213 233
386 3300005341 Ga0070691_10000070 Ga0070691_1000007025 233
387 3300005343 Ga0070687_100001000 Ga0070687_1000010005 233
388 3300005344 Ga0070661_100000668 Ga0070661_10000066822 233
389 3300005345 Ga0070692_10000024 Ga0070692_100000245 233
390 3300005347 Ga0070668_100001091 Ga0070668_10000109125 233
391 3300005353 Ga0070669_100003333 Ga0070669_10000333311 233
392 3300005354 Ga0070675_100001968 Ga0070675_1000019684 233
393 3300005355 Ga0070671_100026086 Ga0070671_1000260864 233
394 3300005356 Ga0070674_100004629 Ga0070674_1000046296 233
395 3300005364 Ga0070673_100005461 Ga0070673_1000054615 233
396 3300005365 Ga0070688_100002260 Ga0070688_1000022604 233
397 3300005366 Ga0070659_100002640 Ga0070659_1000026404 233
398 3300005367 Ga0070667_100001713 Ga0070667_1000017132 233
399 3300005406 Ga0070703_10054652 Ga0070703_100546521 233
400 3300005434 Ga0070709_10003174 Ga0070709_100031746 233
401 3300005435 Ga0070714_100023409 Ga0070714_1000234093 233
402 3300005436 Ga0070713_100019976 Ga0070713_1000199763 233
403 3300005439 Ga0070711_100000117 Ga0070711_10000011734 233
404 3300005440 Ga0070705_100000313 Ga0070705_10000031328 233
405 3300005444 Ga0070694_100000845 Ga0070694_10000084515 233
406 3300005455 Ga0070663_100001391 Ga0070663_10000139110 233
407 3300005456 Ga0070678_100000130 Ga0070678_10000013028 233
408 3300005457 Ga0070662_100004052 Ga0070662_1000040526 233
409 3300005458 Ga0070681_10638268 Ga0070681_106382681 233
410 3300005459 Ga0068867_100143690 Ga0068867_1001436902 233
411 3300005466 Ga0070685_10048639 Ga0070685_100486392 233
412 3300005530 Ga0070679_100206265 Ga0070679_1002062652 233
413 3300005535 Ga0070684_100021766 Ga0070684_1000217662 233
414 3300005536 Ga0070697_100001143 Ga0070697_10000114312 233
415 3300005539 Ga0068853_100004638 Ga0068853_10000463812 233
416 3300005543 Ga0070672_100002673 Ga0070672_1000026734 233
417 3300005545 Ga0070695_100001227 Ga0070695_1000012279 233
418 3300005546 Ga0070696_100005647 Ga0070696_1000056473 233
419 3300005547 Ga0070693_100000264 Ga0070693_10000026413 233
420 3300005548 Ga0070665_100228730 Ga0070665_1002287303 233
421 3300005549 Ga0070704_100066633 Ga0070704_1000666334 233
422 3300005563 Ga0068855_100005350 Ga0068855_1000053503 233
423 3300005577 Ga0068857_100002705 Ga0068857_1000027055 233
424 3300005578 Ga0068854_100019054 Ga0068854_1000190544 233
425 3300005615 Ga0070702_100001185 Ga0070702_10000118512 233
426 3300005617 Ga0068859_100012193 Ga0068859_1000121935 233
427 3300005718 Ga0068866_10008721 Ga0068866_100087212 233
428 3300005719 Ga0068861_100023306 Ga0068861_1000233062 233
429 3300005834 Ga0068851_10048337 Ga0068851_100483372 233
430 3300005841 Ga0068863_100003765 Ga0068863_10000376514 233
431 3300005842 Ga0068858_100026100 Ga0068858_1000261002 233
432 3300005844 Ga0068862_100027598 Ga0068862_1000275985 233
433 3300005937 Ga0081455_10055012 Ga0081455_100550124 233
434 3300006163 Ga0070715_10029967 Ga0070715_100299672 233
435 3300006173 Ga0070716_100000136 Ga0070716_1000001363 233
436 3300006175 Ga0070712_100003026 Ga0070712_1000030267 233
437 3300006237 Ga0097621_100054116 Ga0097621_1000541164 233
438 3300006844 Ga0075428_100242240 Ga0075428_1002422403 233
439 3300006847 Ga0075431_100031456 Ga0075431_1000314562 233
440 3300006852 Ga0075433_10059720 Ga0075433_100597204 233
441 3300006880 Ga0075429_100025308 Ga0075429_1000253086 233
442 3300006881 Ga0068865_100108244 Ga0068865_1001082442 233
443 3300006914 Ga0075436_100011629 Ga0075436_1000116295 233
444 3300006931 Ga0097620_100012193 Ga0097620_1000121937 233
445 3300007076 Ga0075435_100109185 Ga0075435_1001091853 233
446 3300009092 Ga0105250_10018971 Ga0105250_100189712 233
447 3300009093 Ga0105240_10020029 Ga0105240_100200296 233
448 3300009094 Ga0111539_10819853 Ga0111539_108198532 233
449 3300009098 Ga0105245_10008501 Ga0105245_1000850114 233
450 3300009101 Ga0105247_10000799 Ga0105247_100007996 233
451 3300009147 Ga0114129_10723021 Ga0114129_107230212 233
452 3300009148 Ga0105243_10015360 Ga0105243_100153605 233
453 3300009174 Ga0105241_10000626 Ga0105241_1000062620 233
454 3300009176 Ga0105242_10001227 Ga0105242_1000122725 233
455 3300009177 Ga0105248_10007144 Ga0105248_1000714411 233
456 3300009545 Ga0105237_10000914 Ga0105237_100009148 233
457 3300009551 Ga0105238_10089930 Ga0105238_100899302 233
458 3300009553 Ga0105249_10010997 Ga0105249_100109975 233
459 3300010375 Ga0105239_10010452 Ga0105239_100104527 233
460 3300011119 Ga0105246_10000610 Ga0105246_1000061021 233
461 3300013100 Ga0157373_10040703 Ga0157373_100407033 233
462 3300013102 Ga0157371_10042262 Ga0157371_100422622 233
463 3300013105 Ga0157369_10003587 Ga0157369_1000358711 233
464 3300013296 Ga0157374_10001990 Ga0157374_100019904 233
465 3300013297 Ga0157378_10001108 Ga0157378_100011086 233
466 3300013306 Ga0163162_10003707 Ga0163162_1000370716 233
467 3300013307 Ga0157372_10017151 Ga0157372_100171515 233
468 3300013308 Ga0157375_10159662 Ga0157375_101596621 233
469 3300014326 Ga0157380_10014827 Ga0157380_100148274 233
470 3300014326 Ga0157380_10230765 Ga0157380_102307652 233
471 3300014745 Ga0157377_10005353 Ga0157377_100053533 233
472 3300014968 Ga0157379_10005061 Ga0157379_1000506115 233
473 3300014969 Ga0157376_10007270 Ga0157376_100072708 233
474 3300017792 Ga0163161_10003299 Ga0163161_1000329912 233
475 3300025885 Ga0207653_10015748 Ga0207653_100157482 233
476 3300025893 Ga0207682_10018183 Ga0207682_100181834 233
477 3300025898 Ga0207692_10004280 Ga0207692_100042803 233
478 3300025899 Ga0207642_10008573 Ga0207642_100085734 233
479 3300025900 Ga0207710_10002843 Ga0207710_100028435 233
480 3300025901 Ga0207688_10002766 Ga0207688_100027663 233
481 3300025903 Ga0207680_10004688 Ga0207680_100046882 233
482 3300025904 Ga0207647_10017058 Ga0207647_100170585 233
483 3300025906 Ga0207699_10000734 Ga0207699_1000073416 233
484 3300025911 Ga0207654_10024995 Ga0207654_100249953 233
485 3300025912 Ga0207707_10510287 Ga0207707_105102872 233
486 3300025913 Ga0207695_10033960 Ga0207695_100339603 233
487 3300025914 Ga0207671_10106264 Ga0207671_101062643 233
488 3300025915 Ga0207693_10003855 Ga0207693_100038556 233
489 3300025916 Ga0207663_10013874 Ga0207663_100138744 233
490 3300025918 Ga0207662_10002913 Ga0207662_100029134 233
491 3300025919 Ga0207657_10000347 Ga0207657_1000034725 233
492 3300025921 Ga0207652_10393602 Ga0207652_103936022 233
493 3300025922 Ga0207646_10279574 Ga0207646_102795741 233
494 3300025923 Ga0207681_10020111 Ga0207681_100201115 233
495 3300025924 Ga0207694_10077292 Ga0207694_100772922 233
496 3300025925 Ga0207650_10009110 Ga0207650_100091105 233
497 3300025926 Ga0207659_10032390 Ga0207659_100323902 233
498 3300025929 Ga0207664_10020281 Ga0207664_100202813 233
499 3300025931 Ga0207644_10028609 Ga0207644_100286092 233
500 3300025932 Ga0207690_10020812 Ga0207690_100208122 233
501 3300025933 Ga0207706_10000441 Ga0207706_1000044139 233
502 3300025935 Ga0207709_10030534 Ga0207709_100305342 233
503 3300025936 Ga0207670_10008141 Ga0207670_100081416 233
504 3300025937 Ga0207669_10068181 Ga0207669_100681812 233
505 3300025938 Ga0207704_10375054 Ga0207704_103750541 233
506 3300025939 Ga0207665_10000533 Ga0207665_1000053322 233
507 3300025940 Ga0207691_10001403 Ga0207691_1000140319 233
508 3300025941 Ga0207711_10013750 Ga0207711_100137503 233
509 3300025942 Ga0207689_10095073 Ga0207689_100950733 233
510 3300025944 Ga0207661_10031344 Ga0207661_100313444 233
511 3300025945 Ga0207679_10021428 Ga0207679_100214284 233
512 3300025949 Ga0207667_10045455 Ga0207667_100454555 233
513 3300025960 Ga0207651_10606704 Ga0207651_106067041 233
514 3300025961 Ga0207712_10006640 Ga0207712_100066403 233
515 3300025972 Ga0207668_10020070 Ga0207668_100200701 233
516 3300025981 Ga0207640_10025974 Ga0207640_100259744 233
517 3300026023 Ga0207677_10102986 Ga0207677_101029862 233
518 3300026035 Ga0207703_10053726 Ga0207703_100537263 233
519 3300026041 Ga0207639_10010547 Ga0207639_100105472 233
520 3300026067 Ga0207678_10000371 Ga0207678_1000037134 233
521 3300026075 Ga0207708_10000444 Ga0207708_1000044430 233
522 3300026078 Ga0207702_10031560 Ga0207702_100315604 233
523 3300026088 Ga0207641_10017511 Ga0207641_100175115 233
524 3300026089 Ga0207648_10019567 Ga0207648_100195673 233
525 3300026095 Ga0207676_10051185 Ga0207676_100511851 233
526 3300026116 Ga0207674_10001576 Ga0207674_1000157616 233
527 3300026118 Ga0207675_100000203 Ga0207675_10000020333 233
528 3300026121 Ga0207683_10000221 Ga0207683_1000022125 233
529 3300028379 Ga0268266_10202436 Ga0268266_102024363 233
530 3300028380 Ga0268265_10025408 Ga0268265_100254083 233
531 3300028381 Ga0268264_10027808 Ga0268264_100278082 233
532 3300034818 Ga0373950_0005613 Ga0373950_0005613_721_1425 233
533 3300035112 Ga0373932_0002892 Ga0373932_0002892_3044_3748 233
534 3300035121 Ga0373960_0018279 Ga0373960_0018279_312_1016 233
535 3300035691 Ga0373931_0008322 Ga0373931_0008322_3214_3918 233
536 3300037418 Ga0395900_0067581 Ga0395900_0067581_1750_2454 233
537 3300037471 Ga0395905_0017970 Ga0395905_0017970_2180_2884 233
538 3300038443 Ga0395901_0014587 Ga0395901_0014587_1663_2367 233
539 3300048903 Ga0496100_0111987 Ga0496100_0111987_757_1461 233
540 3300048904 Ga0496101_0021025 Ga0496101_0021025_870_1574 233
541 3300048905 Ga0496102_0203018 Ga0496102_0203018_437_1141 233
542 3300048906 Ga0496103_0161843 Ga0496103_0161843_295_999 233
543 3300048907 Ga0496104_0022464 Ga0496104_0022464_1776_2480 233
544 3300048908 Ga0496105_0024045 Ga0496105_0024045_221_925 233
545 3300048909 Ga0496106_0127115 Ga0496106_0127115_423_1127 233
546 3300048911 Ga0496108_0048752 Ga0496108_0048752_2401_3105 233
547 3300048911 Ga0496108_0092011 Ga0496108_0092011_221_925 233
548 3300048912 Ga0496109_0296106 Ga0496109_0296106_728_1432 233
549 3300048913 Ga0496110_0009334 Ga0496110_0009334_600_1304 233
550 3300048914 Ga0496111_0021769 Ga0496111_0021769_423_1127 233
551 3300048915 Ga0496112_0005800 Ga0496112_0005800_3677_4381 233
552 3300048915 Ga0496112_0049894 Ga0496112_0049894_2401_3105 233
553 3300048916 Ga0496113_0008633 Ga0496113_0008633_4024_4728 233
554 3300048917 Ga0496114_0021787 Ga0496114_0021787_3912_4616 233
555 3300048918 Ga0496115_0091962 Ga0496115_0091962_94_798 233
556 3300049574 Ga0501038_0196821 Ga0501038_0196821_539_1243 233
557 3300049576 Ga0501040_0006012 Ga0501040_0006012_404_1108 233
558 3300049579 Ga0501043_0074314 Ga0501043_0074314_1404_2108 233
559 3300049580 Ga0501046_0144071 Ga0501046_0144071_65_769 233
560 3300049582 Ga0501048_0031328 Ga0501048_0031328_2631_3335 233
561 3300049588 Ga0501072_0030772 Ga0501072_0030772_196_900 233
562 3300049589 Ga0501073_0128210 Ga0501073_0128210_645_1349 233
563 3300049590 Ga0501074_0060955 Ga0501074_0060955_1317_2021 233
564 3300049592 Ga0501076_0047848 Ga0501076_0047848_592_1296 233
565 3300049593 Ga0501077_0102213 Ga0501077_0102213_96_800 233
566 3300049741 Ga0501079_0176670 Ga0501079_0176670_122_826 233
567 3300049743 Ga0501081_0099027 Ga0501081_0099027_862_1566 233
568 3300050508 nmdc:mga09592_131361_c1 nmdc:mga09592_131361_c1_374_1078 233
569 3300050510 nmdc:mga06r32_78872_c1 nmdc:mga06r32_78872_c1_45_749 233
570 3300050511 nmdc:mga08y16_127183_c1 nmdc:mga08y16_127183_c1_1069_1773 233
571 3300050512 nmdc:mga0n895_189356_c1 nmdc:mga0n895_189356_c1_747_1451 233
572 3300050513 nmdc:mga0rr50_20821_c1 nmdc:mga0rr50_20821_c1_866_1570 233
573 3300050515 nmdc:mga0a205_249275_c1 nmdc:mga0a205_249275_c1_838_1542 233
574 3300053087 Ga0500643_008114 Ga0500643_008114_991_1713 233
575 3300054114 Ga0501084_0055882 Ga0501084_0055882_342_1046 233
576 3300054114 Ga0501084_0351475 Ga0501084_0351475_76_786 233
577 3300054114 Ga0501084_0821507 Ga0501084_0821507_53_763 233
578 3300060353 Ga0501082_0057130 Ga0501082_0057130_1914_2618 233
579 3300005337 Ga0070682_100126816 Ga0070682_1001268162 234
580 3300005545 Ga0070695_100396804 Ga0070695_1003968042 234
581 3300003781 Ga0055536_1006426 Ga0055536_10064262 235
582 3300003791 Ga0055530_10000522 Ga0055530_1000052232 235
583 3300003794 Ga0055531_10005448 Ga0055531_100054487 235
584 3300005456 Ga0070678_100029766 Ga0070678_1000297664 235
585 3300005563 Ga0068855_100024228 Ga0068855_1000242286 235
586 3300006038 Ga0075365_10082476 Ga0075365_100824762 235
587 3300006195 Ga0075366_10001911 Ga0075366_100019114 235
588 3300006195 Ga0075366_10260752 Ga0075366_102607522 235
589 3300009147 Ga0114129_10349864 Ga0114129_103498641 235
590 3300011119 Ga0105246_10001156 Ga0105246_100011568 235
591 3300025291 Ga0209675_1000838 Ga0209675_100083816 235
592 3300025292 Ga0209676_1001387 Ga0209676_100138719 235
593 3300025298 Ga0209050_1000017 Ga0209050_100001773 235
594 3300025304 Ga0209257_1001118 Ga0209257_100111835 235
595 3300025933 Ga0207706_10002879 Ga0207706_1000287917 235
596 3300025949 Ga0207667_10063290 Ga0207667_100632902 235
597 3300026121 Ga0207683_10400755 Ga0207683_104007552 235
598 3300031456 Ga0307513_10128762 Ga0307513_101287624 235
599 3300032004 Ga0307414_10178573 Ga0307414_101785732 235
600 3300046460 Ga0495638_0180574 Ga0495638_0180574_80_796 235
601 3300049589 Ga0501073_0255101 Ga0501073_0255101_311_1024 235
602 3300050492 nmdc:mga0yw44_59240_c1 nmdc:mga0yw44_59240_c1_1247_1987 235
603 3300050516 nmdc:mga0sz30_85908_c1 nmdc:mga0sz30_85908_c1_271_987 235
604 3300053090 Ga0500646_0132432 Ga0500646_0132432_15_731 235
605 3300053117 Ga0500593_000443 Ga0500593_000443_14016_14735 235
606 3300005434 Ga0070709_10012916 Ga0070709_100129164 236
607 3300005536 Ga0070697_100542921 Ga0070697_1005429211 236
608 3300025298 Ga0209050_1004877 Ga0209050_10048773 236
609 3300025933 Ga0207706_10509368 Ga0207706_105093682 236
610 3300035111 Ga0373923_0106647 Ga0373923_0106647_25_744 236
611 3300035118 Ga0373954_0053889 Ga0373954_0053889_376_1095 236
612 3300035119 Ga0373956_0062578 Ga0373956_0062578_440_1159 236
613 3300036401 Ga0373937_0038800 Ga0373937_0038800_1916_2635 236
614 3300046516 Ga0495628_0131467 Ga0495628_0131467_1159_1878 236
615 3300046660 Ga0495625_0000553 Ga0495625_0000553_31094_31804 236
616 3300048904 Ga0496101_0033374 Ga0496101_0033374_293_1042 236
617 3300048906 Ga0496103_0152437 Ga0496103_0152437_262_1011 236
618 3300048910 Ga0496107_0100260 Ga0496107_0100260_418_1167 236
619 3300053077 Ga0495601_0149578 Ga0495601_0149578_418_1137 236
620 3300053084 Ga0495595_0114175 Ga0495595_0114175_61_780 236
621 3300053139 Ga0500568_0000005 Ga0500568_0000005_72586_73308 236
622 iso_pu_bacteria 2599185354 2600202679 236
623 iso_pu_bacteria 2751185897 2753764463 236
624 3300021388 Ga0213875_10005479 Ga0213875_100054795 237
625 3300037853 Ga0436364_0979303 Ga0436364_0979303_35637_36362 237
626 3300046522 Ga0495643_0075187 Ga0495643_0075187_1006_1746 237
627 3300005441 Ga0070700_100207674 Ga0070700_1002076742 238
628 3300005548 Ga0070665_100012076 Ga0070665_1000120764 238
629 3300006175 Ga0070712_100103266 Ga0070712_1001032663 238
630 3300025941 Ga0207711_10146220 Ga0207711_101462203 239
631 3300028379 Ga0268266_10001370 Ga0268266_100013707 239
632 3300039437 Ga0436365_0789836 Ga0436365_0789836_13_747 239
633 iso_pu_bacteria 2643221563 2643836364 239
634 iso_pu_bacteria 2643221608 2644052840 239
635 iso_pu_bacteria 2919709256 2919712121 239
636 3300001990 JGI24737J22298_10006332 JGI24737J22298_100063323 240
637 3300005328 Ga0070676_10045792 Ga0070676_100457922 240
638 3300005343 Ga0070687_100448485 Ga0070687_1004484852 240
639 3300005354 Ga0070675_100100760 Ga0070675_1001007603 240
640 3300005356 Ga0070674_100009057 Ga0070674_1000090576 240
641 3300005356 Ga0070674_100257880 Ga0070674_1002578802 240
642 3300005366 Ga0070659_100427745 Ga0070659_1004277452 240
643 3300005456 Ga0070678_100007175 Ga0070678_1000071757 240
644 3300005458 Ga0070681_10035084 Ga0070681_100350843 240
645 3300005548 Ga0070665_100002389 Ga0070665_1000023899 240
646 3300006195 Ga0075366_10012251 Ga0075366_100122514 240
647 3300009148 Ga0105243_10000038 Ga0105243_1000003825 240
648 3300011119 Ga0105246_10390621 Ga0105246_103906212 240
649 3300013102 Ga0157371_10200889 Ga0157371_102008893 240
650 3300013104 Ga0157370_10607000 Ga0157370_106070002 240
651 3300025907 Ga0207645_10059441 Ga0207645_100594412 240
652 3300025909 Ga0207705_10003758 Ga0207705_100037583 240
653 3300025931 Ga0207644_10011172 Ga0207644_100111726 240
654 3300025932 Ga0207690_10031983 Ga0207690_100319834 240
655 3300025933 Ga0207706_10219030 Ga0207706_102190303 240
656 3300025935 Ga0207709_10000031 Ga0207709_10000031258 240
657 3300025937 Ga0207669_10000057 Ga0207669_1000005749 240
658 3300025960 Ga0207651_10014429 Ga0207651_100144295 240
659 3300025986 Ga0207658_10568958 Ga0207658_105689582 240
660 3300026041 Ga0207639_10022775 Ga0207639_100227755 240
661 3300026088 Ga0207641_10156085 Ga0207641_101560852 240
662 3300028379 Ga0268266_10000457 Ga0268266_1000045742 240
663 3300028786 Ga0307517_10042818 Ga0307517_100428184 240
664 3300031824 Ga0307413_10001504 Ga0307413_1000150410 240
665 3300031903 Ga0307407_10091734 Ga0307407_100917342 240
666 3300032002 Ga0307416_100214883 Ga0307416_1002148833 240
667 3300032002 Ga0307416_100300820 Ga0307416_1003008202 240
668 3300032004 Ga0307414_10173781 Ga0307414_101737812 240
669 3300032005 Ga0307411_10027478 Ga0307411_100274782 240
670 3300032005 Ga0307411_10193337 Ga0307411_101933372 240
671 3300032126 Ga0307415_100249546 Ga0307415_1002495461 240
672 3300037418 Ga0395900_0099409 Ga0395900_0099409_2208_2942 240
673 3300041443 Ga0451789_1348687 Ga0451789_1348687_147_881 240
674 3300041459 Ga0451800_1091503 Ga0451800_1091503_117_845 240
675 3300046471 Ga0495650_0000492 Ga0495650_0000492_34270_35001 240
676 3300046492 Ga0495585_0014575 Ga0495585_0014575_2167_2898 240
677 3300046506 Ga0495583_0000138 Ga0495583_0000138_68383_69111 240
678 3300046522 Ga0495643_0001928 Ga0495643_0001928_3731_4462 240
679 3300046524 Ga0495648_0004646 Ga0495648_0004646_9673_10404 240
680 3300046536 Ga0495587_0149570 Ga0495587_0149570_550_1281 240
681 3300046616 Ga0495668_0000007 Ga0495668_0000007_75566_76297 240
682 3300046684 Ga0495669_0008207 Ga0495669_0008207_1457_2221 240
683 3300046809 Ga0495600_0000641 Ga0495600_0000641_909_1640 240
684 3300048904 Ga0496101_0084240 Ga0496101_0084240_73_813 240
685 3300048913 Ga0496110_0064083 Ga0496110_0064083_1131_1871 240
686 3300048915 Ga0496112_0016155 Ga0496112_0016155_1800_2540 240
687 3300048915 Ga0496112_0040197 Ga0496112_0040197_91_831 240
688 3300048916 Ga0496113_0237603 Ga0496113_0237603_90_830 240
689 3300049460 Ga0495682_0020538 Ga0495682_0020538_490_1218 240
690 3300053103 Ga0500555_000408 Ga0500555_000408_14966_15694 240
691 3300053739 Ga0500587_000386 Ga0500587_000386_1032_1766 240
692 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006335 241
693 3300025297 Ga0209758_1000001 Ga0209758_10000011491 241
694 3300025914 Ga0207671_10006068 Ga0207671_100060687 241
695 3300005333 Ga0070677_10000238 Ga0070677_1000023816 242
696 3300005347 Ga0070668_100000068 Ga0070668_10000006841 242
697 3300005355 Ga0070671_100001553 Ga0070671_10000155320 242
698 3300005548 Ga0070665_100000535 Ga0070665_10000053515 242
699 3300005548 Ga0070665_100335667 Ga0070665_1003356672 242
700 3300005617 Ga0068859_100005823 Ga0068859_10000582320 242
701 3300005841 Ga0068863_100000001 Ga0068863_100000001203 242
702 3300005843 Ga0068860_100247972 Ga0068860_1002479723 242
703 3300005844 Ga0068862_100115373 Ga0068862_1001153733 242
704 3300006931 Ga0097620_100005823 Ga0097620_10000582320 242
705 3300025931 Ga0207644_10000544 Ga0207644_1000054410 242
706 3300025972 Ga0207668_10000056 Ga0207668_10000056103 242
707 3300026088 Ga0207641_10000001 Ga0207641_10000001540 242
708 3300028380 Ga0268265_10105545 Ga0268265_101055453 242
709 3300028381 Ga0268264_10018445 Ga0268264_100184453 242
710 3300001904 JGI24736J21556_1001434 JGI24736J21556_10014342 243
711 3300001915 JGI24741J21665_1000020 JGI24741J21665_10000205 243
712 3300001976 JGI24752J21851_1002297 JGI24752J21851_10022972 243
713 3300001979 JGI24740J21852_10009521 JGI24740J21852_100095212 243
714 3300001989 JGI24739J22299_10001733 JGI24739J22299_100017336 243
715 3300001990 JGI24737J22298_10002227 JGI24737J22298_100022277 243
716 3300002075 JGI24738J21930_10000749 JGI24738J21930_100007495 243
717 3300002076 JGI24749J21850_1000037 JGI24749J21850_100003720 243
718 3300005289 Ga0065704_10077887 Ga0065704_100778873 243
719 3300005289 Ga0065704_10101542 Ga0065704_101015423 243
720 3300005331 Ga0070670_100000792 Ga0070670_10000079220 243
721 3300005339 Ga0070660_100268274 Ga0070660_1002682742 243
722 3300005344 Ga0070661_100000697 Ga0070661_10000069725 243
723 3300005367 Ga0070667_100000290 Ga0070667_10000029017 243
724 3300005367 Ga0070667_100000480 Ga0070667_10000048022 243
725 3300005455 Ga0070663_100040898 Ga0070663_1000408983 243
726 3300005457 Ga0070662_100344142 Ga0070662_1003441422 243
727 3300005539 Ga0068853_100175392 Ga0068853_1001753922 243
728 3300005539 Ga0068853_100680149 Ga0068853_1006801491 243
729 3300005544 Ga0070686_100001769 Ga0070686_1000017698 243
730 3300005563 Ga0068855_100290513 Ga0068855_1002905132 243
731 3300005577 Ga0068857_100736301 Ga0068857_1007363012 243
732 3300005614 Ga0068856_100008926 Ga0068856_1000089268 243
733 3300005616 Ga0068852_100182067 Ga0068852_1001820673 243
734 3300005617 Ga0068859_100030808 Ga0068859_1000308084 243
735 3300005618 Ga0068864_100000063 Ga0068864_10000006357 243
736 3300005618 Ga0068864_100491146 Ga0068864_1004911462 243
737 3300005834 Ga0068851_10056413 Ga0068851_100564134 243
738 3300005841 Ga0068863_100000062 Ga0068863_10000006257 243
739 3300005841 Ga0068863_100017272 Ga0068863_1000172723 243
740 3300005844 Ga0068862_100000069 Ga0068862_10000006960 243
741 3300006195 Ga0075366_10141343 Ga0075366_101413431 243
742 3300006931 Ga0097620_100030807 Ga0097620_1000308074 243
743 3300009011 Ga0105251_10001006 Ga0105251_1000100611 243
744 3300009101 Ga0105247_10054565 Ga0105247_100545652 243
745 3300009147 Ga0114129_10179394 Ga0114129_101793944 243
746 3300009174 Ga0105241_10000478 Ga0105241_100004783 243
747 3300009177 Ga0105248_10000536 Ga0105248_1000053634 243
748 3300009545 Ga0105237_10075553 Ga0105237_100755535 243
749 3300009545 Ga0105237_10271370 Ga0105237_102713703 243
750 3300009553 Ga0105249_10000160 Ga0105249_1000016053 243
751 3300009553 Ga0105249_10243157 Ga0105249_102431573 243
752 3300009978 Ga0105148_100750 Ga0105148_1007505 243
753 3300013100 Ga0157373_10035437 Ga0157373_100354373 243
754 3300013105 Ga0157369_10006519 Ga0157369_1000651912 243
755 3300013306 Ga0163162_10019223 Ga0163162_100192233 243
756 3300014325 Ga0163163_10043887 Ga0163163_100438876 243
757 3300014326 Ga0157380_10000217 Ga0157380_1000021710 243
758 3300014968 Ga0157379_10060843 Ga0157379_100608433 243
759 3300017792 Ga0163161_10008607 Ga0163161_100086075 243
760 3300020070 Ga0206356_10071980 Ga0206356_100719803 243
761 3300025229 Ga0209147_100735 Ga0209147_1007358 243
762 3300025304 Ga0209257_1008283 Ga0209257_10082838 243
763 3300025321 Ga0207656_10049493 Ga0207656_100494933 243
764 3300025735 Ga0207713_1017945 Ga0207713_10179453 243
765 3300025904 Ga0207647_10023940 Ga0207647_100239402 243
766 3300025909 Ga0207705_10054556 Ga0207705_100545563 243
767 3300025911 Ga0207654_10249204 Ga0207654_102492042 243
768 3300025914 Ga0207671_10021469 Ga0207671_100214694 243
769 3300025918 Ga0207662_10053984 Ga0207662_100539844 243
770 3300025919 Ga0207657_10031188 Ga0207657_100311886 243
771 3300025924 Ga0207694_10034937 Ga0207694_100349374 243
772 3300025925 Ga0207650_10000986 Ga0207650_1000098612 243
773 3300025931 Ga0207644_10150615 Ga0207644_101506153 243
774 3300025933 Ga0207706_10163068 Ga0207706_101630682 243
775 3300025941 Ga0207711_10000017 Ga0207711_10000017423 243
776 3300025945 Ga0207679_10223257 Ga0207679_102232573 243
777 3300025961 Ga0207712_10000222 Ga0207712_1000022236 243
778 3300025981 Ga0207640_10032087 Ga0207640_100320873 243
779 3300025986 Ga0207658_10000133 Ga0207658_1000013335 243
780 3300025986 Ga0207658_10003592 Ga0207658_1000359213 243
781 3300026041 Ga0207639_10009135 Ga0207639_100091353 243
782 3300026041 Ga0207639_10424020 Ga0207639_104240202 243
783 3300026067 Ga0207678_10000271 Ga0207678_1000027136 243
784 3300026078 Ga0207702_10002479 Ga0207702_100024796 243
785 3300026088 Ga0207641_10000022 Ga0207641_10000022170 243
786 3300026095 Ga0207676_10000056 Ga0207676_1000005685 243
787 3300026142 Ga0207698_10006086 Ga0207698_100060863 243
788 3300028380 Ga0268265_10000044 Ga0268265_10000044153 243
789 3300031548 Ga0307408_100026409 Ga0307408_1000264093 243
790 3300031731 Ga0307405_10045074 Ga0307405_100450744 243
791 3300031911 Ga0307412_10388292 Ga0307412_103882922 243
792 3300032002 Ga0307416_100112109 Ga0307416_1001121095 243
793 3300032004 Ga0307414_10409363 Ga0307414_104093632 243
794 3300032126 Ga0307415_100347879 Ga0307415_1003478792 243
795 3300039437 Ga0436365_1355696 Ga0436365_1355696_1156_1911 243
796 3300039450 Ga0436363_1066328 Ga0436363_1066328_194_940 243
797 3300046453 Ga0495627_000167 Ga0495627_000167_48945_49682 243
798 3300046460 Ga0495638_0000011 Ga0495638_0000011_70536_71273 243
799 3300046506 Ga0495583_0000251 Ga0495583_0000251_70007_70744 243
800 3300046519 Ga0495632_0000938 Ga0495632_0000938_4045_4782 243
801 3300046524 Ga0495648_0000036 Ga0495648_0000036_70390_71127 243
802 3300046692 Ga0495671_0000054 Ga0495671_0000054_70026_70763 243
803 3300047469 Ga0495673_0000158 Ga0495673_0000158_70263_71000 243
804 3300047469 Ga0495673_0027162 Ga0495673_0027162_1059_1796 243
805 3300048907 Ga0496104_0114913 Ga0496104_0114913_783_1523 243
806 3300048908 Ga0496105_0011723 Ga0496105_0011723_2942_3682 243
807 3300048911 Ga0496108_0713479 Ga0496108_0713479_62_814 243
808 3300048912 Ga0496109_0325677 Ga0496109_0325677_524_1276 243
809 3300048914 Ga0496111_0252747 Ga0496111_0252747_257_1009 243
810 3300048920 Ga0496117_0009524 Ga0496117_0009524_2717_3454 243
811 3300048921 Ga0496118_0020768 Ga0496118_0020768_3837_4574 243
812 3300048923 Ga0496120_0104411 Ga0496120_0104411_731_1471 243
813 3300048925 Ga0496122_0009142 Ga0496122_0009142_316_1068 243
814 3300048927 Ga0496124_0030412 Ga0496124_0030412_2947_3693 243
815 3300048927 Ga0496124_0147353 Ga0496124_0147353_204_956 243
816 3300049663 Ga0501223_000230 Ga0501223_000230_2525_3256 243
817 3300049669 Ga0501235_003856 Ga0501235_003856_2192_2929 243
818 3300049705 Ga0501225_0000080 Ga0501225_0000080_11233_11964 243
819 3300049705 Ga0501225_0039065 Ga0501225_0039065_128_859 243
820 3300049822 Ga0501035_0190442 Ga0501035_0190442_622_1359 243
821 3300050512 nmdc:mga0n895_426707_c1 nmdc:mga0n895_426707_c1_455_1198 243
822 3300053177 Ga0500636_0004813 Ga0500636_0004813_4826_5572 243
823 iso_pu_bacteria 2775507255 2778123420 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

102

254

0.95

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

24

88

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3knu-assembly1.cif.gz_B crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.9328 3 213
3knu-assembly1.cif.gz_A crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.931 3 213
4ig6-assembly1.cif.gz_A crystal structure of a trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum bound to s-adenosylhomocysteine 0.9296 3 224
3knu-assembly2.cif.gz_D crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.9256 3 213
3knu-assembly2.cif.gz_C crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.9255 3 212
ID Description Score Start End Superfamily
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9659 3 159 3.40.1280.10
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9355 3 159 3.40.1280.10
4yq2A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9294 175 226 1.10.1270.20
3quvB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9294 175 224 1.10.1270.20
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9289 1 163 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A3D4QIM4-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9693 3 133 GO:0002939
GO:0005829
GO:0052906
AF-A0A528D6F4-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9617 1 167 GO:0002939
GO:0005829
GO:0052906
AF-A0A2E3L645-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9609 2 188 GO:0002939
GO:0005829
GO:0052906
AF-A0A439KNT5-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9573 1 148 GO:0002939
GO:0005829
GO:0052906
AF-A0A528D6F4-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9561 1 167 GO:0002939
GO:0005829
GO:0052906

Feature Viewer

pLDDT pTM Quality
89.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map