F482329
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 823 | 528 | 659 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100290513|Ga0068855_1002905132 |
| Length | 280 |
| Sequence | MTFAATVLTLYPEMFPGPLGLSLAGRAREEGTWDLETVQIRDFAADKHRTVDDTPAGGGAGMVLRVDVLAKAIDYAREAIDIRIRSSRAKSRDAGAADGVSTSLDTNGEGGAGSVPVIAMTPRGKPLTQARVRELAAGPGVIVLCGRFEGFDERIFAARGVEEVSVGDIVLSGGEPAALMLLDACIRLLPGVMGAASSGAEESFENGLLEYPHYTRPAEWEGRTIPEVLRSGDHAKIAAWRKLQSEVDTRLRRPDLWERHDGARVQSASGARRETKDLDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 4 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 5 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 6 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 7 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 8 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 9 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 10 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 11 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 12 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 13 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 14 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 15 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 16 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 17 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 18 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 19 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 20 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 21 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 22 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 23 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 24 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 25 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 26 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 27 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 28 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 29 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 30 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 31 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 32 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 33 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 34 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 35 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 36 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 37 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 38 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 39 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 40 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 41 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 42 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 43 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 44 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 45 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 46 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 47 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 48 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 49 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 50 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 51 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 52 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 53 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 54 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 55 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 56 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 57 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 58 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 59 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 60 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 61 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 62 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 63 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 64 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 65 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 66 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 67 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 68 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 69 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 70 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 71 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 72 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 73 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 74 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 75 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 76 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 77 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 78 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 79 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 80 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 81 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 82 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 83 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 84 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 85 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 86 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 87 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 88 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 89 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 90 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 91 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 92 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 93 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 94 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 95 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 96 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 97 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 98 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 99 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 100 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 101 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 102 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 103 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 104 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 105 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 106 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 107 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 108 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 109 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 110 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 111 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 112 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 113 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 114 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 115 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 116 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 117 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 118 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 119 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 120 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 121 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 122 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 123 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 124 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 125 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 126 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 127 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 128 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 129 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 130 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 131 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 132 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 133 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 134 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 135 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 136 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 137 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 138 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 139 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 140 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 141 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 142 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 143 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 144 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 145 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 146 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 147 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 148 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 149 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 150 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 151 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 152 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 153 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 154 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 155 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 156 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 157 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 158 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 159 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 160 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 161 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 162 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 163 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 164 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 165 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 166 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 167 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 168 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 169 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 170 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 171 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 172 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 173 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 177 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 180 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 182 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 184 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 186 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 190 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 197 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 211 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 212 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 213 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 214 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 215 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 217 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 219 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 225 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 226 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 227 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 228 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 230 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 231 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 232 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 233 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 234 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 235 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 236 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 237 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 238 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 239 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 240 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 241 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 242 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 243 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 244 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 245 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 246 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 247 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 250 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 251 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 253 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 254 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 255 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 256 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 257 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 258 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 259 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 260 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 262 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 277 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 295 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 296 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 297 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 299 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 300 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 373 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 374 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 375 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 376 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 377 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 378 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 379 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 380 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 381 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 382 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 383 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 384 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 385 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 386 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 387 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 388 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 389 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 390 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 391 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 392 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 393 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 394 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 395 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 396 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 397 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 398 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 399 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 400 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 401 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 402 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 403 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 404 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 405 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 406 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 431 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 432 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 433 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 434 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 435 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 436 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 439 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 440 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 441 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 442 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 443 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 444 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 445 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 446 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 447 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 452 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 479 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 480 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 481 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 490 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 491 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 492 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 493 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 494 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 502 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 508 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 509 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 510 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 511 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 512 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 516 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 519 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 520 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 521 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 522 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 523 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 524 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 525 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 526 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 527 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 528 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.95 |
| Metatranscriptomes | 0.12 |
| Isolates | 19.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 16.16 |
| Rhizoplane | 5.1 |
| Rhizosphere | 66.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001434 | 3300001904 | Bacteria | 4370 |
| 2 | JGI24741J21665_1000020 | 3300001915 | Bacteria | 37657 |
| 3 | JGI24752J21851_1002297 | 3300001976 | Bacteria | 2549 |
| 4 | JGI24746J21847_1011509 | 3300001977 | Bacteria | 1300 |
| 5 | JGI24740J21852_10009521 | 3300001979 | Bacteria | 3798 |
| 6 | JGI24739J22299_10001733 | 3300001989 | Bacteria | 8298 |
| 7 | JGI24737J22298_10002227 | 3300001990 | Bacteria | 6914 |
| 8 | JGI24737J22298_10006157 | 3300001990 | Bacteria | 4110 |
| 9 | JGI24737J22298_10006332 | 3300001990 | Bacteria | 4047 |
| 10 | JGI24738J21930_10000749 | 3300002075 | Bacteria | 9345 |
| 11 | JGI24738J21930_10014815 | 3300002075 | Bacteria | 1668 |
| 12 | JGI24749J21850_1000037 | 3300002076 | Bacteria | 24773 |
| 13 | JGI24034J26672_10006184 | 3300002239 | Bacteria | 1725 |
| 14 | JGI25157J39369_1001721 | 3300002741 | Bacteria | 7336 |
| 15 | JGI25406J46586_10000167 | 3300003203 | Bacteria | 29176 |
| 16 | JGI25165J46597_1000052 | 3300003214 | Bacteria | 236064 |
| 17 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 18 | Ga0055536_1006426 | 3300003781 | Bacteria | 5493 |
| 19 | Ga0055530_10000522 | 3300003791 | Bacteria | 33291 |
| 20 | Ga0055531_10005448 | 3300003794 | Bacteria | 7448 |
| 21 | Ga0065704_10077887 | 3300005289 | Bacteria | 4591 |
| 22 | Ga0065704_10101542 | 3300005289 | Bacteria | 2234 |
| 23 | Ga0070658_10028412 | 3300005327 | Bacteria | 4489 |
| 24 | Ga0070676_10045792 | 3300005328 | Bacteria | 2548 |
| 25 | Ga0070683_100012785 | 3300005329 | Bacteria | 7302 |
| 26 | Ga0070690_100060095 | 3300005330 | Bacteria | 2445 |
| 27 | Ga0070670_100000792 | 3300005331 | Bacteria | 24611 |
| 28 | Ga0070670_100024711 | 3300005331 | Bacteria | 5167 |
| 29 | Ga0070677_10000238 | 3300005333 | Bacteria | 19104 |
| 30 | Ga0070677_10010859 | 3300005333 | Bacteria | 3127 |
| 31 | Ga0068869_100077158 | 3300005334 | Bacteria | 2478 |
| 32 | Ga0070666_10001688 | 3300005335 | Bacteria | 13469 |
| 33 | Ga0070680_100012436 | 3300005336 | Bacteria | 6614 |
| 34 | Ga0070682_100005303 | 3300005337 | Bacteria | 7171 |
| 35 | Ga0070682_100126816 | 3300005337 | Bacteria | 1721 |
| 36 | Ga0068868_100019864 | 3300005338 | Bacteria | 5039 |
| 37 | Ga0068868_100106201 | 3300005338 | Bacteria | 2277 |
| 38 | Ga0070660_100002943 | 3300005339 | Bacteria | 11718 |
| 39 | Ga0070660_100268274 | 3300005339 | Bacteria | 1394 |
| 40 | Ga0070689_100003122 | 3300005340 | Bacteria | 10942 |
| 41 | Ga0070691_10000070 | 3300005341 | Bacteria | 28614 |
| 42 | Ga0070691_10135955 | 3300005341 | Bacteria | 1249 |
| 43 | Ga0070687_100001000 | 3300005343 | Bacteria | 9633 |
| 44 | Ga0070687_100448485 | 3300005343 | Bacteria | 858 |
| 45 | Ga0070661_100000668 | 3300005344 | Bacteria | 25151 |
| 46 | Ga0070661_100000697 | 3300005344 | Bacteria | 24630 |
| 47 | Ga0070692_10000024 | 3300005345 | Bacteria | 29214 |
| 48 | Ga0070668_100000068 | 3300005347 | Bacteria | 64209 |
| 49 | Ga0070668_100001091 | 3300005347 | Bacteria | 19133 |
| 50 | Ga0070669_100003333 | 3300005353 | Bacteria | 11547 |
| 51 | Ga0070675_100001968 | 3300005354 | Bacteria | 15203 |
| 52 | Ga0070675_100100760 | 3300005354 | Bacteria | 2433 |
| 53 | Ga0070671_100001553 | 3300005355 | Bacteria | 17294 |
| 54 | Ga0070671_100026086 | 3300005355 | Bacteria | 4800 |
| 55 | Ga0070671_100043860 | 3300005355 | Bacteria | 3717 |
| 56 | Ga0070671_100077222 | 3300005355 | Bacteria | 2783 |
| 57 | Ga0070674_100004629 | 3300005356 | Bacteria | 7861 |
| 58 | Ga0070674_100009057 | 3300005356 | Bacteria | 5950 |
| 59 | Ga0070674_100257880 | 3300005356 | Bacteria | 1372 |
| 60 | Ga0070673_100005461 | 3300005364 | Bacteria | 8140 |
| 61 | Ga0070673_100201978 | 3300005364 | Bacteria | 1712 |
| 62 | Ga0070673_100968301 | 3300005364 | Bacteria | 791 |
| 63 | Ga0070688_100002260 | 3300005365 | Bacteria | 9728 |
| 64 | Ga0070688_100197022 | 3300005365 | Bacteria | 1407 |
| 65 | Ga0070659_100002640 | 3300005366 | Bacteria | 12754 |
| 66 | Ga0070659_100427745 | 3300005366 | Bacteria | 1120 |
| 67 | Ga0070667_100000290 | 3300005367 | Bacteria | 56841 |
| 68 | Ga0070667_100000480 | 3300005367 | Bacteria | 40910 |
| 69 | Ga0070667_100001713 | 3300005367 | Bacteria | 19600 |
| 70 | Ga0070703_10054652 | 3300005406 | Bacteria | 1288 |
| 71 | Ga0070709_10003174 | 3300005434 | Bacteria | 8812 |
| 72 | Ga0070709_10012916 | 3300005434 | Bacteria | 4681 |
| 73 | Ga0070714_100023409 | 3300005435 | Bacteria | 5073 |
| 74 | Ga0070714_100284098 | 3300005435 | Bacteria | 1538 |
| 75 | Ga0070713_100019976 | 3300005436 | Bacteria | 5128 |
| 76 | Ga0070711_100000117 | 3300005439 | Bacteria | 41545 |
| 77 | Ga0070705_100000313 | 3300005440 | Bacteria | 28689 |
| 78 | Ga0070700_100207674 | 3300005441 | Bacteria | 1380 |
| 79 | Ga0070694_100000845 | 3300005444 | Bacteria | 17237 |
| 80 | Ga0070663_100001391 | 3300005455 | Bacteria | 13222 |
| 81 | Ga0070663_100040898 | 3300005455 | Bacteria | 3248 |
| 82 | Ga0070678_100000130 | 3300005456 | Bacteria | 30149 |
| 83 | Ga0070678_100007175 | 3300005456 | Bacteria | 6592 |
| 84 | Ga0070678_100029766 | 3300005456 | Bacteria | 3744 |
| 85 | Ga0070662_100004052 | 3300005457 | Bacteria | 9202 |
| 86 | Ga0070662_100344142 | 3300005457 | Bacteria | 1220 |
| 87 | Ga0070681_10035084 | 3300005458 | Bacteria | 5039 |
| 88 | Ga0070681_10638268 | 3300005458 | Bacteria | 980 |
| 89 | Ga0068867_100143690 | 3300005459 | Bacteria | 1867 |
| 90 | Ga0070685_10048639 | 3300005466 | Bacteria | 2443 |
| 91 | Ga0070679_100206265 | 3300005530 | Bacteria | 1930 |
| 92 | Ga0070684_100021766 | 3300005535 | Bacteria | 5340 |
| 93 | Ga0070697_100001143 | 3300005536 | Bacteria | 20096 |
| 94 | Ga0070697_100542921 | 3300005536 | Bacteria | 1019 |
| 95 | Ga0068853_100004638 | 3300005539 | Bacteria | 10655 |
| 96 | Ga0068853_100175392 | 3300005539 | Bacteria | 1941 |
| 97 | Ga0068853_100680149 | 3300005539 | Bacteria | 981 |
| 98 | Ga0070672_100002673 | 3300005543 | Bacteria | 11400 |
| 99 | Ga0070686_100001769 | 3300005544 | Bacteria | 12073 |
| 100 | Ga0070686_100025610 | 3300005544 | Bacteria | 3552 |
| 101 | Ga0070686_100592980 | 3300005544 | Bacteria | 872 |
| 102 | Ga0070695_100001227 | 3300005545 | Bacteria | 14082 |
| 103 | Ga0070695_100396804 | 3300005545 | Bacteria | 1045 |
| 104 | Ga0070696_100005647 | 3300005546 | Bacteria | 8358 |
| 105 | Ga0070693_100000264 | 3300005547 | Bacteria | 24687 |
| 106 | Ga0070665_100000535 | 3300005548 | Bacteria | 53560 |
| 107 | Ga0070665_100002389 | 3300005548 | Bacteria | 20706 |
| 108 | Ga0070665_100012076 | 3300005548 | Bacteria | 8713 |
| 109 | Ga0070665_100028878 | 3300005548 | Bacteria | 5583 |
| 110 | Ga0070665_100228730 | 3300005548 | Bacteria | 1860 |
| 111 | Ga0070665_100335667 | 3300005548 | Bacteria | 1516 |
| 112 | Ga0070665_100449775 | 3300005548 | Bacteria | 1298 |
| 113 | Ga0070704_100066633 | 3300005549 | Bacteria | 2597 |
| 114 | Ga0068855_100005350 | 3300005563 | Bacteria | 15657 |
| 115 | Ga0068855_100024228 | 3300005563 | Bacteria | 7265 |
| 116 | Ga0068855_100290513 | 3300005563 | Bacteria | 1812 |
| 117 | Ga0068857_100002705 | 3300005577 | Bacteria | 14546 |
| 118 | Ga0068857_100736301 | 3300005577 | Bacteria | 938 |
| 119 | Ga0068854_100019054 | 3300005578 | Bacteria | 4618 |
| 120 | Ga0068856_100008926 | 3300005614 | Bacteria | 9751 |
| 121 | Ga0070702_100001185 | 3300005615 | Bacteria | 10512 |
| 122 | Ga0068852_100182067 | 3300005616 | Bacteria | 1977 |
| 123 | Ga0068859_100005823 | 3300005617 | Bacteria | 12519 |
| 124 | Ga0068859_100012193 | 3300005617 | Bacteria | 8640 |
| 125 | Ga0068859_100030808 | 3300005617 | Bacteria | 5383 |
| 126 | Ga0068859_100225103 | 3300005617 | Bacteria | 1964 |
| 127 | Ga0068859_100329930 | 3300005617 | Bacteria | 1620 |
| 128 | Ga0068864_100000063 | 3300005618 | Bacteria | 119845 |
| 129 | Ga0068864_100066286 | 3300005618 | Bacteria | 3134 |
| 130 | Ga0068864_100491146 | 3300005618 | Bacteria | 1180 |
| 131 | Ga0068866_10008721 | 3300005718 | Bacteria | 4286 |
| 132 | Ga0068861_100023306 | 3300005719 | Bacteria | 4464 |
| 133 | Ga0068851_10048337 | 3300005834 | Bacteria | 2156 |
| 134 | Ga0068851_10056413 | 3300005834 | Bacteria | 2003 |
| 135 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 136 | Ga0068863_100000062 | 3300005841 | Bacteria | 119845 |
| 137 | Ga0068863_100003765 | 3300005841 | Bacteria | 15006 |
| 138 | Ga0068863_100017272 | 3300005841 | Bacteria | 6922 |
| 139 | Ga0068858_100026100 | 3300005842 | Bacteria | 5432 |
| 140 | Ga0068860_100066297 | 3300005843 | Bacteria | 3429 |
| 141 | Ga0068860_100247972 | 3300005843 | Bacteria | 1733 |
| 142 | Ga0068862_100000069 | 3300005844 | Bacteria | 122535 |
| 143 | Ga0068862_100027598 | 3300005844 | Bacteria | 4779 |
| 144 | Ga0068862_100115373 | 3300005844 | Bacteria | 2362 |
| 145 | Ga0068862_100728167 | 3300005844 | Bacteria | 963 |
| 146 | Ga0081455_10055012 | 3300005937 | Bacteria | 3388 |
| 147 | Ga0081540_1098829 | 3300005983 | Bacteria | 1262 |
| 148 | Ga0081539_10001073 | 3300005985 | Bacteria | 49846 |
| 149 | Ga0075365_10082476 | 3300006038 | Bacteria | 2180 |
| 150 | Ga0075365_10124826 | 3300006038 | Bacteria | 1778 |
| 151 | Ga0075365_10166232 | 3300006038 | Bacteria | 1539 |
| 152 | Ga0075365_10255096 | 3300006038 | Bacteria | 1233 |
| 153 | Ga0075365_10394511 | 3300006038 | Bacteria | 976 |
| 154 | Ga0075368_10042328 | 3300006042 | Bacteria | 1792 |
| 155 | Ga0075363_100043911 | 3300006048 | Bacteria | 2366 |
| 156 | Ga0075364_10116579 | 3300006051 | Bacteria | 1786 |
| 157 | Ga0070715_10029967 | 3300006163 | Bacteria | 2195 |
| 158 | Ga0070716_100000136 | 3300006173 | Bacteria | 29543 |
| 159 | Ga0070712_100003026 | 3300006175 | Bacteria | 10403 |
| 160 | Ga0070712_100103266 | 3300006175 | Bacteria | 2113 |
| 161 | Ga0070712_100305893 | 3300006175 | Bacteria | 1288 |
| 162 | Ga0075367_10038757 | 3300006178 | Bacteria | 2775 |
| 163 | Ga0075366_10001911 | 3300006195 | Bacteria | 10534 |
| 164 | Ga0075366_10012251 | 3300006195 | Bacteria | 4861 |
| 165 | Ga0075366_10141343 | 3300006195 | Bacteria | 1455 |
| 166 | Ga0075366_10260752 | 3300006195 | Bacteria | 1058 |
| 167 | Ga0097621_100054116 | 3300006237 | Bacteria | 3272 |
| 168 | Ga0068871_100049904 | 3300006358 | Bacteria | 3384 |
| 169 | Ga0075428_100242240 | 3300006844 | Bacteria | 1945 |
| 170 | Ga0075431_100031456 | 3300006847 | Bacteria | 5466 |
| 171 | Ga0075431_100448577 | 3300006847 | Bacteria | 1286 |
| 172 | Ga0075433_10059720 | 3300006852 | Bacteria | 3336 |
| 173 | Ga0075434_100072316 | 3300006871 | Bacteria | 3441 |
| 174 | Ga0075429_100025308 | 3300006880 | Bacteria | 5151 |
| 175 | Ga0068865_100014630 | 3300006881 | Bacteria | 4990 |
| 176 | Ga0068865_100108244 | 3300006881 | Bacteria | 2045 |
| 177 | Ga0075436_100011629 | 3300006914 | Bacteria | 6040 |
| 178 | Ga0097620_100005823 | 3300006931 | Bacteria | 12519 |
| 179 | Ga0097620_100012193 | 3300006931 | Bacteria | 8640 |
| 180 | Ga0097620_100030807 | 3300006931 | Bacteria | 5383 |
| 181 | Ga0097620_100329945 | 3300006931 | Bacteria | 1620 |
| 182 | Ga0075435_100109185 | 3300007076 | Bacteria | 2299 |
| 183 | Ga0105251_10001006 | 3300009011 | Bacteria | 24692 |
| 184 | Ga0105250_10018971 | 3300009092 | Bacteria | 2782 |
| 185 | Ga0105240_10020029 | 3300009093 | Bacteria | 8931 |
| 186 | Ga0105240_10228412 | 3300009093 | Bacteria | 2164 |
| 187 | Ga0111539_10819853 | 3300009094 | Bacteria | 1083 |
| 188 | Ga0105245_10008501 | 3300009098 | Bacteria | 8954 |
| 189 | Ga0105245_10012824 | 3300009098 | Bacteria | 7303 |
| 190 | Ga0105247_10000799 | 3300009101 | Bacteria | 24136 |
| 191 | Ga0105247_10054565 | 3300009101 | Bacteria | 2465 |
| 192 | Ga0114129_10179394 | 3300009147 | Bacteria | 2883 |
| 193 | Ga0114129_10205703 | 3300009147 | Bacteria | 2663 |
| 194 | Ga0114129_10349864 | 3300009147 | Bacteria | 1958 |
| 195 | Ga0114129_10723021 | 3300009147 | Bacteria | 1277 |
| 196 | Ga0105243_10000038 | 3300009148 | Bacteria | 174351 |
| 197 | Ga0105243_10015360 | 3300009148 | Bacteria | 5792 |
| 198 | Ga0105243_10291739 | 3300009148 | Bacteria | 1474 |
| 199 | Ga0105241_10000478 | 3300009174 | Bacteria | 30203 |
| 200 | Ga0105241_10000626 | 3300009174 | Bacteria | 26576 |
| 201 | Ga0105242_10001227 | 3300009176 | Bacteria | 20231 |
| 202 | Ga0105248_10000536 | 3300009177 | Bacteria | 43208 |
| 203 | Ga0105248_10007144 | 3300009177 | Bacteria | 12244 |
| 204 | Ga0105237_10000914 | 3300009545 | Bacteria | 39684 |
| 205 | Ga0105237_10075553 | 3300009545 | Bacteria | 3361 |
| 206 | Ga0105237_10271370 | 3300009545 | Bacteria | 1699 |
| 207 | Ga0105238_10089930 | 3300009551 | Bacteria | 3057 |
| 208 | Ga0105238_10479438 | 3300009551 | Bacteria | 1243 |
| 209 | Ga0105249_10000160 | 3300009553 | Bacteria | 81883 |
| 210 | Ga0105249_10010997 | 3300009553 | Bacteria | 7950 |
| 211 | Ga0105249_10243157 | 3300009553 | Bacteria | 1780 |
| 212 | Ga0105249_10306378 | 3300009553 | Bacteria | 1595 |
| 213 | Ga0105148_100750 | 3300009978 | Bacteria | 2467 |
| 214 | Ga0105239_10010452 | 3300010375 | Bacteria | 10379 |
| 215 | Ga0105239_10407953 | 3300010375 | Bacteria | 1538 |
| 216 | Ga0105246_10000610 | 3300011119 | Bacteria | 19889 |
| 217 | Ga0105246_10001156 | 3300011119 | Bacteria | 15320 |
| 218 | Ga0105246_10067023 | 3300011119 | Bacteria | 2515 |
| 219 | Ga0105246_10390621 | 3300011119 | Bacteria | 1152 |
| 220 | Ga0157373_10035437 | 3300013100 | Bacteria | 3583 |
| 221 | Ga0157373_10040703 | 3300013100 | Bacteria | 3325 |
| 222 | Ga0157371_10042262 | 3300013102 | Bacteria | 3249 |
| 223 | Ga0157371_10200889 | 3300013102 | Bacteria | 1429 |
| 224 | Ga0157370_10607000 | 3300013104 | Bacteria | 1002 |
| 225 | Ga0157369_10003587 | 3300013105 | Bacteria | 18436 |
| 226 | Ga0157369_10006519 | 3300013105 | Bacteria | 13523 |
| 227 | Ga0157374_10001990 | 3300013296 | Bacteria | 17150 |
| 228 | Ga0157378_10001108 | 3300013297 | Bacteria | 24518 |
| 229 | Ga0163162_10003707 | 3300013306 | Bacteria | 14641 |
| 230 | Ga0163162_10019223 | 3300013306 | Bacteria | 6699 |
| 231 | Ga0163162_10139568 | 3300013306 | Bacteria | 2536 |
| 232 | Ga0157372_10017151 | 3300013307 | Bacteria | 7773 |
| 233 | Ga0157375_10159662 | 3300013308 | Bacteria | 2396 |
| 234 | Ga0163163_10043887 | 3300014325 | Bacteria | 4385 |
| 235 | Ga0157380_10000217 | 3300014326 | Bacteria | 34251 |
| 236 | Ga0157380_10014827 | 3300014326 | Bacteria | 5709 |
| 237 | Ga0157380_10183414 | 3300014326 | Bacteria | 1841 |
| 238 | Ga0157380_10230765 | 3300014326 | Bacteria | 1662 |
| 239 | Ga0157380_10281309 | 3300014326 | Bacteria | 1522 |
| 240 | Ga0157377_10005353 | 3300014745 | Bacteria | 6023 |
| 241 | Ga0157379_10005061 | 3300014968 | Bacteria | 11301 |
| 242 | Ga0157379_10060843 | 3300014968 | Bacteria | 3377 |
| 243 | Ga0157376_10007270 | 3300014969 | Bacteria | 7886 |
| 244 | Ga0163161_10003299 | 3300017792 | Bacteria | 11334 |
| 245 | Ga0163161_10008607 | 3300017792 | Bacteria | 7053 |
| 246 | Ga0163161_10011472 | 3300017792 | Bacteria | 6148 |
| 247 | Ga0206356_10071980 | 3300020070 | Bacteria | 2536 |
| 248 | Ga0213876_10051205 | 3300021384 | Bacteria | 2182 |
| 249 | Ga0213875_10000033 | 3300021388 | Bacteria | 170944 |
| 250 | Ga0213875_10005479 | 3300021388 | Bacteria | 6802 |
| 251 | Ga0209147_100735 | 3300025229 | Bacteria | 16276 |
| 252 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 253 | Ga0209759_1000142 | 3300025256 | Bacteria | 124090 |
| 254 | Ga0209233_1000118 | 3300025261 | Bacteria | 236172 |
| 255 | Ga0209675_1000838 | 3300025291 | Bacteria | 20134 |
| 256 | Ga0209676_1001387 | 3300025292 | Bacteria | 23537 |
| 257 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 258 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 259 | Ga0209050_1004877 | 3300025298 | Bacteria | 8791 |
| 260 | Ga0209257_1001118 | 3300025304 | Bacteria | 34674 |
| 261 | Ga0209257_1008283 | 3300025304 | Bacteria | 5965 |
| 262 | Ga0207656_10049493 | 3300025321 | Bacteria | 1812 |
| 263 | Ga0207713_1017945 | 3300025735 | Bacteria | 3521 |
| 264 | Ga0207653_10015748 | 3300025885 | Bacteria | 2373 |
| 265 | Ga0207682_10018183 | 3300025893 | Bacteria | 2747 |
| 266 | Ga0207692_10004280 | 3300025898 | Bacteria | 5645 |
| 267 | Ga0207642_10008573 | 3300025899 | Bacteria | 3516 |
| 268 | Ga0207710_10002843 | 3300025900 | Bacteria | 7886 |
| 269 | Ga0207688_10002766 | 3300025901 | Bacteria | 9508 |
| 270 | Ga0207680_10004688 | 3300025903 | Bacteria | 6495 |
| 271 | Ga0207647_10017058 | 3300025904 | Bacteria | 4944 |
| 272 | Ga0207647_10023940 | 3300025904 | Bacteria | 4032 |
| 273 | Ga0207647_10081963 | 3300025904 | Bacteria | 1933 |
| 274 | Ga0207699_10000734 | 3300025906 | Bacteria | 15646 |
| 275 | Ga0207645_10010138 | 3300025907 | Bacteria | 6480 |
| 276 | Ga0207645_10059441 | 3300025907 | Bacteria | 2441 |
| 277 | Ga0207705_10003758 | 3300025909 | Bacteria | 11564 |
| 278 | Ga0207705_10054556 | 3300025909 | Bacteria | 2880 |
| 279 | Ga0207654_10024995 | 3300025911 | Bacteria | 3217 |
| 280 | Ga0207654_10249204 | 3300025911 | Bacteria | 1190 |
| 281 | Ga0207707_10510287 | 3300025912 | Bacteria | 1025 |
| 282 | Ga0207695_10033960 | 3300025913 | Bacteria | 5553 |
| 283 | Ga0207695_10470363 | 3300025913 | Bacteria | 1139 |
| 284 | Ga0207695_10680158 | 3300025913 | Bacteria | 910 |
| 285 | Ga0207671_10006068 | 3300025914 | Bacteria | 10888 |
| 286 | Ga0207671_10021469 | 3300025914 | Bacteria | 4899 |
| 287 | Ga0207671_10106264 | 3300025914 | Bacteria | 2131 |
| 288 | Ga0207693_10003855 | 3300025915 | Bacteria | 12774 |
| 289 | Ga0207693_10306164 | 3300025915 | Bacteria | 1244 |
| 290 | Ga0207663_10013874 | 3300025916 | Bacteria | 4394 |
| 291 | Ga0207662_10002913 | 3300025918 | Bacteria | 8678 |
| 292 | Ga0207662_10053984 | 3300025918 | Bacteria | 2395 |
| 293 | Ga0207657_10000347 | 3300025919 | Bacteria | 49144 |
| 294 | Ga0207657_10031188 | 3300025919 | Bacteria | 4831 |
| 295 | Ga0207649_10368930 | 3300025920 | Bacteria | 1067 |
| 296 | Ga0207652_10393602 | 3300025921 | Bacteria | 1250 |
| 297 | Ga0207646_10279574 | 3300025922 | Bacteria | 1508 |
| 298 | Ga0207681_10020111 | 3300025923 | Bacteria | 4226 |
| 299 | Ga0207694_10034937 | 3300025924 | Bacteria | 3854 |
| 300 | Ga0207694_10077292 | 3300025924 | Bacteria | 2608 |
| 301 | Ga0207650_10000986 | 3300025925 | Bacteria | 21395 |
| 302 | Ga0207650_10009110 | 3300025925 | Bacteria | 6784 |
| 303 | Ga0207659_10032390 | 3300025926 | Bacteria | 3587 |
| 304 | Ga0207687_10013570 | 3300025927 | Bacteria | 5319 |
| 305 | Ga0207687_10359341 | 3300025927 | Bacteria | 1188 |
| 306 | Ga0207664_10020281 | 3300025929 | Bacteria | 4924 |
| 307 | Ga0207664_10644584 | 3300025929 | Bacteria | 952 |
| 308 | Ga0207644_10000544 | 3300025931 | Bacteria | 24497 |
| 309 | Ga0207644_10011172 | 3300025931 | Bacteria | 5933 |
| 310 | Ga0207644_10028609 | 3300025931 | Bacteria | 3860 |
| 311 | Ga0207644_10056559 | 3300025931 | Bacteria | 2831 |
| 312 | Ga0207644_10150615 | 3300025931 | Bacteria | 1800 |
| 313 | Ga0207690_10020812 | 3300025932 | Bacteria | 4059 |
| 314 | Ga0207690_10031983 | 3300025932 | Bacteria | 3372 |
| 315 | Ga0207706_10000441 | 3300025933 | Bacteria | 44360 |
| 316 | Ga0207706_10002879 | 3300025933 | Bacteria | 16670 |
| 317 | Ga0207706_10163068 | 3300025933 | Bacteria | 1959 |
| 318 | Ga0207706_10219030 | 3300025933 | Bacteria | 1667 |
| 319 | Ga0207706_10509368 | 3300025933 | Bacteria | 1038 |
| 320 | Ga0207686_10386450 | 3300025934 | Bacteria | 1063 |
| 321 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 322 | Ga0207709_10030534 | 3300025935 | Bacteria | 3136 |
| 323 | Ga0207670_10008141 | 3300025936 | Bacteria | 5900 |
| 324 | Ga0207669_10000057 | 3300025937 | Bacteria | 56270 |
| 325 | Ga0207669_10009139 | 3300025937 | Bacteria | 4703 |
| 326 | Ga0207669_10068181 | 3300025937 | Bacteria | 2220 |
| 327 | Ga0207704_10375054 | 3300025938 | Bacteria | 1115 |
| 328 | Ga0207665_10000533 | 3300025939 | Bacteria | 25620 |
| 329 | Ga0207665_10157735 | 3300025939 | Bacteria | 1630 |
| 330 | Ga0207691_10001403 | 3300025940 | Bacteria | 24078 |
| 331 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 332 | Ga0207711_10013750 | 3300025941 | Bacteria | 6720 |
| 333 | Ga0207711_10146220 | 3300025941 | Bacteria | 2130 |
| 334 | Ga0207689_10095073 | 3300025942 | Bacteria | 2447 |
| 335 | Ga0207689_10235438 | 3300025942 | Bacteria | 1514 |
| 336 | Ga0207661_10031344 | 3300025944 | Bacteria | 4106 |
| 337 | Ga0207679_10021428 | 3300025945 | Bacteria | 4382 |
| 338 | Ga0207679_10223257 | 3300025945 | Bacteria | 1586 |
| 339 | Ga0207667_10045455 | 3300025949 | Bacteria | 4650 |
| 340 | Ga0207667_10063290 | 3300025949 | Bacteria | 3865 |
| 341 | Ga0207651_10014429 | 3300025960 | Bacteria | 4561 |
| 342 | Ga0207651_10606704 | 3300025960 | Bacteria | 957 |
| 343 | Ga0207712_10000222 | 3300025961 | Bacteria | 56073 |
| 344 | Ga0207712_10006640 | 3300025961 | Bacteria | 7304 |
| 345 | Ga0207668_10000056 | 3300025972 | Bacteria | 93913 |
| 346 | Ga0207668_10020070 | 3300025972 | Bacteria | 4238 |
| 347 | Ga0207668_10213178 | 3300025972 | Bacteria | 1546 |
| 348 | Ga0207640_10025974 | 3300025981 | Bacteria | 3552 |
| 349 | Ga0207640_10032087 | 3300025981 | Bacteria | 3254 |
| 350 | Ga0207640_10361993 | 3300025981 | Bacteria | 1169 |
| 351 | Ga0207658_10000133 | 3300025986 | Bacteria | 78402 |
| 352 | Ga0207658_10003592 | 3300025986 | Bacteria | 10960 |
| 353 | Ga0207658_10568958 | 3300025986 | Bacteria | 1015 |
| 354 | Ga0207677_10080172 | 3300026023 | Bacteria | 2338 |
| 355 | Ga0207677_10102986 | 3300026023 | Bacteria | 2106 |
| 356 | Ga0207703_10053726 | 3300026035 | Bacteria | 3274 |
| 357 | Ga0207639_10009135 | 3300026041 | Bacteria | 6832 |
| 358 | Ga0207639_10010547 | 3300026041 | Bacteria | 6399 |
| 359 | Ga0207639_10022775 | 3300026041 | Bacteria | 4515 |
| 360 | Ga0207639_10424020 | 3300026041 | Bacteria | 1203 |
| 361 | Ga0207678_10000271 | 3300026067 | Bacteria | 47011 |
| 362 | Ga0207678_10000371 | 3300026067 | Bacteria | 40938 |
| 363 | Ga0207678_10312033 | 3300026067 | Bacteria | 1352 |
| 364 | Ga0207708_10000444 | 3300026075 | Bacteria | 32197 |
| 365 | Ga0207702_10002479 | 3300026078 | Bacteria | 17436 |
| 366 | Ga0207702_10031560 | 3300026078 | Bacteria | 4415 |
| 367 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 368 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 369 | Ga0207641_10017511 | 3300026088 | Bacteria | 5866 |
| 370 | Ga0207641_10156085 | 3300026088 | Bacteria | 2070 |
| 371 | Ga0207648_10019567 | 3300026089 | Bacteria | 6110 |
| 372 | Ga0207648_10230588 | 3300026089 | Bacteria | 1647 |
| 373 | Ga0207676_10000056 | 3300026095 | Bacteria | 124484 |
| 374 | Ga0207676_10030709 | 3300026095 | Bacteria | 4036 |
| 375 | Ga0207676_10048276 | 3300026095 | Bacteria | 3304 |
| 376 | Ga0207676_10051185 | 3300026095 | Bacteria | 3223 |
| 377 | Ga0207674_10001576 | 3300026116 | Bacteria | 29373 |
| 378 | Ga0207675_100000203 | 3300026118 | Bacteria | 55051 |
| 379 | Ga0207683_10000221 | 3300026121 | Bacteria | 50019 |
| 380 | Ga0207683_10400755 | 3300026121 | Bacteria | 1262 |
| 381 | Ga0207698_10006086 | 3300026142 | Bacteria | 7507 |
| 382 | Ga0268266_10000457 | 3300028379 | Bacteria | 59586 |
| 383 | Ga0268266_10001370 | 3300028379 | Bacteria | 29379 |
| 384 | Ga0268266_10125646 | 3300028379 | Bacteria | 2288 |
| 385 | Ga0268266_10202436 | 3300028379 | Bacteria | 1817 |
| 386 | Ga0268265_10000044 | 3300028380 | Bacteria | 182545 |
| 387 | Ga0268265_10025408 | 3300028380 | Bacteria | 4203 |
| 388 | Ga0268265_10105545 | 3300028380 | Bacteria | 2286 |
| 389 | Ga0268264_10018445 | 3300028381 | Bacteria | 5707 |
| 390 | Ga0268264_10027808 | 3300028381 | Bacteria | 4623 |
| 391 | Ga0307517_10042818 | 3300028786 | Bacteria | 4842 |
| 392 | Ga0265340_10021513 | 3300031247 | Bacteria | 3308 |
| 393 | Ga0307513_10128762 | 3300031456 | Bacteria | 2481 |
| 394 | Ga0307408_100026409 | 3300031548 | Bacteria | 3989 |
| 395 | Ga0307405_10045074 | 3300031731 | Bacteria | 2700 |
| 396 | Ga0307413_10001504 | 3300031824 | Bacteria | 8914 |
| 397 | Ga0307407_10091734 | 3300031903 | Bacteria | 1864 |
| 398 | Ga0307412_10388292 | 3300031911 | Bacteria | 1132 |
| 399 | Ga0307416_100112109 | 3300032002 | Bacteria | 2406 |
| 400 | Ga0307416_100214883 | 3300032002 | Bacteria | 1838 |
| 401 | Ga0307416_100300820 | 3300032002 | Bacteria | 1594 |
| 402 | Ga0307414_10173781 | 3300032004 | Bacteria | 1725 |
| 403 | Ga0307414_10178573 | 3300032004 | Bacteria | 1705 |
| 404 | Ga0307414_10409363 | 3300032004 | Bacteria | 1180 |
| 405 | Ga0307411_10027478 | 3300032005 | Bacteria | 3444 |
| 406 | Ga0307411_10193337 | 3300032005 | Bacteria | 1555 |
| 407 | Ga0307415_100249546 | 3300032126 | Bacteria | 1441 |
| 408 | Ga0307415_100347879 | 3300032126 | Bacteria | 1246 |
| 409 | Ga0373950_0005613 | 3300034818 | Bacteria | 1881 |
| 410 | Ga0373923_0106647 | 3300035111 | Bacteria | 1240 |
| 411 | Ga0373932_0002892 | 3300035112 | Bacteria | 4239 |
| 412 | Ga0373954_0053889 | 3300035118 | Bacteria | 1891 |
| 413 | Ga0373956_0062578 | 3300035119 | Bacteria | 1687 |
| 414 | Ga0373960_0018279 | 3300035121 | Bacteria | 1826 |
| 415 | Ga0373931_0008322 | 3300035691 | Bacteria | 4912 |
| 416 | Ga0373937_0038800 | 3300036401 | Bacteria | 4340 |
| 417 | Ga0373937_0144566 | 3300036401 | Bacteria | 2226 |
| 418 | Ga0373925_0042979 | 3300037068 | Bacteria | 3353 |
| 419 | Ga0395899_0000430 | 3300037312 | Bacteria | 48341 |
| 420 | Ga0395900_0000086 | 3300037418 | Bacteria | 171749 |
| 421 | Ga0395900_0067581 | 3300037418 | Bacteria | 3672 |
| 422 | Ga0395900_0099409 | 3300037418 | Bacteria | 2988 |
| 423 | Ga0395900_0229777 | 3300037418 | Bacteria | 1866 |
| 424 | Ga0395898_0000901 | 3300037466 | Bacteria | 47807 |
| 425 | Ga0395905_0000614 | 3300037471 | Bacteria | 47761 |
| 426 | Ga0395905_0017970 | 3300037471 | Bacteria | 6714 |
| 427 | Ga0436364_0979303 | 3300037853 | Bacteria | 39415 |
| 428 | Ga0436364_1338082 | 3300037853 | Bacteria | 27858 |
| 429 | Ga0395901_0000449 | 3300038443 | Bacteria | 47853 |
| 430 | Ga0395901_0014587 | 3300038443 | Bacteria | 7988 |
| 431 | Ga0395901_0204127 | 3300038443 | Bacteria | 2071 |
| 432 | Ga0436365_0789836 | 3300039437 | Bacteria | 1112 |
| 433 | Ga0436365_0804346 | 3300039437 | Bacteria | 2089 |
| 434 | Ga0436365_1355696 | 3300039437 | Bacteria | 6053 |
| 435 | Ga0436363_1066328 | 3300039450 | Bacteria | 1284 |
| 436 | Ga0451789_1348687 | 3300041443 | Bacteria | 946 |
| 437 | Ga0451800_1091503 | 3300041459 | Bacteria | 911 |
| 438 | Ga0466972_0154466 | 3300044658 | Bacteria | 1078 |
| 439 | Ga0466965_0404704 | 3300044683 | Bacteria | 754 |
| 440 | Ga0453684_0072417 | 3300044712 | Bacteria | 4350 |
| 441 | Ga0495627_000167 | 3300046453 | Bacteria | 74800 |
| 442 | Ga0495603_0411026 | 3300046455 | Bacteria | 776 |
| 443 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 444 | Ga0495638_0006475 | 3300046460 | Bacteria | 8514 |
| 445 | Ga0495638_0075581 | 3300046460 | Bacteria | 2053 |
| 446 | Ga0495638_0180574 | 3300046460 | Bacteria | 1204 |
| 447 | Ga0495650_0000492 | 3300046471 | Bacteria | 59983 |
| 448 | Ga0495585_0014575 | 3300046492 | Bacteria | 4576 |
| 449 | Ga0495583_0000138 | 3300046506 | Bacteria | 123486 |
| 450 | Ga0495583_0000251 | 3300046506 | Bacteria | 88803 |
| 451 | Ga0495610_0065825 | 3300046512 | Bacteria | 1709 |
| 452 | Ga0495620_0120879 | 3300046515 | Bacteria | 1032 |
| 453 | Ga0495628_0131467 | 3300046516 | Bacteria | 1914 |
| 454 | Ga0495632_0000938 | 3300046519 | Bacteria | 25529 |
| 455 | Ga0495643_0001928 | 3300046522 | Bacteria | 17473 |
| 456 | Ga0495643_0075187 | 3300046522 | Bacteria | 1768 |
| 457 | Ga0495643_0196594 | 3300046522 | Bacteria | 970 |
| 458 | Ga0495648_0000036 | 3300046524 | Bacteria | 195997 |
| 459 | Ga0495648_0004646 | 3300046524 | Bacteria | 11648 |
| 460 | Ga0495587_0149570 | 3300046536 | Bacteria | 1331 |
| 461 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 462 | Ga0495634_0284350 | 3300046642 | Bacteria | 1004 |
| 463 | Ga0495625_0000553 | 3300046660 | Bacteria | 54796 |
| 464 | Ga0495625_0037557 | 3300046660 | Bacteria | 3553 |
| 465 | Ga0495635_0377828 | 3300046663 | Bacteria | 943 |
| 466 | Ga0495669_0008207 | 3300046684 | Bacteria | 4384 |
| 467 | Ga0495671_0000054 | 3300046692 | Bacteria | 115885 |
| 468 | Ga0495600_0000641 | 3300046809 | Bacteria | 18077 |
| 469 | Ga0495673_0000158 | 3300047469 | Bacteria | 116122 |
| 470 | Ga0495673_0027162 | 3300047469 | Bacteria | 2727 |
| 471 | Ga0495602_0165080 | 3300048088 | Bacteria | 1725 |
| 472 | Ga0496100_0111987 | 3300048903 | Bacteria | 1897 |
| 473 | Ga0496101_0021025 | 3300048904 | Bacteria | 4478 |
| 474 | Ga0496101_0033374 | 3300048904 | Bacteria | 3630 |
| 475 | Ga0496101_0035354 | 3300048904 | Bacteria | 3534 |
| 476 | Ga0496101_0084240 | 3300048904 | Bacteria | 2354 |
| 477 | Ga0496102_0072856 | 3300048905 | Bacteria | 3157 |
| 478 | Ga0496102_0203018 | 3300048905 | Bacteria | 1868 |
| 479 | Ga0496103_0152437 | 3300048906 | Bacteria | 1481 |
| 480 | Ga0496103_0161843 | 3300048906 | Bacteria | 1435 |
| 481 | Ga0496104_0022464 | 3300048907 | Bacteria | 5795 |
| 482 | Ga0496104_0056425 | 3300048907 | Bacteria | 3714 |
| 483 | Ga0496104_0064083 | 3300048907 | Bacteria | 3487 |
| 484 | Ga0496104_0114913 | 3300048907 | Bacteria | 2582 |
| 485 | Ga0496105_0011723 | 3300048908 | Bacteria | 6937 |
| 486 | Ga0496105_0024045 | 3300048908 | Bacteria | 4948 |
| 487 | Ga0496106_0127115 | 3300048909 | Bacteria | 1996 |
| 488 | Ga0496107_0100260 | 3300048910 | Bacteria | 2123 |
| 489 | Ga0496108_0048752 | 3300048911 | Bacteria | 3541 |
| 490 | Ga0496108_0092011 | 3300048911 | Bacteria | 2578 |
| 491 | Ga0496108_0298577 | 3300048911 | Bacteria | 1403 |
| 492 | Ga0496108_0713479 | 3300048911 | Bacteria | 869 |
| 493 | Ga0496109_0094332 | 3300048912 | Bacteria | 2770 |
| 494 | Ga0496109_0296106 | 3300048912 | Bacteria | 1525 |
| 495 | Ga0496109_0325677 | 3300048912 | Bacteria | 1450 |
| 496 | Ga0496110_0009334 | 3300048913 | Bacteria | 7936 |
| 497 | Ga0496110_0064083 | 3300048913 | Bacteria | 3247 |
| 498 | Ga0496111_0021769 | 3300048914 | Bacteria | 4479 |
| 499 | Ga0496111_0252747 | 3300048914 | Bacteria | 1308 |
| 500 | Ga0496112_0005800 | 3300048915 | Bacteria | 10742 |
| 501 | Ga0496112_0016155 | 3300048915 | Bacteria | 6983 |
| 502 | Ga0496112_0040197 | 3300048915 | Bacteria | 4572 |
| 503 | Ga0496112_0049894 | 3300048915 | Bacteria | 4102 |
| 504 | Ga0496112_0141211 | 3300048915 | Bacteria | 2378 |
| 505 | Ga0496113_0008633 | 3300048916 | Bacteria | 6647 |
| 506 | Ga0496113_0237603 | 3300048916 | Bacteria | 1453 |
| 507 | Ga0496114_0021787 | 3300048917 | Bacteria | 5215 |
| 508 | Ga0496115_0023976 | 3300048918 | Bacteria | 4739 |
| 509 | Ga0496115_0091962 | 3300048918 | Bacteria | 2479 |
| 510 | Ga0496117_0009524 | 3300048920 | Bacteria | 9020 |
| 511 | Ga0496118_0020768 | 3300048921 | Bacteria | 5812 |
| 512 | Ga0496119_0053130 | 3300048922 | Bacteria | 2477 |
| 513 | Ga0496120_0005636 | 3300048923 | Bacteria | 9919 |
| 514 | Ga0496120_0104411 | 3300048923 | Bacteria | 1491 |
| 515 | Ga0496122_0009142 | 3300048925 | Bacteria | 10501 |
| 516 | Ga0496123_0016411 | 3300048926 | Bacteria | 6017 |
| 517 | Ga0496124_0001397 | 3300048927 | Bacteria | 36152 |
| 518 | Ga0496124_0030412 | 3300048927 | Bacteria | 4793 |
| 519 | Ga0496124_0089860 | 3300048927 | Bacteria | 2507 |
| 520 | Ga0496124_0147353 | 3300048927 | Bacteria | 1851 |
| 521 | Ga0496126_0127437 | 3300048929 | Bacteria | 2202 |
| 522 | Ga0495682_0020538 | 3300049460 | Bacteria | 2479 |
| 523 | Ga0501031_0111761 | 3300049568 | Bacteria | 1784 |
| 524 | Ga0501031_0301914 | 3300049568 | Bacteria | 1038 |
| 525 | Ga0501032_0020198 | 3300049569 | Bacteria | 4643 |
| 526 | Ga0501033_0017722 | 3300049570 | Bacteria | 5378 |
| 527 | Ga0501033_0167547 | 3300049570 | Bacteria | 1579 |
| 528 | Ga0501034_0008076 | 3300049571 | Bacteria | 11161 |
| 529 | Ga0501034_0031600 | 3300049571 | Bacteria | 5378 |
| 530 | Ga0501034_0040265 | 3300049571 | Bacteria | 4730 |
| 531 | Ga0501034_0418731 | 3300049571 | Bacteria | 1261 |
| 532 | Ga0501036_0043648 | 3300049572 | Bacteria | 3797 |
| 533 | Ga0501036_0071904 | 3300049572 | Bacteria | 2925 |
| 534 | Ga0501036_0380011 | 3300049572 | Bacteria | 1179 |
| 535 | Ga0501037_0042496 | 3300049573 | Bacteria | 3339 |
| 536 | Ga0501037_0084498 | 3300049573 | Bacteria | 2299 |
| 537 | Ga0501038_0071456 | 3300049574 | Bacteria | 2943 |
| 538 | Ga0501038_0196821 | 3300049574 | Bacteria | 1619 |
| 539 | Ga0501038_0716965 | 3300049574 | Bacteria | 748 |
| 540 | Ga0501039_0020531 | 3300049575 | Bacteria | 5062 |
| 541 | Ga0501039_0537816 | 3300049575 | Bacteria | 917 |
| 542 | Ga0501040_0006012 | 3300049576 | Bacteria | 7854 |
| 543 | Ga0501040_0013184 | 3300049576 | Bacteria | 5437 |
| 544 | Ga0501040_0039284 | 3300049576 | Bacteria | 3218 |
| 545 | Ga0501040_0053368 | 3300049576 | Bacteria | 2768 |
| 546 | Ga0501041_0022085 | 3300049577 | Bacteria | 3810 |
| 547 | Ga0501041_0129762 | 3300049577 | Bacteria | 1570 |
| 548 | Ga0501042_0026279 | 3300049578 | Bacteria | 4092 |
| 549 | Ga0501042_0342588 | 3300049578 | Bacteria | 1081 |
| 550 | Ga0501043_0027397 | 3300049579 | Bacteria | 4473 |
| 551 | Ga0501043_0074314 | 3300049579 | Bacteria | 2670 |
| 552 | Ga0501046_0000033 | 3300049580 | Bacteria | 174675 |
| 553 | Ga0501046_0016707 | 3300049580 | Bacteria | 6139 |
| 554 | Ga0501046_0025507 | 3300049580 | Bacteria | 4837 |
| 555 | Ga0501046_0144071 | 3300049580 | Bacteria | 1800 |
| 556 | Ga0501047_0041016 | 3300049581 | Bacteria | 4473 |
| 557 | Ga0501047_0387613 | 3300049581 | Bacteria | 1231 |
| 558 | Ga0501047_0572922 | 3300049581 | Bacteria | 952 |
| 559 | Ga0501048_0016006 | 3300049582 | Bacteria | 5530 |
| 560 | Ga0501048_0031328 | 3300049582 | Bacteria | 3847 |
| 561 | Ga0501048_0187373 | 3300049582 | Bacteria | 1466 |
| 562 | Ga0501068_0012935 | 3300049584 | Bacteria | 4742 |
| 563 | Ga0501068_0013380 | 3300049584 | Bacteria | 4668 |
| 564 | Ga0501069_0038025 | 3300049585 | Bacteria | 2656 |
| 565 | Ga0501070_0461617 | 3300049586 | Bacteria | 1023 |
| 566 | Ga0501070_0495128 | 3300049586 | Bacteria | 982 |
| 567 | Ga0501071_0164905 | 3300049587 | Bacteria | 1657 |
| 568 | Ga0501071_0334464 | 3300049587 | Bacteria | 1151 |
| 569 | Ga0501071_0792359 | 3300049587 | Bacteria | 730 |
| 570 | Ga0501072_0030772 | 3300049588 | Bacteria | 4199 |
| 571 | Ga0501072_0076905 | 3300049588 | Bacteria | 2641 |
| 572 | Ga0501072_0192510 | 3300049588 | Bacteria | 1626 |
| 573 | Ga0501072_0386466 | 3300049588 | Bacteria | 1110 |
| 574 | Ga0501073_0026085 | 3300049589 | Bacteria | 4187 |
| 575 | Ga0501073_0128210 | 3300049589 | Bacteria | 1759 |
| 576 | Ga0501073_0255101 | 3300049589 | Bacteria | 1211 |
| 577 | Ga0501074_0034169 | 3300049590 | Bacteria | 3686 |
| 578 | Ga0501074_0060955 | 3300049590 | Bacteria | 2718 |
| 579 | Ga0501074_0323809 | 3300049590 | Bacteria | 1094 |
| 580 | Ga0501075_0067512 | 3300049591 | Bacteria | 2700 |
| 581 | Ga0501075_0100624 | 3300049591 | Bacteria | 2195 |
| 582 | Ga0501076_0047848 | 3300049592 | Bacteria | 3382 |
| 583 | Ga0501076_0052128 | 3300049592 | Bacteria | 3240 |
| 584 | Ga0501076_0088884 | 3300049592 | Bacteria | 2483 |
| 585 | Ga0501077_0011993 | 3300049593 | Bacteria | 5423 |
| 586 | Ga0501077_0102213 | 3300049593 | Bacteria | 1816 |
| 587 | Ga0501223_000230 | 3300049663 | Bacteria | 14369 |
| 588 | Ga0501235_003856 | 3300049669 | Bacteria | 3237 |
| 589 | Ga0501225_0000080 | 3300049705 | Bacteria | 30728 |
| 590 | Ga0501225_0018412 | 3300049705 | Bacteria | 1936 |
| 591 | Ga0501225_0039065 | 3300049705 | Bacteria | 1308 |
| 592 | Ga0501079_0082311 | 3300049741 | Bacteria | 2489 |
| 593 | Ga0501079_0112779 | 3300049741 | Bacteria | 2113 |
| 594 | Ga0501079_0176670 | 3300049741 | Bacteria | 1665 |
| 595 | Ga0501079_0402486 | 3300049741 | Bacteria | 1074 |
| 596 | Ga0501079_0672590 | 3300049741 | Bacteria | 815 |
| 597 | Ga0501080_0002809 | 3300049742 | Bacteria | 15307 |
| 598 | Ga0501080_0316647 | 3300049742 | Bacteria | 1413 |
| 599 | Ga0501081_0005965 | 3300049743 | Bacteria | 7888 |
| 600 | Ga0501081_0011068 | 3300049743 | Bacteria | 5900 |
| 601 | Ga0501081_0099027 | 3300049743 | Bacteria | 2059 |
| 602 | Ga0501081_0117007 | 3300049743 | Bacteria | 1896 |
| 603 | Ga0501083_0026184 | 3300049744 | Bacteria | 4033 |
| 604 | Ga0501035_0025372 | 3300049822 | Bacteria | 5434 |
| 605 | Ga0501035_0029884 | 3300049822 | Bacteria | 4969 |
| 606 | Ga0501035_0190442 | 3300049822 | Bacteria | 1763 |
| 607 | Ga0501035_0324676 | 3300049822 | Bacteria | 1292 |
| 608 | Ga0501035_0727227 | 3300049822 | Bacteria | 798 |
| 609 | Ga0501044_0033064 | 3300049823 | Bacteria | 5434 |
| 610 | Ga0501045_0022603 | 3300049824 | Bacteria | 4504 |
| 611 | Ga0501045_0035905 | 3300049824 | Bacteria | 3599 |
| 612 | Ga0501045_0165446 | 3300049824 | Bacteria | 1647 |
| 613 | nmdc:mga03n38_11638_c1 | 3300050490 | Bacteria | 3286 |
| 614 | nmdc:mga00v17_278592_c1 | 3300050491 | Bacteria | 1085 |
| 615 | nmdc:mga0yw44_144014_c1 | 3300050492 | Bacteria | 1550 |
| 616 | nmdc:mga0yw44_226882_c1 | 3300050492 | Bacteria | 1239 |
| 617 | nmdc:mga0yw44_24883_c1 | 3300050492 | Bacteria | 3395 |
| 618 | nmdc:mga0yw44_59240_c1 | 3300050492 | Bacteria | 2342 |
| 619 | nmdc:mga0k408_352386_c1 | 3300050493 | Bacteria | 877 |
| 620 | nmdc:mga06z11_37456_c1 | 3300050494 | Bacteria | 2402 |
| 621 | nmdc:mga06z11_75776_c1 | 3300050494 | Bacteria | 1792 |
| 622 | nmdc:mga07m45_74995_c1 | 3300050496 | Bacteria | 1927 |
| 623 | nmdc:mga07m45_87014_c1 | 3300050496 | Bacteria | 1788 |
| 624 | nmdc:mga09592_131361_c1 | 3300050508 | Bacteria | 2155 |
| 625 | nmdc:mga0qj67_257581_c1 | 3300050509 | Bacteria | 1415 |
| 626 | nmdc:mga06r32_122939_c1 | 3300050510 | Bacteria | 2561 |
| 627 | nmdc:mga06r32_78872_c1 | 3300050510 | Bacteria | 3202 |
| 628 | nmdc:mga08y16_127183_c1 | 3300050511 | Bacteria | 2651 |
| 629 | nmdc:mga0n895_189356_c1 | 3300050512 | Bacteria | 2089 |
| 630 | nmdc:mga0n895_426707_c1 | 3300050512 | Bacteria | 1340 |
| 631 | nmdc:mga0rr50_20821_c1 | 3300050513 | Bacteria | 4464 |
| 632 | nmdc:mga0a205_249275_c1 | 3300050515 | Bacteria | 1656 |
| 633 | nmdc:mga0sz30_85908_c1 | 3300050516 | Bacteria | 1365 |
| 634 | Ga0495601_0149578 | 3300053077 | Bacteria | 1524 |
| 635 | Ga0500610_0160457 | 3300053079 | Bacteria | 1119 |
| 636 | Ga0495655_0064330 | 3300053083 | Bacteria | 1009 |
| 637 | Ga0495655_0079630 | 3300053083 | Bacteria | 934 |
| 638 | Ga0495595_0114175 | 3300053084 | Bacteria | 1312 |
| 639 | Ga0495619_0013696 | 3300053085 | Bacteria | 5112 |
| 640 | Ga0500643_008114 | 3300053087 | Bacteria | 4159 |
| 641 | Ga0500646_0132432 | 3300053090 | Bacteria | 811 |
| 642 | Ga0500555_000408 | 3300053103 | Bacteria | 17901 |
| 643 | Ga0500593_000443 | 3300053117 | Bacteria | 16325 |
| 644 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 645 | Ga0500568_0000131 | 3300053139 | Bacteria | 67970 |
| 646 | Ga0500620_000396 | 3300053155 | Bacteria | 8062 |
| 647 | Ga0500627_0063679 | 3300053158 | Bacteria | 1625 |
| 648 | Ga0500627_0220688 | 3300053158 | Bacteria | 846 |
| 649 | Ga0500636_0004813 | 3300053177 | Bacteria | 7660 |
| 650 | Ga0500587_000386 | 3300053739 | Bacteria | 5071 |
| 651 | Ga0501084_0020964 | 3300054114 | Bacteria | 5450 |
| 652 | Ga0501084_0032100 | 3300054114 | Bacteria | 4392 |
| 653 | Ga0501084_0055882 | 3300054114 | Bacteria | 3303 |
| 654 | Ga0501084_0351475 | 3300054114 | Bacteria | 1245 |
| 655 | Ga0501084_0821507 | 3300054114 | Bacteria | 783 |
| 656 | Ga0501082_0057130 | 3300060353 | Bacteria | 3362 |
| 657 | Ga0501082_0077754 | 3300060353 | Bacteria | 2861 |
| 658 | Ga0501082_0141462 | 3300060353 | Bacteria | 2088 |
| 659 | Ga0530510_0059609 | 3300061734 | Bacteria | 2761 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8004727605 | 8004729149 | 207 |
| 2 | 3300037312 | Ga0395899_0000430 | Ga0395899_0000430_17773_18420 | 212 |
| 3 | 3300037418 | Ga0395900_0000086 | Ga0395900_0000086_17773_18420 | 212 |
| 4 | 3300037466 | Ga0395898_0000901 | Ga0395898_0000901_17773_18420 | 212 |
| 5 | 3300037471 | Ga0395905_0000614 | Ga0395905_0000614_29342_29989 | 212 |
| 6 | 3300038443 | Ga0395901_0000449 | Ga0395901_0000449_29306_29953 | 212 |
| 7 | 3300049587 | Ga0501071_0792359 | Ga0501071_0792359_67_711 | 213 |
| 8 | iso_pu_bacteria | 2958137437 | 2958140378 | 213 |
| 9 | iso_pu_bacteria | 2906386501 | 2906386994 | 215 |
| 10 | 3300050509 | nmdc:mga0qj67_257581_c1 | nmdc:mga0qj67_257581_c1_23_682 | 216 |
| 11 | 3300050510 | nmdc:mga06r32_122939_c1 | nmdc:mga06r32_122939_c1_27_686 | 216 |
| 12 | 3300044683 | Ga0466965_0404704 | Ga0466965_0404704_20_712 | 217 |
| 13 | 3300049573 | Ga0501037_0042496 | Ga0501037_0042496_10_672 | 217 |
| 14 | 3300050494 | nmdc:mga06z11_37456_c1 | nmdc:mga06z11_37456_c1_19_681 | 217 |
| 15 | iso_pu_bacteria | 2852653556 | 2852653973 | 217 |
| 16 | iso_pu_bacteria | 2970619444 | 2970623898 | 217 |
| 17 | 3300049574 | Ga0501038_0716965 | Ga0501038_0716965_78_737 | 218 |
| 18 | 3300049822 | Ga0501035_0727227 | Ga0501035_0727227_118_777 | 218 |
| 19 | 3300049581 | Ga0501047_0572922 | Ga0501047_0572922_31_702 | 219 |
| 20 | iso_pu_bacteria | 2643221662 | 2644345853 | 219 |
| 21 | iso_pu_bacteria | 2937891427 | 2937894403 | 221 |
| 22 | iso_pu_bacteria | 2513237351 | 2514586656 | 222 |
| 23 | 3300050493 | nmdc:mga0k408_352386_c1 | nmdc:mga0k408_352386_c1_43_723 | 223 |
| 24 | 3300005617 | Ga0068859_100329930 | Ga0068859_1003299302 | 224 |
| 25 | 3300006931 | Ga0097620_100329945 | Ga0097620_1003299452 | 224 |
| 26 | iso_pu_bacteria | 2599185301 | 2599936983 | 224 |
| 27 | iso_pu_bacteria | 2922185730 | 2922189986 | 224 |
| 28 | iso_pu_bacteria | 2968117919 | 2968122325 | 224 |
| 29 | iso_pu_bacteria | 2979742915 | 2979751876 | 224 |
| 30 | iso_pu_bacteria | 2503198000 | 2503199046 | 225 |
| 31 | iso_pu_bacteria | 2508501123 | 2509117686 | 225 |
| 32 | iso_pu_bacteria | 2509276022 | 2509393997 | 225 |
| 33 | iso_pu_bacteria | 2512875016 | 2512933554 | 225 |
| 34 | iso_pu_bacteria | 2512875024 | 2512961693 | 225 |
| 35 | iso_pu_bacteria | 2513237164 | 2514035624 | 225 |
| 36 | iso_pu_bacteria | 2588253730 | 2588519632 | 225 |
| 37 | iso_pu_bacteria | 2738543024 | 2739306056 | 225 |
| 38 | iso_pu_bacteria | 2874139085 | 2874139431 | 225 |
| 39 | iso_pu_bacteria | 2874168670 | 2874170686 | 225 |
| 40 | iso_pu_bacteria | 2876363079 | 2876364192 | 225 |
| 41 | iso_pu_bacteria | 2888337043 | 2888343731 | 225 |
| 42 | iso_pu_bacteria | 2903448605 | 2903453704 | 225 |
| 43 | iso_pu_bacteria | 2903521522 | 2903525648 | 225 |
| 44 | iso_pu_bacteria | 2903528002 | 2903532805 | 225 |
| 45 | iso_pu_bacteria | 2937848649 | 2937851652 | 225 |
| 46 | iso_pu_bacteria | 2958064165 | 2958065713 | 225 |
| 47 | iso_pu_bacteria | 2963644680 | 2963645650 | 225 |
| 48 | iso_pu_bacteria | 2968083720 | 2968085014 | 225 |
| 49 | iso_pu_bacteria | 2977922695 | 2977929508 | 225 |
| 50 | iso_pu_bacteria | 2989771324 | 2989771548 | 225 |
| 51 | iso_pu_bacteria | 3000135777 | 3000137714 | 225 |
| 52 | iso_pu_bacteria | 3004211236 | 3004218362 | 225 |
| 53 | iso_pu_bacteria | 3004218560 | 3004219541 | 225 |
| 54 | iso_pu_bacteria | 3004289098 | 3004289836 | 225 |
| 55 | iso_pu_bacteria | 637000159 | 637076659 | 225 |
| 56 | iso_pu_bacteria | 8055617313 | 8055618245 | 225 |
| 57 | iso_pu_bacteria | 2510065059 | 2510318332 | 226 |
| 58 | iso_pu_bacteria | 2597489875 | 2597811930 | 226 |
| 59 | iso_pu_bacteria | 2643221595 | 2643988509 | 226 |
| 60 | iso_pu_bacteria | 2643221627 | 2644154574 | 226 |
| 61 | iso_pu_bacteria | 2687453392 | 2688596316 | 226 |
| 62 | iso_pu_bacteria | 2844009547 | 2844011145 | 226 |
| 63 | iso_pu_bacteria | 2847686936 | 2847690250 | 226 |
| 64 | iso_pu_bacteria | 2856328259 | 2856329807 | 226 |
| 65 | iso_pu_bacteria | 2856334872 | 2856336609 | 226 |
| 66 | iso_pu_bacteria | 2869249662 | 2869256323 | 226 |
| 67 | iso_pu_bacteria | 2869264136 | 2869267489 | 226 |
| 68 | iso_pu_bacteria | 2869271264 | 2869271957 | 226 |
| 69 | iso_pu_bacteria | 2871451962 | 2871459197 | 226 |
| 70 | iso_pu_bacteria | 2871459585 | 2871464886 | 226 |
| 71 | iso_pu_bacteria | 2871466892 | 2871472361 | 226 |
| 72 | iso_pu_bacteria | 2874102143 | 2874104888 | 226 |
| 73 | iso_pu_bacteria | 2874131515 | 2874137000 | 226 |
| 74 | iso_pu_bacteria | 2874162495 | 2874166806 | 226 |
| 75 | iso_pu_bacteria | 2876392853 | 2876399229 | 226 |
| 76 | iso_pu_bacteria | 2876399893 | 2876402455 | 226 |
| 77 | iso_pu_bacteria | 2876406927 | 2876410423 | 226 |
| 78 | iso_pu_bacteria | 2878774303 | 2878776656 | 226 |
| 79 | iso_pu_bacteria | 2878781027 | 2878785619 | 226 |
| 80 | iso_pu_bacteria | 2881161766 | 2881165328 | 226 |
| 81 | iso_pu_bacteria | 2885326080 | 2885330905 | 226 |
| 82 | iso_pu_bacteria | 2904659560 | 2904665756 | 226 |
| 83 | iso_pu_bacteria | 2906328253 | 2906333889 | 226 |
| 84 | iso_pu_bacteria | 2906363423 | 2906366417 | 226 |
| 85 | iso_pu_bacteria | 2906370794 | 2906377444 | 226 |
| 86 | iso_pu_bacteria | 2906378014 | 2906384998 | 226 |
| 87 | iso_pu_bacteria | 2906393657 | 2906400506 | 226 |
| 88 | iso_pu_bacteria | 2906408224 | 2906411097 | 226 |
| 89 | iso_pu_bacteria | 2922151315 | 2922158489 | 226 |
| 90 | iso_pu_bacteria | 2922172374 | 2922176703 | 226 |
| 91 | iso_pu_bacteria | 2922178524 | 2922180400 | 226 |
| 92 | iso_pu_bacteria | 2924748358 | 2924751080 | 226 |
| 93 | iso_pu_bacteria | 2924762789 | 2924768566 | 226 |
| 94 | iso_pu_bacteria | 2958115193 | 2958120422 | 226 |
| 95 | iso_pu_bacteria | 2958122699 | 2958128059 | 226 |
| 96 | iso_pu_bacteria | 2958158011 | 2958162706 | 226 |
| 97 | iso_pu_bacteria | 2961114664 | 2961121099 | 226 |
| 98 | iso_pu_bacteria | 2965025482 | 2965026648 | 226 |
| 99 | iso_pu_bacteria | 2965040258 | 2965041476 | 226 |
| 100 | iso_pu_bacteria | 2965047637 | 2965053612 | 226 |
| 101 | iso_pu_bacteria | 2965062239 | 2965067793 | 226 |
| 102 | iso_pu_bacteria | 2965089291 | 2965095222 | 226 |
| 103 | iso_pu_bacteria | 2965102966 | 2965109243 | 226 |
| 104 | iso_pu_bacteria | 2968097103 | 2968100250 | 226 |
| 105 | iso_pu_bacteria | 2968110612 | 2968117249 | 226 |
| 106 | iso_pu_bacteria | 2968128360 | 2968129655 | 226 |
| 107 | iso_pu_bacteria | 2970489779 | 2970490811 | 226 |
| 108 | iso_pu_bacteria | 2970510686 | 2970511100 | 226 |
| 109 | iso_pu_bacteria | 2970547951 | 2970551978 | 226 |
| 110 | iso_pu_bacteria | 2977872689 | 2977874311 | 226 |
| 111 | iso_pu_bacteria | 2977915119 | 2977916843 | 226 |
| 112 | iso_pu_bacteria | 2977935797 | 2977938925 | 226 |
| 113 | iso_pu_bacteria | 2977950692 | 2977953576 | 226 |
| 114 | iso_pu_bacteria | 2977957713 | 2977961341 | 226 |
| 115 | iso_pu_bacteria | 2979779861 | 2979784468 | 226 |
| 116 | iso_pu_bacteria | 2979793036 | 2979798346 | 226 |
| 117 | iso_pu_bacteria | 2987645492 | 2987648562 | 226 |
| 118 | iso_pu_bacteria | 2987666974 | 2987673295 | 226 |
| 119 | iso_pu_bacteria | 2987673487 | 2987673725 | 226 |
| 120 | iso_pu_bacteria | 3004167301 | 3004173647 | 226 |
| 121 | iso_pu_bacteria | 3004195979 | 3004200191 | 226 |
| 122 | iso_pu_bacteria | 649633066 | 649870869 | 226 |
| 123 | iso_pu_bacteria | 8004300914 | 8004303087 | 226 |
| 124 | iso_pu_bacteria | 8004695233 | 8004703094 | 226 |
| 125 | iso_pu_bacteria | 8004703790 | 8004706421 | 226 |
| 126 | 3300025934 | Ga0207686_10386450 | Ga0207686_103864502 | 227 |
| 127 | 3300031247 | Ga0265340_10021513 | Ga0265340_100215134 | 227 |
| 128 | 3300049741 | Ga0501079_0672590 | Ga0501079_0672590_114_800 | 227 |
| 129 | 3300053139 | Ga0500568_0000131 | Ga0500568_0000131_30664_31356 | 227 |
| 130 | iso_pu_bacteria | 2856364286 | 2856365056 | 227 |
| 131 | iso_pu_bacteria | 2857349434 | 2857353266 | 227 |
| 132 | iso_pu_bacteria | 2869169390 | 2869175900 | 227 |
| 133 | iso_pu_bacteria | 2869234852 | 2869241044 | 227 |
| 134 | iso_pu_bacteria | 2869256925 | 2869260636 | 227 |
| 135 | iso_pu_bacteria | 2869285874 | 2869286320 | 227 |
| 136 | iso_pu_bacteria | 2871429161 | 2871430289 | 227 |
| 137 | iso_pu_bacteria | 2871435913 | 2871443269 | 227 |
| 138 | iso_pu_bacteria | 2871481445 | 2871485875 | 227 |
| 139 | iso_pu_bacteria | 2874109183 | 2874113996 | 227 |
| 140 | iso_pu_bacteria | 2874116593 | 2874123092 | 227 |
| 141 | iso_pu_bacteria | 2874146452 | 2874146706 | 227 |
| 142 | iso_pu_bacteria | 2874155637 | 2874155780 | 227 |
| 143 | iso_pu_bacteria | 2876386047 | 2876388565 | 227 |
| 144 | iso_pu_bacteria | 2876413966 | 2876414109 | 227 |
| 145 | iso_pu_bacteria | 2876420981 | 2876427348 | 227 |
| 146 | iso_pu_bacteria | 2878730984 | 2878733884 | 227 |
| 147 | iso_pu_bacteria | 2878745973 | 2878746485 | 227 |
| 148 | iso_pu_bacteria | 2882632389 | 2882640357 | 227 |
| 149 | iso_pu_bacteria | 2903492973 | 2903499675 | 227 |
| 150 | iso_pu_bacteria | 2906308376 | 2906308886 | 227 |
| 151 | iso_pu_bacteria | 2906321335 | 2906322166 | 227 |
| 152 | iso_pu_bacteria | 2906401398 | 2906405346 | 227 |
| 153 | iso_pu_bacteria | 2924710171 | 2924710696 | 227 |
| 154 | iso_pu_bacteria | 2924733363 | 2924737252 | 227 |
| 155 | iso_pu_bacteria | 2924741084 | 2924746547 | 227 |
| 156 | iso_pu_bacteria | 2937813078 | 2937822225 | 227 |
| 157 | iso_pu_bacteria | 2937861824 | 2937863556 | 227 |
| 158 | iso_pu_bacteria | 2958108152 | 2958111071 | 227 |
| 159 | iso_pu_bacteria | 2958130278 | 2958130719 | 227 |
| 160 | iso_pu_bacteria | 2958179912 | 2958180058 | 227 |
| 161 | iso_pu_bacteria | 2961077736 | 2961077885 | 227 |
| 162 | iso_pu_bacteria | 2961183825 | 2961184839 | 227 |
| 163 | iso_pu_bacteria | 2968138860 | 2968144192 | 227 |
| 164 | iso_pu_bacteria | 2970532167 | 2970539004 | 227 |
| 165 | iso_pu_bacteria | 2970627176 | 2970630113 | 227 |
| 166 | iso_pu_bacteria | 2977843712 | 2977844278 | 227 |
| 167 | iso_pu_bacteria | 2977851361 | 2977855402 | 227 |
| 168 | iso_pu_bacteria | 2977942078 | 2977942401 | 227 |
| 169 | iso_pu_bacteria | 2987636660 | 2987641858 | 227 |
| 170 | iso_pu_bacteria | 2996386984 | 2996389852 | 227 |
| 171 | iso_pu_bacteria | 3004203850 | 3004209330 | 227 |
| 172 | iso_pu_bacteria | 3004232784 | 3004236243 | 227 |
| 173 | iso_pu_bacteria | 3004268573 | 3004269397 | 227 |
| 174 | iso_pu_bacteria | 8004312739 | 8004313354 | 227 |
| 175 | iso_pu_bacteria | 8004387939 | 8004388520 | 227 |
| 176 | iso_pu_bacteria | 8004714634 | 8004715142 | 227 |
| 177 | 3300006847 | Ga0075431_100448577 | Ga0075431_1004485772 | 228 |
| 178 | 3300009093 | Ga0105240_10228412 | Ga0105240_102284122 | 228 |
| 179 | 3300025913 | Ga0207695_10680158 | Ga0207695_106801582 | 228 |
| 180 | 3300048905 | Ga0496102_0072856 | Ga0496102_0072856_1166_1861 | 228 |
| 181 | 3300048926 | Ga0496123_0016411 | Ga0496123_0016411_377_1072 | 228 |
| 182 | 3300048927 | Ga0496124_0001397 | Ga0496124_0001397_974_1669 | 228 |
| 183 | 3300049575 | Ga0501039_0537816 | Ga0501039_0537816_18_713 | 228 |
| 184 | 3300002741 | JGI25157J39369_1001721 | JGI25157J39369_10017218 | 229 |
| 185 | 3300003203 | JGI25406J46586_10000167 | JGI25406J46586_1000016722 | 229 |
| 186 | 3300005985 | Ga0081539_10001073 | Ga0081539_1000107336 | 229 |
| 187 | 3300006038 | Ga0075365_10166232 | Ga0075365_101662322 | 229 |
| 188 | 3300006038 | Ga0075365_10394511 | Ga0075365_103945112 | 229 |
| 189 | 3300006042 | Ga0075368_10042328 | Ga0075368_100423282 | 229 |
| 190 | 3300006048 | Ga0075363_100043911 | Ga0075363_1000439113 | 229 |
| 191 | 3300006051 | Ga0075364_10116579 | Ga0075364_101165792 | 229 |
| 192 | 3300006175 | Ga0070712_100305893 | Ga0070712_1003058932 | 229 |
| 193 | 3300009551 | Ga0105238_10479438 | Ga0105238_104794382 | 229 |
| 194 | 3300010375 | Ga0105239_10407953 | Ga0105239_104079532 | 229 |
| 195 | 3300025250 | Ga0209026_1000032 | Ga0209026_100003297 | 229 |
| 196 | 3300025256 | Ga0209759_1000142 | Ga0209759_1000142100 | 229 |
| 197 | 3300025904 | Ga0207647_10081963 | Ga0207647_100819632 | 229 |
| 198 | 3300025913 | Ga0207695_10470363 | Ga0207695_104703632 | 229 |
| 199 | 3300025915 | Ga0207693_10306164 | Ga0207693_103061642 | 229 |
| 200 | 3300025920 | Ga0207649_10368930 | Ga0207649_103689302 | 229 |
| 201 | 3300025927 | Ga0207687_10359341 | Ga0207687_103593412 | 229 |
| 202 | 3300037068 | Ga0373925_0042979 | Ga0373925_0042979_2196_2894 | 229 |
| 203 | 3300046460 | Ga0495638_0006475 | Ga0495638_0006475_4815_5513 | 229 |
| 204 | 3300046460 | Ga0495638_0075581 | Ga0495638_0075581_627_1325 | 229 |
| 205 | 3300046512 | Ga0495610_0065825 | Ga0495610_0065825_170_868 | 229 |
| 206 | 3300046515 | Ga0495620_0120879 | Ga0495620_0120879_95_793 | 229 |
| 207 | 3300046522 | Ga0495643_0196594 | Ga0495643_0196594_32_730 | 229 |
| 208 | 3300046642 | Ga0495634_0284350 | Ga0495634_0284350_236_934 | 229 |
| 209 | 3300046660 | Ga0495625_0037557 | Ga0495625_0037557_1666_2364 | 229 |
| 210 | 3300048922 | Ga0496119_0053130 | Ga0496119_0053130_1649_2347 | 229 |
| 211 | 3300048927 | Ga0496124_0089860 | Ga0496124_0089860_1513_2211 | 229 |
| 212 | 3300048929 | Ga0496126_0127437 | Ga0496126_0127437_458_1156 | 229 |
| 213 | 3300049578 | Ga0501042_0342588 | Ga0501042_0342588_273_968 | 229 |
| 214 | 3300050492 | nmdc:mga0yw44_144014_c1 | nmdc:mga0yw44_144014_c1_690_1388 | 229 |
| 215 | 3300050492 | nmdc:mga0yw44_24883_c1 | nmdc:mga0yw44_24883_c1_1582_2280 | 229 |
| 216 | 3300053079 | Ga0500610_0160457 | Ga0500610_0160457_39_737 | 229 |
| 217 | 3300053083 | Ga0495655_0064330 | Ga0495655_0064330_32_730 | 229 |
| 218 | 3300053083 | Ga0495655_0079630 | Ga0495655_0079630_15_713 | 229 |
| 219 | 3300053155 | Ga0500620_000396 | Ga0500620_000396_4030_4728 | 229 |
| 220 | 3300003214 | JGI25165J46597_1000052 | JGI25165J46597_1000052230 | 230 |
| 221 | 3300005355 | Ga0070671_100043860 | Ga0070671_1000438605 | 230 |
| 222 | 3300005365 | Ga0070688_100197022 | Ga0070688_1001970222 | 230 |
| 223 | 3300005435 | Ga0070714_100284098 | Ga0070714_1002840982 | 230 |
| 224 | 3300005548 | Ga0070665_100028878 | Ga0070665_1000288786 | 230 |
| 225 | 3300005844 | Ga0068862_100728167 | Ga0068862_1007281671 | 230 |
| 226 | 3300006038 | Ga0075365_10124826 | Ga0075365_101248261 | 230 |
| 227 | 3300006038 | Ga0075365_10255096 | Ga0075365_102550962 | 230 |
| 228 | 3300006178 | Ga0075367_10038757 | Ga0075367_100387573 | 230 |
| 229 | 3300009147 | Ga0114129_10205703 | Ga0114129_102057034 | 230 |
| 230 | 3300009553 | Ga0105249_10306378 | Ga0105249_103063782 | 230 |
| 231 | 3300014326 | Ga0157380_10183414 | Ga0157380_101834142 | 230 |
| 232 | 3300021384 | Ga0213876_10051205 | Ga0213876_100512052 | 230 |
| 233 | 3300021388 | Ga0213875_10000033 | Ga0213875_1000003362 | 230 |
| 234 | 3300025261 | Ga0209233_1000118 | Ga0209233_100011837 | 230 |
| 235 | 3300025929 | Ga0207664_10644584 | Ga0207664_106445841 | 230 |
| 236 | 3300025939 | Ga0207665_10157735 | Ga0207665_101577353 | 230 |
| 237 | 3300025972 | Ga0207668_10213178 | Ga0207668_102131782 | 230 |
| 238 | 3300026095 | Ga0207676_10030709 | Ga0207676_100307095 | 230 |
| 239 | 3300028379 | Ga0268266_10125646 | Ga0268266_101256462 | 230 |
| 240 | 3300037418 | Ga0395900_0229777 | Ga0395900_0229777_738_1439 | 230 |
| 241 | 3300037853 | Ga0436364_1338082 | Ga0436364_1338082_20512_21213 | 230 |
| 242 | 3300038443 | Ga0395901_0204127 | Ga0395901_0204127_150_851 | 230 |
| 243 | 3300039437 | Ga0436365_0804346 | Ga0436365_0804346_896_1597 | 230 |
| 244 | 3300048904 | Ga0496101_0035354 | Ga0496101_0035354_1275_2000 | 230 |
| 245 | 3300048907 | Ga0496104_0064083 | Ga0496104_0064083_2059_2784 | 230 |
| 246 | 3300048911 | Ga0496108_0298577 | Ga0496108_0298577_380_1105 | 230 |
| 247 | 3300048915 | Ga0496112_0141211 | Ga0496112_0141211_897_1598 | 230 |
| 248 | 3300048923 | Ga0496120_0005636 | Ga0496120_0005636_6007_6708 | 230 |
| 249 | 3300049568 | Ga0501031_0111761 | Ga0501031_0111761_1003_1749 | 230 |
| 250 | 3300049569 | Ga0501032_0020198 | Ga0501032_0020198_846_1547 | 230 |
| 251 | 3300049570 | Ga0501033_0017722 | Ga0501033_0017722_3097_3798 | 230 |
| 252 | 3300049571 | Ga0501034_0008076 | Ga0501034_0008076_1274_1975 | 230 |
| 253 | 3300049571 | Ga0501034_0031600 | Ga0501034_0031600_1581_2282 | 230 |
| 254 | 3300049571 | Ga0501034_0040265 | Ga0501034_0040265_3145_3891 | 230 |
| 255 | 3300049572 | Ga0501036_0071904 | Ga0501036_0071904_1581_2282 | 230 |
| 256 | 3300049573 | Ga0501037_0084498 | Ga0501037_0084498_612_1313 | 230 |
| 257 | 3300049574 | Ga0501038_0071456 | Ga0501038_0071456_1581_2282 | 230 |
| 258 | 3300049575 | Ga0501039_0020531 | Ga0501039_0020531_846_1547 | 230 |
| 259 | 3300049576 | Ga0501040_0039284 | Ga0501040_0039284_1856_2557 | 230 |
| 260 | 3300049577 | Ga0501041_0129762 | Ga0501041_0129762_642_1343 | 230 |
| 261 | 3300049579 | Ga0501043_0027397 | Ga0501043_0027397_2192_2893 | 230 |
| 262 | 3300049580 | Ga0501046_0025507 | Ga0501046_0025507_1981_2682 | 230 |
| 263 | 3300049581 | Ga0501047_0041016 | Ga0501047_0041016_1581_2282 | 230 |
| 264 | 3300049582 | Ga0501048_0016006 | Ga0501048_0016006_2272_2973 | 230 |
| 265 | 3300049584 | Ga0501068_0012935 | Ga0501068_0012935_2461_3162 | 230 |
| 266 | 3300049585 | Ga0501069_0038025 | Ga0501069_0038025_1671_2372 | 230 |
| 267 | 3300049587 | Ga0501071_0164905 | Ga0501071_0164905_322_1023 | 230 |
| 268 | 3300049588 | Ga0501072_0076905 | Ga0501072_0076905_1753_2454 | 230 |
| 269 | 3300049589 | Ga0501073_0026085 | Ga0501073_0026085_2765_3466 | 230 |
| 270 | 3300049590 | Ga0501074_0034169 | Ga0501074_0034169_2559_3260 | 230 |
| 271 | 3300049705 | Ga0501225_0018412 | Ga0501225_0018412_1128_1826 | 230 |
| 272 | 3300049742 | Ga0501080_0002809 | Ga0501080_0002809_3058_3759 | 230 |
| 273 | 3300049744 | Ga0501083_0026184 | Ga0501083_0026184_1704_2405 | 230 |
| 274 | 3300049822 | Ga0501035_0025372 | Ga0501035_0025372_3097_3798 | 230 |
| 275 | 3300049822 | Ga0501035_0324676 | Ga0501035_0324676_257_958 | 230 |
| 276 | 3300049823 | Ga0501044_0033064 | Ga0501044_0033064_1637_2338 | 230 |
| 277 | 3300049824 | Ga0501045_0022603 | Ga0501045_0022603_1980_2681 | 230 |
| 278 | 3300050490 | nmdc:mga03n38_11638_c1 | nmdc:mga03n38_11638_c1_1909_2610 | 230 |
| 279 | 3300050491 | nmdc:mga00v17_278592_c1 | nmdc:mga00v17_278592_c1_232_933 | 230 |
| 280 | 3300050492 | nmdc:mga0yw44_226882_c1 | nmdc:mga0yw44_226882_c1_320_1021 | 230 |
| 281 | 3300050494 | nmdc:mga06z11_75776_c1 | nmdc:mga06z11_75776_c1_545_1246 | 230 |
| 282 | 3300050496 | nmdc:mga07m45_74995_c1 | nmdc:mga07m45_74995_c1_661_1362 | 230 |
| 283 | 3300050496 | nmdc:mga07m45_87014_c1 | nmdc:mga07m45_87014_c1_605_1306 | 230 |
| 284 | 3300053158 | Ga0500627_0063679 | Ga0500627_0063679_26_727 | 230 |
| 285 | 3300053158 | Ga0500627_0220688 | Ga0500627_0220688_84_785 | 230 |
| 286 | iso_pu_bacteria | 2869162929 | 2869167180 | 230 |
| 287 | 3300005341 | Ga0070691_10135955 | Ga0070691_101359552 | 231 |
| 288 | 3300005544 | Ga0070686_100592980 | Ga0070686_1005929801 | 231 |
| 289 | 3300005548 | Ga0070665_100449775 | Ga0070665_1004497752 | 231 |
| 290 | 3300005617 | Ga0068859_100225103 | Ga0068859_1002251032 | 231 |
| 291 | 3300005843 | Ga0068860_100066297 | Ga0068860_1000662974 | 231 |
| 292 | 3300006881 | Ga0068865_100014630 | Ga0068865_1000146304 | 231 |
| 293 | 3300009148 | Ga0105243_10291739 | Ga0105243_102917392 | 231 |
| 294 | 3300011119 | Ga0105246_10067023 | Ga0105246_100670234 | 231 |
| 295 | 3300013306 | Ga0163162_10139568 | Ga0163162_101395682 | 231 |
| 296 | 3300014326 | Ga0157380_10281309 | Ga0157380_102813093 | 231 |
| 297 | 3300017792 | Ga0163161_10011472 | Ga0163161_100114726 | 231 |
| 298 | 3300025907 | Ga0207645_10010138 | Ga0207645_100101382 | 231 |
| 299 | 3300025937 | Ga0207669_10009139 | Ga0207669_100091392 | 231 |
| 300 | 3300025942 | Ga0207689_10235438 | Ga0207689_102354382 | 231 |
| 301 | 3300025981 | Ga0207640_10361993 | Ga0207640_103619932 | 231 |
| 302 | 3300026067 | Ga0207678_10312033 | Ga0207678_103120331 | 231 |
| 303 | 3300026089 | Ga0207648_10230588 | Ga0207648_102305882 | 231 |
| 304 | 3300036401 | Ga0373937_0144566 | Ga0373937_0144566_992_1696 | 231 |
| 305 | 3300044658 | Ga0466972_0154466 | Ga0466972_0154466_176_880 | 231 |
| 306 | 3300046455 | Ga0495603_0411026 | Ga0495603_0411026_37_741 | 231 |
| 307 | 3300046663 | Ga0495635_0377828 | Ga0495635_0377828_142_846 | 231 |
| 308 | 3300048088 | Ga0495602_0165080 | Ga0495602_0165080_40_744 | 231 |
| 309 | 3300048907 | Ga0496104_0056425 | Ga0496104_0056425_2574_3272 | 231 |
| 310 | 3300048912 | Ga0496109_0094332 | Ga0496109_0094332_137_835 | 231 |
| 311 | 3300048918 | Ga0496115_0023976 | Ga0496115_0023976_3490_4188 | 231 |
| 312 | 3300049568 | Ga0501031_0301914 | Ga0501031_0301914_152_850 | 231 |
| 313 | 3300049570 | Ga0501033_0167547 | Ga0501033_0167547_675_1373 | 231 |
| 314 | 3300049571 | Ga0501034_0418731 | Ga0501034_0418731_152_856 | 231 |
| 315 | 3300049572 | Ga0501036_0043648 | Ga0501036_0043648_3025_3723 | 231 |
| 316 | 3300049572 | Ga0501036_0380011 | Ga0501036_0380011_154_858 | 231 |
| 317 | 3300049576 | Ga0501040_0013184 | Ga0501040_0013184_2540_3238 | 231 |
| 318 | 3300049576 | Ga0501040_0053368 | Ga0501040_0053368_1981_2685 | 231 |
| 319 | 3300049577 | Ga0501041_0022085 | Ga0501041_0022085_2105_2803 | 231 |
| 320 | 3300049578 | Ga0501042_0026279 | Ga0501042_0026279_2425_3123 | 231 |
| 321 | 3300049580 | Ga0501046_0016707 | Ga0501046_0016707_4921_5625 | 231 |
| 322 | 3300049581 | Ga0501047_0387613 | Ga0501047_0387613_151_855 | 231 |
| 323 | 3300049582 | Ga0501048_0187373 | Ga0501048_0187373_676_1374 | 231 |
| 324 | 3300049584 | Ga0501068_0013380 | Ga0501068_0013380_69_773 | 231 |
| 325 | 3300049586 | Ga0501070_0495128 | Ga0501070_0495128_229_927 | 231 |
| 326 | 3300049587 | Ga0501071_0334464 | Ga0501071_0334464_267_971 | 231 |
| 327 | 3300049588 | Ga0501072_0192510 | Ga0501072_0192510_587_1291 | 231 |
| 328 | 3300049588 | Ga0501072_0386466 | Ga0501072_0386466_322_1020 | 231 |
| 329 | 3300049590 | Ga0501074_0323809 | Ga0501074_0323809_247_951 | 231 |
| 330 | 3300049591 | Ga0501075_0067512 | Ga0501075_0067512_1616_2314 | 231 |
| 331 | 3300049591 | Ga0501075_0100624 | Ga0501075_0100624_1145_1849 | 231 |
| 332 | 3300049592 | Ga0501076_0052128 | Ga0501076_0052128_100_804 | 231 |
| 333 | 3300049592 | Ga0501076_0088884 | Ga0501076_0088884_493_1191 | 231 |
| 334 | 3300049593 | Ga0501077_0011993 | Ga0501077_0011993_776_1480 | 231 |
| 335 | 3300049741 | Ga0501079_0082311 | Ga0501079_0082311_1435_2139 | 231 |
| 336 | 3300049741 | Ga0501079_0112779 | Ga0501079_0112779_1343_2041 | 231 |
| 337 | 3300049742 | Ga0501080_0316647 | Ga0501080_0316647_149_853 | 231 |
| 338 | 3300049743 | Ga0501081_0005965 | Ga0501081_0005965_6403_7107 | 231 |
| 339 | 3300049743 | Ga0501081_0011068 | Ga0501081_0011068_2625_3323 | 231 |
| 340 | 3300049743 | Ga0501081_0117007 | Ga0501081_0117007_912_1616 | 231 |
| 341 | 3300049824 | Ga0501045_0035905 | Ga0501045_0035905_426_1124 | 231 |
| 342 | 3300049824 | Ga0501045_0165446 | Ga0501045_0165446_324_1028 | 231 |
| 343 | 3300053085 | Ga0495619_0013696 | Ga0495619_0013696_3720_4424 | 231 |
| 344 | 3300054114 | Ga0501084_0020964 | Ga0501084_0020964_2379_3083 | 231 |
| 345 | 3300054114 | Ga0501084_0032100 | Ga0501084_0032100_1167_1865 | 231 |
| 346 | 3300060353 | Ga0501082_0077754 | Ga0501082_0077754_86_784 | 231 |
| 347 | 3300060353 | Ga0501082_0141462 | Ga0501082_0141462_995_1699 | 231 |
| 348 | 3300061734 | Ga0530510_0059609 | Ga0530510_0059609_24_722 | 231 |
| 349 | iso_pu_bacteria | 2852680915 | 2852682627 | 231 |
| 350 | iso_pu_bacteria | 2937980651 | 2937982618 | 231 |
| 351 | 3300005338 | Ga0068868_100019864 | Ga0068868_1000198643 | 232 |
| 352 | 3300005355 | Ga0070671_100077222 | Ga0070671_1000772223 | 232 |
| 353 | 3300005364 | Ga0070673_100201978 | Ga0070673_1002019783 | 232 |
| 354 | 3300005364 | Ga0070673_100968301 | Ga0070673_1009683011 | 232 |
| 355 | 3300005544 | Ga0070686_100025610 | Ga0070686_1000256104 | 232 |
| 356 | 3300005618 | Ga0068864_100066286 | Ga0068864_1000662864 | 232 |
| 357 | 3300005983 | Ga0081540_1098829 | Ga0081540_10988292 | 232 |
| 358 | 3300006358 | Ga0068871_100049904 | Ga0068871_1000499044 | 232 |
| 359 | 3300006871 | Ga0075434_100072316 | Ga0075434_1000723165 | 232 |
| 360 | 3300009098 | Ga0105245_10012824 | Ga0105245_100128242 | 232 |
| 361 | 3300025927 | Ga0207687_10013570 | Ga0207687_100135702 | 232 |
| 362 | 3300025931 | Ga0207644_10056559 | Ga0207644_100565593 | 232 |
| 363 | 3300026023 | Ga0207677_10080172 | Ga0207677_100801722 | 232 |
| 364 | 3300026095 | Ga0207676_10048276 | Ga0207676_100482764 | 232 |
| 365 | 3300044712 | Ga0453684_0072417 | Ga0453684_0072417_1307_2062 | 232 |
| 366 | 3300049580 | Ga0501046_0000033 | Ga0501046_0000033_18351_19079 | 232 |
| 367 | 3300049586 | Ga0501070_0461617 | Ga0501070_0461617_271_981 | 232 |
| 368 | 3300049741 | Ga0501079_0402486 | Ga0501079_0402486_231_938 | 232 |
| 369 | 3300049822 | Ga0501035_0029884 | Ga0501035_0029884_3442_4152 | 232 |
| 370 | 3300001977 | JGI24746J21847_1011509 | JGI24746J21847_10115092 | 233 |
| 371 | 3300001990 | JGI24737J22298_10006157 | JGI24737J22298_100061572 | 233 |
| 372 | 3300002075 | JGI24738J21930_10014815 | JGI24738J21930_100148152 | 233 |
| 373 | 3300002239 | JGI24034J26672_10006184 | JGI24034J26672_100061842 | 233 |
| 374 | 3300005327 | Ga0070658_10028412 | Ga0070658_100284125 | 233 |
| 375 | 3300005329 | Ga0070683_100012785 | Ga0070683_1000127854 | 233 |
| 376 | 3300005330 | Ga0070690_100060095 | Ga0070690_1000600952 | 233 |
| 377 | 3300005331 | Ga0070670_100024711 | Ga0070670_1000247113 | 233 |
| 378 | 3300005333 | Ga0070677_10010859 | Ga0070677_100108594 | 233 |
| 379 | 3300005334 | Ga0068869_100077158 | Ga0068869_1000771583 | 233 |
| 380 | 3300005335 | Ga0070666_10001688 | Ga0070666_100016885 | 233 |
| 381 | 3300005336 | Ga0070680_100012436 | Ga0070680_1000124362 | 233 |
| 382 | 3300005337 | Ga0070682_100005303 | Ga0070682_1000053033 | 233 |
| 383 | 3300005338 | Ga0068868_100106201 | Ga0068868_1001062013 | 233 |
| 384 | 3300005339 | Ga0070660_100002943 | Ga0070660_10000294310 | 233 |
| 385 | 3300005340 | Ga0070689_100003122 | Ga0070689_10000312213 | 233 |
| 386 | 3300005341 | Ga0070691_10000070 | Ga0070691_1000007025 | 233 |
| 387 | 3300005343 | Ga0070687_100001000 | Ga0070687_1000010005 | 233 |
| 388 | 3300005344 | Ga0070661_100000668 | Ga0070661_10000066822 | 233 |
| 389 | 3300005345 | Ga0070692_10000024 | Ga0070692_100000245 | 233 |
| 390 | 3300005347 | Ga0070668_100001091 | Ga0070668_10000109125 | 233 |
| 391 | 3300005353 | Ga0070669_100003333 | Ga0070669_10000333311 | 233 |
| 392 | 3300005354 | Ga0070675_100001968 | Ga0070675_1000019684 | 233 |
| 393 | 3300005355 | Ga0070671_100026086 | Ga0070671_1000260864 | 233 |
| 394 | 3300005356 | Ga0070674_100004629 | Ga0070674_1000046296 | 233 |
| 395 | 3300005364 | Ga0070673_100005461 | Ga0070673_1000054615 | 233 |
| 396 | 3300005365 | Ga0070688_100002260 | Ga0070688_1000022604 | 233 |
| 397 | 3300005366 | Ga0070659_100002640 | Ga0070659_1000026404 | 233 |
| 398 | 3300005367 | Ga0070667_100001713 | Ga0070667_1000017132 | 233 |
| 399 | 3300005406 | Ga0070703_10054652 | Ga0070703_100546521 | 233 |
| 400 | 3300005434 | Ga0070709_10003174 | Ga0070709_100031746 | 233 |
| 401 | 3300005435 | Ga0070714_100023409 | Ga0070714_1000234093 | 233 |
| 402 | 3300005436 | Ga0070713_100019976 | Ga0070713_1000199763 | 233 |
| 403 | 3300005439 | Ga0070711_100000117 | Ga0070711_10000011734 | 233 |
| 404 | 3300005440 | Ga0070705_100000313 | Ga0070705_10000031328 | 233 |
| 405 | 3300005444 | Ga0070694_100000845 | Ga0070694_10000084515 | 233 |
| 406 | 3300005455 | Ga0070663_100001391 | Ga0070663_10000139110 | 233 |
| 407 | 3300005456 | Ga0070678_100000130 | Ga0070678_10000013028 | 233 |
| 408 | 3300005457 | Ga0070662_100004052 | Ga0070662_1000040526 | 233 |
| 409 | 3300005458 | Ga0070681_10638268 | Ga0070681_106382681 | 233 |
| 410 | 3300005459 | Ga0068867_100143690 | Ga0068867_1001436902 | 233 |
| 411 | 3300005466 | Ga0070685_10048639 | Ga0070685_100486392 | 233 |
| 412 | 3300005530 | Ga0070679_100206265 | Ga0070679_1002062652 | 233 |
| 413 | 3300005535 | Ga0070684_100021766 | Ga0070684_1000217662 | 233 |
| 414 | 3300005536 | Ga0070697_100001143 | Ga0070697_10000114312 | 233 |
| 415 | 3300005539 | Ga0068853_100004638 | Ga0068853_10000463812 | 233 |
| 416 | 3300005543 | Ga0070672_100002673 | Ga0070672_1000026734 | 233 |
| 417 | 3300005545 | Ga0070695_100001227 | Ga0070695_1000012279 | 233 |
| 418 | 3300005546 | Ga0070696_100005647 | Ga0070696_1000056473 | 233 |
| 419 | 3300005547 | Ga0070693_100000264 | Ga0070693_10000026413 | 233 |
| 420 | 3300005548 | Ga0070665_100228730 | Ga0070665_1002287303 | 233 |
| 421 | 3300005549 | Ga0070704_100066633 | Ga0070704_1000666334 | 233 |
| 422 | 3300005563 | Ga0068855_100005350 | Ga0068855_1000053503 | 233 |
| 423 | 3300005577 | Ga0068857_100002705 | Ga0068857_1000027055 | 233 |
| 424 | 3300005578 | Ga0068854_100019054 | Ga0068854_1000190544 | 233 |
| 425 | 3300005615 | Ga0070702_100001185 | Ga0070702_10000118512 | 233 |
| 426 | 3300005617 | Ga0068859_100012193 | Ga0068859_1000121935 | 233 |
| 427 | 3300005718 | Ga0068866_10008721 | Ga0068866_100087212 | 233 |
| 428 | 3300005719 | Ga0068861_100023306 | Ga0068861_1000233062 | 233 |
| 429 | 3300005834 | Ga0068851_10048337 | Ga0068851_100483372 | 233 |
| 430 | 3300005841 | Ga0068863_100003765 | Ga0068863_10000376514 | 233 |
| 431 | 3300005842 | Ga0068858_100026100 | Ga0068858_1000261002 | 233 |
| 432 | 3300005844 | Ga0068862_100027598 | Ga0068862_1000275985 | 233 |
| 433 | 3300005937 | Ga0081455_10055012 | Ga0081455_100550124 | 233 |
| 434 | 3300006163 | Ga0070715_10029967 | Ga0070715_100299672 | 233 |
| 435 | 3300006173 | Ga0070716_100000136 | Ga0070716_1000001363 | 233 |
| 436 | 3300006175 | Ga0070712_100003026 | Ga0070712_1000030267 | 233 |
| 437 | 3300006237 | Ga0097621_100054116 | Ga0097621_1000541164 | 233 |
| 438 | 3300006844 | Ga0075428_100242240 | Ga0075428_1002422403 | 233 |
| 439 | 3300006847 | Ga0075431_100031456 | Ga0075431_1000314562 | 233 |
| 440 | 3300006852 | Ga0075433_10059720 | Ga0075433_100597204 | 233 |
| 441 | 3300006880 | Ga0075429_100025308 | Ga0075429_1000253086 | 233 |
| 442 | 3300006881 | Ga0068865_100108244 | Ga0068865_1001082442 | 233 |
| 443 | 3300006914 | Ga0075436_100011629 | Ga0075436_1000116295 | 233 |
| 444 | 3300006931 | Ga0097620_100012193 | Ga0097620_1000121937 | 233 |
| 445 | 3300007076 | Ga0075435_100109185 | Ga0075435_1001091853 | 233 |
| 446 | 3300009092 | Ga0105250_10018971 | Ga0105250_100189712 | 233 |
| 447 | 3300009093 | Ga0105240_10020029 | Ga0105240_100200296 | 233 |
| 448 | 3300009094 | Ga0111539_10819853 | Ga0111539_108198532 | 233 |
| 449 | 3300009098 | Ga0105245_10008501 | Ga0105245_1000850114 | 233 |
| 450 | 3300009101 | Ga0105247_10000799 | Ga0105247_100007996 | 233 |
| 451 | 3300009147 | Ga0114129_10723021 | Ga0114129_107230212 | 233 |
| 452 | 3300009148 | Ga0105243_10015360 | Ga0105243_100153605 | 233 |
| 453 | 3300009174 | Ga0105241_10000626 | Ga0105241_1000062620 | 233 |
| 454 | 3300009176 | Ga0105242_10001227 | Ga0105242_1000122725 | 233 |
| 455 | 3300009177 | Ga0105248_10007144 | Ga0105248_1000714411 | 233 |
| 456 | 3300009545 | Ga0105237_10000914 | Ga0105237_100009148 | 233 |
| 457 | 3300009551 | Ga0105238_10089930 | Ga0105238_100899302 | 233 |
| 458 | 3300009553 | Ga0105249_10010997 | Ga0105249_100109975 | 233 |
| 459 | 3300010375 | Ga0105239_10010452 | Ga0105239_100104527 | 233 |
| 460 | 3300011119 | Ga0105246_10000610 | Ga0105246_1000061021 | 233 |
| 461 | 3300013100 | Ga0157373_10040703 | Ga0157373_100407033 | 233 |
| 462 | 3300013102 | Ga0157371_10042262 | Ga0157371_100422622 | 233 |
| 463 | 3300013105 | Ga0157369_10003587 | Ga0157369_1000358711 | 233 |
| 464 | 3300013296 | Ga0157374_10001990 | Ga0157374_100019904 | 233 |
| 465 | 3300013297 | Ga0157378_10001108 | Ga0157378_100011086 | 233 |
| 466 | 3300013306 | Ga0163162_10003707 | Ga0163162_1000370716 | 233 |
| 467 | 3300013307 | Ga0157372_10017151 | Ga0157372_100171515 | 233 |
| 468 | 3300013308 | Ga0157375_10159662 | Ga0157375_101596621 | 233 |
| 469 | 3300014326 | Ga0157380_10014827 | Ga0157380_100148274 | 233 |
| 470 | 3300014326 | Ga0157380_10230765 | Ga0157380_102307652 | 233 |
| 471 | 3300014745 | Ga0157377_10005353 | Ga0157377_100053533 | 233 |
| 472 | 3300014968 | Ga0157379_10005061 | Ga0157379_1000506115 | 233 |
| 473 | 3300014969 | Ga0157376_10007270 | Ga0157376_100072708 | 233 |
| 474 | 3300017792 | Ga0163161_10003299 | Ga0163161_1000329912 | 233 |
| 475 | 3300025885 | Ga0207653_10015748 | Ga0207653_100157482 | 233 |
| 476 | 3300025893 | Ga0207682_10018183 | Ga0207682_100181834 | 233 |
| 477 | 3300025898 | Ga0207692_10004280 | Ga0207692_100042803 | 233 |
| 478 | 3300025899 | Ga0207642_10008573 | Ga0207642_100085734 | 233 |
| 479 | 3300025900 | Ga0207710_10002843 | Ga0207710_100028435 | 233 |
| 480 | 3300025901 | Ga0207688_10002766 | Ga0207688_100027663 | 233 |
| 481 | 3300025903 | Ga0207680_10004688 | Ga0207680_100046882 | 233 |
| 482 | 3300025904 | Ga0207647_10017058 | Ga0207647_100170585 | 233 |
| 483 | 3300025906 | Ga0207699_10000734 | Ga0207699_1000073416 | 233 |
| 484 | 3300025911 | Ga0207654_10024995 | Ga0207654_100249953 | 233 |
| 485 | 3300025912 | Ga0207707_10510287 | Ga0207707_105102872 | 233 |
| 486 | 3300025913 | Ga0207695_10033960 | Ga0207695_100339603 | 233 |
| 487 | 3300025914 | Ga0207671_10106264 | Ga0207671_101062643 | 233 |
| 488 | 3300025915 | Ga0207693_10003855 | Ga0207693_100038556 | 233 |
| 489 | 3300025916 | Ga0207663_10013874 | Ga0207663_100138744 | 233 |
| 490 | 3300025918 | Ga0207662_10002913 | Ga0207662_100029134 | 233 |
| 491 | 3300025919 | Ga0207657_10000347 | Ga0207657_1000034725 | 233 |
| 492 | 3300025921 | Ga0207652_10393602 | Ga0207652_103936022 | 233 |
| 493 | 3300025922 | Ga0207646_10279574 | Ga0207646_102795741 | 233 |
| 494 | 3300025923 | Ga0207681_10020111 | Ga0207681_100201115 | 233 |
| 495 | 3300025924 | Ga0207694_10077292 | Ga0207694_100772922 | 233 |
| 496 | 3300025925 | Ga0207650_10009110 | Ga0207650_100091105 | 233 |
| 497 | 3300025926 | Ga0207659_10032390 | Ga0207659_100323902 | 233 |
| 498 | 3300025929 | Ga0207664_10020281 | Ga0207664_100202813 | 233 |
| 499 | 3300025931 | Ga0207644_10028609 | Ga0207644_100286092 | 233 |
| 500 | 3300025932 | Ga0207690_10020812 | Ga0207690_100208122 | 233 |
| 501 | 3300025933 | Ga0207706_10000441 | Ga0207706_1000044139 | 233 |
| 502 | 3300025935 | Ga0207709_10030534 | Ga0207709_100305342 | 233 |
| 503 | 3300025936 | Ga0207670_10008141 | Ga0207670_100081416 | 233 |
| 504 | 3300025937 | Ga0207669_10068181 | Ga0207669_100681812 | 233 |
| 505 | 3300025938 | Ga0207704_10375054 | Ga0207704_103750541 | 233 |
| 506 | 3300025939 | Ga0207665_10000533 | Ga0207665_1000053322 | 233 |
| 507 | 3300025940 | Ga0207691_10001403 | Ga0207691_1000140319 | 233 |
| 508 | 3300025941 | Ga0207711_10013750 | Ga0207711_100137503 | 233 |
| 509 | 3300025942 | Ga0207689_10095073 | Ga0207689_100950733 | 233 |
| 510 | 3300025944 | Ga0207661_10031344 | Ga0207661_100313444 | 233 |
| 511 | 3300025945 | Ga0207679_10021428 | Ga0207679_100214284 | 233 |
| 512 | 3300025949 | Ga0207667_10045455 | Ga0207667_100454555 | 233 |
| 513 | 3300025960 | Ga0207651_10606704 | Ga0207651_106067041 | 233 |
| 514 | 3300025961 | Ga0207712_10006640 | Ga0207712_100066403 | 233 |
| 515 | 3300025972 | Ga0207668_10020070 | Ga0207668_100200701 | 233 |
| 516 | 3300025981 | Ga0207640_10025974 | Ga0207640_100259744 | 233 |
| 517 | 3300026023 | Ga0207677_10102986 | Ga0207677_101029862 | 233 |
| 518 | 3300026035 | Ga0207703_10053726 | Ga0207703_100537263 | 233 |
| 519 | 3300026041 | Ga0207639_10010547 | Ga0207639_100105472 | 233 |
| 520 | 3300026067 | Ga0207678_10000371 | Ga0207678_1000037134 | 233 |
| 521 | 3300026075 | Ga0207708_10000444 | Ga0207708_1000044430 | 233 |
| 522 | 3300026078 | Ga0207702_10031560 | Ga0207702_100315604 | 233 |
| 523 | 3300026088 | Ga0207641_10017511 | Ga0207641_100175115 | 233 |
| 524 | 3300026089 | Ga0207648_10019567 | Ga0207648_100195673 | 233 |
| 525 | 3300026095 | Ga0207676_10051185 | Ga0207676_100511851 | 233 |
| 526 | 3300026116 | Ga0207674_10001576 | Ga0207674_1000157616 | 233 |
| 527 | 3300026118 | Ga0207675_100000203 | Ga0207675_10000020333 | 233 |
| 528 | 3300026121 | Ga0207683_10000221 | Ga0207683_1000022125 | 233 |
| 529 | 3300028379 | Ga0268266_10202436 | Ga0268266_102024363 | 233 |
| 530 | 3300028380 | Ga0268265_10025408 | Ga0268265_100254083 | 233 |
| 531 | 3300028381 | Ga0268264_10027808 | Ga0268264_100278082 | 233 |
| 532 | 3300034818 | Ga0373950_0005613 | Ga0373950_0005613_721_1425 | 233 |
| 533 | 3300035112 | Ga0373932_0002892 | Ga0373932_0002892_3044_3748 | 233 |
| 534 | 3300035121 | Ga0373960_0018279 | Ga0373960_0018279_312_1016 | 233 |
| 535 | 3300035691 | Ga0373931_0008322 | Ga0373931_0008322_3214_3918 | 233 |
| 536 | 3300037418 | Ga0395900_0067581 | Ga0395900_0067581_1750_2454 | 233 |
| 537 | 3300037471 | Ga0395905_0017970 | Ga0395905_0017970_2180_2884 | 233 |
| 538 | 3300038443 | Ga0395901_0014587 | Ga0395901_0014587_1663_2367 | 233 |
| 539 | 3300048903 | Ga0496100_0111987 | Ga0496100_0111987_757_1461 | 233 |
| 540 | 3300048904 | Ga0496101_0021025 | Ga0496101_0021025_870_1574 | 233 |
| 541 | 3300048905 | Ga0496102_0203018 | Ga0496102_0203018_437_1141 | 233 |
| 542 | 3300048906 | Ga0496103_0161843 | Ga0496103_0161843_295_999 | 233 |
| 543 | 3300048907 | Ga0496104_0022464 | Ga0496104_0022464_1776_2480 | 233 |
| 544 | 3300048908 | Ga0496105_0024045 | Ga0496105_0024045_221_925 | 233 |
| 545 | 3300048909 | Ga0496106_0127115 | Ga0496106_0127115_423_1127 | 233 |
| 546 | 3300048911 | Ga0496108_0048752 | Ga0496108_0048752_2401_3105 | 233 |
| 547 | 3300048911 | Ga0496108_0092011 | Ga0496108_0092011_221_925 | 233 |
| 548 | 3300048912 | Ga0496109_0296106 | Ga0496109_0296106_728_1432 | 233 |
| 549 | 3300048913 | Ga0496110_0009334 | Ga0496110_0009334_600_1304 | 233 |
| 550 | 3300048914 | Ga0496111_0021769 | Ga0496111_0021769_423_1127 | 233 |
| 551 | 3300048915 | Ga0496112_0005800 | Ga0496112_0005800_3677_4381 | 233 |
| 552 | 3300048915 | Ga0496112_0049894 | Ga0496112_0049894_2401_3105 | 233 |
| 553 | 3300048916 | Ga0496113_0008633 | Ga0496113_0008633_4024_4728 | 233 |
| 554 | 3300048917 | Ga0496114_0021787 | Ga0496114_0021787_3912_4616 | 233 |
| 555 | 3300048918 | Ga0496115_0091962 | Ga0496115_0091962_94_798 | 233 |
| 556 | 3300049574 | Ga0501038_0196821 | Ga0501038_0196821_539_1243 | 233 |
| 557 | 3300049576 | Ga0501040_0006012 | Ga0501040_0006012_404_1108 | 233 |
| 558 | 3300049579 | Ga0501043_0074314 | Ga0501043_0074314_1404_2108 | 233 |
| 559 | 3300049580 | Ga0501046_0144071 | Ga0501046_0144071_65_769 | 233 |
| 560 | 3300049582 | Ga0501048_0031328 | Ga0501048_0031328_2631_3335 | 233 |
| 561 | 3300049588 | Ga0501072_0030772 | Ga0501072_0030772_196_900 | 233 |
| 562 | 3300049589 | Ga0501073_0128210 | Ga0501073_0128210_645_1349 | 233 |
| 563 | 3300049590 | Ga0501074_0060955 | Ga0501074_0060955_1317_2021 | 233 |
| 564 | 3300049592 | Ga0501076_0047848 | Ga0501076_0047848_592_1296 | 233 |
| 565 | 3300049593 | Ga0501077_0102213 | Ga0501077_0102213_96_800 | 233 |
| 566 | 3300049741 | Ga0501079_0176670 | Ga0501079_0176670_122_826 | 233 |
| 567 | 3300049743 | Ga0501081_0099027 | Ga0501081_0099027_862_1566 | 233 |
| 568 | 3300050508 | nmdc:mga09592_131361_c1 | nmdc:mga09592_131361_c1_374_1078 | 233 |
| 569 | 3300050510 | nmdc:mga06r32_78872_c1 | nmdc:mga06r32_78872_c1_45_749 | 233 |
| 570 | 3300050511 | nmdc:mga08y16_127183_c1 | nmdc:mga08y16_127183_c1_1069_1773 | 233 |
| 571 | 3300050512 | nmdc:mga0n895_189356_c1 | nmdc:mga0n895_189356_c1_747_1451 | 233 |
| 572 | 3300050513 | nmdc:mga0rr50_20821_c1 | nmdc:mga0rr50_20821_c1_866_1570 | 233 |
| 573 | 3300050515 | nmdc:mga0a205_249275_c1 | nmdc:mga0a205_249275_c1_838_1542 | 233 |
| 574 | 3300053087 | Ga0500643_008114 | Ga0500643_008114_991_1713 | 233 |
| 575 | 3300054114 | Ga0501084_0055882 | Ga0501084_0055882_342_1046 | 233 |
| 576 | 3300054114 | Ga0501084_0351475 | Ga0501084_0351475_76_786 | 233 |
| 577 | 3300054114 | Ga0501084_0821507 | Ga0501084_0821507_53_763 | 233 |
| 578 | 3300060353 | Ga0501082_0057130 | Ga0501082_0057130_1914_2618 | 233 |
| 579 | 3300005337 | Ga0070682_100126816 | Ga0070682_1001268162 | 234 |
| 580 | 3300005545 | Ga0070695_100396804 | Ga0070695_1003968042 | 234 |
| 581 | 3300003781 | Ga0055536_1006426 | Ga0055536_10064262 | 235 |
| 582 | 3300003791 | Ga0055530_10000522 | Ga0055530_1000052232 | 235 |
| 583 | 3300003794 | Ga0055531_10005448 | Ga0055531_100054487 | 235 |
| 584 | 3300005456 | Ga0070678_100029766 | Ga0070678_1000297664 | 235 |
| 585 | 3300005563 | Ga0068855_100024228 | Ga0068855_1000242286 | 235 |
| 586 | 3300006038 | Ga0075365_10082476 | Ga0075365_100824762 | 235 |
| 587 | 3300006195 | Ga0075366_10001911 | Ga0075366_100019114 | 235 |
| 588 | 3300006195 | Ga0075366_10260752 | Ga0075366_102607522 | 235 |
| 589 | 3300009147 | Ga0114129_10349864 | Ga0114129_103498641 | 235 |
| 590 | 3300011119 | Ga0105246_10001156 | Ga0105246_100011568 | 235 |
| 591 | 3300025291 | Ga0209675_1000838 | Ga0209675_100083816 | 235 |
| 592 | 3300025292 | Ga0209676_1001387 | Ga0209676_100138719 | 235 |
| 593 | 3300025298 | Ga0209050_1000017 | Ga0209050_100001773 | 235 |
| 594 | 3300025304 | Ga0209257_1001118 | Ga0209257_100111835 | 235 |
| 595 | 3300025933 | Ga0207706_10002879 | Ga0207706_1000287917 | 235 |
| 596 | 3300025949 | Ga0207667_10063290 | Ga0207667_100632902 | 235 |
| 597 | 3300026121 | Ga0207683_10400755 | Ga0207683_104007552 | 235 |
| 598 | 3300031456 | Ga0307513_10128762 | Ga0307513_101287624 | 235 |
| 599 | 3300032004 | Ga0307414_10178573 | Ga0307414_101785732 | 235 |
| 600 | 3300046460 | Ga0495638_0180574 | Ga0495638_0180574_80_796 | 235 |
| 601 | 3300049589 | Ga0501073_0255101 | Ga0501073_0255101_311_1024 | 235 |
| 602 | 3300050492 | nmdc:mga0yw44_59240_c1 | nmdc:mga0yw44_59240_c1_1247_1987 | 235 |
| 603 | 3300050516 | nmdc:mga0sz30_85908_c1 | nmdc:mga0sz30_85908_c1_271_987 | 235 |
| 604 | 3300053090 | Ga0500646_0132432 | Ga0500646_0132432_15_731 | 235 |
| 605 | 3300053117 | Ga0500593_000443 | Ga0500593_000443_14016_14735 | 235 |
| 606 | 3300005434 | Ga0070709_10012916 | Ga0070709_100129164 | 236 |
| 607 | 3300005536 | Ga0070697_100542921 | Ga0070697_1005429211 | 236 |
| 608 | 3300025298 | Ga0209050_1004877 | Ga0209050_10048773 | 236 |
| 609 | 3300025933 | Ga0207706_10509368 | Ga0207706_105093682 | 236 |
| 610 | 3300035111 | Ga0373923_0106647 | Ga0373923_0106647_25_744 | 236 |
| 611 | 3300035118 | Ga0373954_0053889 | Ga0373954_0053889_376_1095 | 236 |
| 612 | 3300035119 | Ga0373956_0062578 | Ga0373956_0062578_440_1159 | 236 |
| 613 | 3300036401 | Ga0373937_0038800 | Ga0373937_0038800_1916_2635 | 236 |
| 614 | 3300046516 | Ga0495628_0131467 | Ga0495628_0131467_1159_1878 | 236 |
| 615 | 3300046660 | Ga0495625_0000553 | Ga0495625_0000553_31094_31804 | 236 |
| 616 | 3300048904 | Ga0496101_0033374 | Ga0496101_0033374_293_1042 | 236 |
| 617 | 3300048906 | Ga0496103_0152437 | Ga0496103_0152437_262_1011 | 236 |
| 618 | 3300048910 | Ga0496107_0100260 | Ga0496107_0100260_418_1167 | 236 |
| 619 | 3300053077 | Ga0495601_0149578 | Ga0495601_0149578_418_1137 | 236 |
| 620 | 3300053084 | Ga0495595_0114175 | Ga0495595_0114175_61_780 | 236 |
| 621 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_72586_73308 | 236 |
| 622 | iso_pu_bacteria | 2599185354 | 2600202679 | 236 |
| 623 | iso_pu_bacteria | 2751185897 | 2753764463 | 236 |
| 624 | 3300021388 | Ga0213875_10005479 | Ga0213875_100054795 | 237 |
| 625 | 3300037853 | Ga0436364_0979303 | Ga0436364_0979303_35637_36362 | 237 |
| 626 | 3300046522 | Ga0495643_0075187 | Ga0495643_0075187_1006_1746 | 237 |
| 627 | 3300005441 | Ga0070700_100207674 | Ga0070700_1002076742 | 238 |
| 628 | 3300005548 | Ga0070665_100012076 | Ga0070665_1000120764 | 238 |
| 629 | 3300006175 | Ga0070712_100103266 | Ga0070712_1001032663 | 238 |
| 630 | 3300025941 | Ga0207711_10146220 | Ga0207711_101462203 | 239 |
| 631 | 3300028379 | Ga0268266_10001370 | Ga0268266_100013707 | 239 |
| 632 | 3300039437 | Ga0436365_0789836 | Ga0436365_0789836_13_747 | 239 |
| 633 | iso_pu_bacteria | 2643221563 | 2643836364 | 239 |
| 634 | iso_pu_bacteria | 2643221608 | 2644052840 | 239 |
| 635 | iso_pu_bacteria | 2919709256 | 2919712121 | 239 |
| 636 | 3300001990 | JGI24737J22298_10006332 | JGI24737J22298_100063323 | 240 |
| 637 | 3300005328 | Ga0070676_10045792 | Ga0070676_100457922 | 240 |
| 638 | 3300005343 | Ga0070687_100448485 | Ga0070687_1004484852 | 240 |
| 639 | 3300005354 | Ga0070675_100100760 | Ga0070675_1001007603 | 240 |
| 640 | 3300005356 | Ga0070674_100009057 | Ga0070674_1000090576 | 240 |
| 641 | 3300005356 | Ga0070674_100257880 | Ga0070674_1002578802 | 240 |
| 642 | 3300005366 | Ga0070659_100427745 | Ga0070659_1004277452 | 240 |
| 643 | 3300005456 | Ga0070678_100007175 | Ga0070678_1000071757 | 240 |
| 644 | 3300005458 | Ga0070681_10035084 | Ga0070681_100350843 | 240 |
| 645 | 3300005548 | Ga0070665_100002389 | Ga0070665_1000023899 | 240 |
| 646 | 3300006195 | Ga0075366_10012251 | Ga0075366_100122514 | 240 |
| 647 | 3300009148 | Ga0105243_10000038 | Ga0105243_1000003825 | 240 |
| 648 | 3300011119 | Ga0105246_10390621 | Ga0105246_103906212 | 240 |
| 649 | 3300013102 | Ga0157371_10200889 | Ga0157371_102008893 | 240 |
| 650 | 3300013104 | Ga0157370_10607000 | Ga0157370_106070002 | 240 |
| 651 | 3300025907 | Ga0207645_10059441 | Ga0207645_100594412 | 240 |
| 652 | 3300025909 | Ga0207705_10003758 | Ga0207705_100037583 | 240 |
| 653 | 3300025931 | Ga0207644_10011172 | Ga0207644_100111726 | 240 |
| 654 | 3300025932 | Ga0207690_10031983 | Ga0207690_100319834 | 240 |
| 655 | 3300025933 | Ga0207706_10219030 | Ga0207706_102190303 | 240 |
| 656 | 3300025935 | Ga0207709_10000031 | Ga0207709_10000031258 | 240 |
| 657 | 3300025937 | Ga0207669_10000057 | Ga0207669_1000005749 | 240 |
| 658 | 3300025960 | Ga0207651_10014429 | Ga0207651_100144295 | 240 |
| 659 | 3300025986 | Ga0207658_10568958 | Ga0207658_105689582 | 240 |
| 660 | 3300026041 | Ga0207639_10022775 | Ga0207639_100227755 | 240 |
| 661 | 3300026088 | Ga0207641_10156085 | Ga0207641_101560852 | 240 |
| 662 | 3300028379 | Ga0268266_10000457 | Ga0268266_1000045742 | 240 |
| 663 | 3300028786 | Ga0307517_10042818 | Ga0307517_100428184 | 240 |
| 664 | 3300031824 | Ga0307413_10001504 | Ga0307413_1000150410 | 240 |
| 665 | 3300031903 | Ga0307407_10091734 | Ga0307407_100917342 | 240 |
| 666 | 3300032002 | Ga0307416_100214883 | Ga0307416_1002148833 | 240 |
| 667 | 3300032002 | Ga0307416_100300820 | Ga0307416_1003008202 | 240 |
| 668 | 3300032004 | Ga0307414_10173781 | Ga0307414_101737812 | 240 |
| 669 | 3300032005 | Ga0307411_10027478 | Ga0307411_100274782 | 240 |
| 670 | 3300032005 | Ga0307411_10193337 | Ga0307411_101933372 | 240 |
| 671 | 3300032126 | Ga0307415_100249546 | Ga0307415_1002495461 | 240 |
| 672 | 3300037418 | Ga0395900_0099409 | Ga0395900_0099409_2208_2942 | 240 |
| 673 | 3300041443 | Ga0451789_1348687 | Ga0451789_1348687_147_881 | 240 |
| 674 | 3300041459 | Ga0451800_1091503 | Ga0451800_1091503_117_845 | 240 |
| 675 | 3300046471 | Ga0495650_0000492 | Ga0495650_0000492_34270_35001 | 240 |
| 676 | 3300046492 | Ga0495585_0014575 | Ga0495585_0014575_2167_2898 | 240 |
| 677 | 3300046506 | Ga0495583_0000138 | Ga0495583_0000138_68383_69111 | 240 |
| 678 | 3300046522 | Ga0495643_0001928 | Ga0495643_0001928_3731_4462 | 240 |
| 679 | 3300046524 | Ga0495648_0004646 | Ga0495648_0004646_9673_10404 | 240 |
| 680 | 3300046536 | Ga0495587_0149570 | Ga0495587_0149570_550_1281 | 240 |
| 681 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_75566_76297 | 240 |
| 682 | 3300046684 | Ga0495669_0008207 | Ga0495669_0008207_1457_2221 | 240 |
| 683 | 3300046809 | Ga0495600_0000641 | Ga0495600_0000641_909_1640 | 240 |
| 684 | 3300048904 | Ga0496101_0084240 | Ga0496101_0084240_73_813 | 240 |
| 685 | 3300048913 | Ga0496110_0064083 | Ga0496110_0064083_1131_1871 | 240 |
| 686 | 3300048915 | Ga0496112_0016155 | Ga0496112_0016155_1800_2540 | 240 |
| 687 | 3300048915 | Ga0496112_0040197 | Ga0496112_0040197_91_831 | 240 |
| 688 | 3300048916 | Ga0496113_0237603 | Ga0496113_0237603_90_830 | 240 |
| 689 | 3300049460 | Ga0495682_0020538 | Ga0495682_0020538_490_1218 | 240 |
| 690 | 3300053103 | Ga0500555_000408 | Ga0500555_000408_14966_15694 | 240 |
| 691 | 3300053739 | Ga0500587_000386 | Ga0500587_000386_1032_1766 | 240 |
| 692 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006335 | 241 |
| 693 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011491 | 241 |
| 694 | 3300025914 | Ga0207671_10006068 | Ga0207671_100060687 | 241 |
| 695 | 3300005333 | Ga0070677_10000238 | Ga0070677_1000023816 | 242 |
| 696 | 3300005347 | Ga0070668_100000068 | Ga0070668_10000006841 | 242 |
| 697 | 3300005355 | Ga0070671_100001553 | Ga0070671_10000155320 | 242 |
| 698 | 3300005548 | Ga0070665_100000535 | Ga0070665_10000053515 | 242 |
| 699 | 3300005548 | Ga0070665_100335667 | Ga0070665_1003356672 | 242 |
| 700 | 3300005617 | Ga0068859_100005823 | Ga0068859_10000582320 | 242 |
| 701 | 3300005841 | Ga0068863_100000001 | Ga0068863_100000001203 | 242 |
| 702 | 3300005843 | Ga0068860_100247972 | Ga0068860_1002479723 | 242 |
| 703 | 3300005844 | Ga0068862_100115373 | Ga0068862_1001153733 | 242 |
| 704 | 3300006931 | Ga0097620_100005823 | Ga0097620_10000582320 | 242 |
| 705 | 3300025931 | Ga0207644_10000544 | Ga0207644_1000054410 | 242 |
| 706 | 3300025972 | Ga0207668_10000056 | Ga0207668_10000056103 | 242 |
| 707 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001540 | 242 |
| 708 | 3300028380 | Ga0268265_10105545 | Ga0268265_101055453 | 242 |
| 709 | 3300028381 | Ga0268264_10018445 | Ga0268264_100184453 | 242 |
| 710 | 3300001904 | JGI24736J21556_1001434 | JGI24736J21556_10014342 | 243 |
| 711 | 3300001915 | JGI24741J21665_1000020 | JGI24741J21665_10000205 | 243 |
| 712 | 3300001976 | JGI24752J21851_1002297 | JGI24752J21851_10022972 | 243 |
| 713 | 3300001979 | JGI24740J21852_10009521 | JGI24740J21852_100095212 | 243 |
| 714 | 3300001989 | JGI24739J22299_10001733 | JGI24739J22299_100017336 | 243 |
| 715 | 3300001990 | JGI24737J22298_10002227 | JGI24737J22298_100022277 | 243 |
| 716 | 3300002075 | JGI24738J21930_10000749 | JGI24738J21930_100007495 | 243 |
| 717 | 3300002076 | JGI24749J21850_1000037 | JGI24749J21850_100003720 | 243 |
| 718 | 3300005289 | Ga0065704_10077887 | Ga0065704_100778873 | 243 |
| 719 | 3300005289 | Ga0065704_10101542 | Ga0065704_101015423 | 243 |
| 720 | 3300005331 | Ga0070670_100000792 | Ga0070670_10000079220 | 243 |
| 721 | 3300005339 | Ga0070660_100268274 | Ga0070660_1002682742 | 243 |
| 722 | 3300005344 | Ga0070661_100000697 | Ga0070661_10000069725 | 243 |
| 723 | 3300005367 | Ga0070667_100000290 | Ga0070667_10000029017 | 243 |
| 724 | 3300005367 | Ga0070667_100000480 | Ga0070667_10000048022 | 243 |
| 725 | 3300005455 | Ga0070663_100040898 | Ga0070663_1000408983 | 243 |
| 726 | 3300005457 | Ga0070662_100344142 | Ga0070662_1003441422 | 243 |
| 727 | 3300005539 | Ga0068853_100175392 | Ga0068853_1001753922 | 243 |
| 728 | 3300005539 | Ga0068853_100680149 | Ga0068853_1006801491 | 243 |
| 729 | 3300005544 | Ga0070686_100001769 | Ga0070686_1000017698 | 243 |
| 730 | 3300005563 | Ga0068855_100290513 | Ga0068855_1002905132 | 243 |
| 731 | 3300005577 | Ga0068857_100736301 | Ga0068857_1007363012 | 243 |
| 732 | 3300005614 | Ga0068856_100008926 | Ga0068856_1000089268 | 243 |
| 733 | 3300005616 | Ga0068852_100182067 | Ga0068852_1001820673 | 243 |
| 734 | 3300005617 | Ga0068859_100030808 | Ga0068859_1000308084 | 243 |
| 735 | 3300005618 | Ga0068864_100000063 | Ga0068864_10000006357 | 243 |
| 736 | 3300005618 | Ga0068864_100491146 | Ga0068864_1004911462 | 243 |
| 737 | 3300005834 | Ga0068851_10056413 | Ga0068851_100564134 | 243 |
| 738 | 3300005841 | Ga0068863_100000062 | Ga0068863_10000006257 | 243 |
| 739 | 3300005841 | Ga0068863_100017272 | Ga0068863_1000172723 | 243 |
| 740 | 3300005844 | Ga0068862_100000069 | Ga0068862_10000006960 | 243 |
| 741 | 3300006195 | Ga0075366_10141343 | Ga0075366_101413431 | 243 |
| 742 | 3300006931 | Ga0097620_100030807 | Ga0097620_1000308074 | 243 |
| 743 | 3300009011 | Ga0105251_10001006 | Ga0105251_1000100611 | 243 |
| 744 | 3300009101 | Ga0105247_10054565 | Ga0105247_100545652 | 243 |
| 745 | 3300009147 | Ga0114129_10179394 | Ga0114129_101793944 | 243 |
| 746 | 3300009174 | Ga0105241_10000478 | Ga0105241_100004783 | 243 |
| 747 | 3300009177 | Ga0105248_10000536 | Ga0105248_1000053634 | 243 |
| 748 | 3300009545 | Ga0105237_10075553 | Ga0105237_100755535 | 243 |
| 749 | 3300009545 | Ga0105237_10271370 | Ga0105237_102713703 | 243 |
| 750 | 3300009553 | Ga0105249_10000160 | Ga0105249_1000016053 | 243 |
| 751 | 3300009553 | Ga0105249_10243157 | Ga0105249_102431573 | 243 |
| 752 | 3300009978 | Ga0105148_100750 | Ga0105148_1007505 | 243 |
| 753 | 3300013100 | Ga0157373_10035437 | Ga0157373_100354373 | 243 |
| 754 | 3300013105 | Ga0157369_10006519 | Ga0157369_1000651912 | 243 |
| 755 | 3300013306 | Ga0163162_10019223 | Ga0163162_100192233 | 243 |
| 756 | 3300014325 | Ga0163163_10043887 | Ga0163163_100438876 | 243 |
| 757 | 3300014326 | Ga0157380_10000217 | Ga0157380_1000021710 | 243 |
| 758 | 3300014968 | Ga0157379_10060843 | Ga0157379_100608433 | 243 |
| 759 | 3300017792 | Ga0163161_10008607 | Ga0163161_100086075 | 243 |
| 760 | 3300020070 | Ga0206356_10071980 | Ga0206356_100719803 | 243 |
| 761 | 3300025229 | Ga0209147_100735 | Ga0209147_1007358 | 243 |
| 762 | 3300025304 | Ga0209257_1008283 | Ga0209257_10082838 | 243 |
| 763 | 3300025321 | Ga0207656_10049493 | Ga0207656_100494933 | 243 |
| 764 | 3300025735 | Ga0207713_1017945 | Ga0207713_10179453 | 243 |
| 765 | 3300025904 | Ga0207647_10023940 | Ga0207647_100239402 | 243 |
| 766 | 3300025909 | Ga0207705_10054556 | Ga0207705_100545563 | 243 |
| 767 | 3300025911 | Ga0207654_10249204 | Ga0207654_102492042 | 243 |
| 768 | 3300025914 | Ga0207671_10021469 | Ga0207671_100214694 | 243 |
| 769 | 3300025918 | Ga0207662_10053984 | Ga0207662_100539844 | 243 |
| 770 | 3300025919 | Ga0207657_10031188 | Ga0207657_100311886 | 243 |
| 771 | 3300025924 | Ga0207694_10034937 | Ga0207694_100349374 | 243 |
| 772 | 3300025925 | Ga0207650_10000986 | Ga0207650_1000098612 | 243 |
| 773 | 3300025931 | Ga0207644_10150615 | Ga0207644_101506153 | 243 |
| 774 | 3300025933 | Ga0207706_10163068 | Ga0207706_101630682 | 243 |
| 775 | 3300025941 | Ga0207711_10000017 | Ga0207711_10000017423 | 243 |
| 776 | 3300025945 | Ga0207679_10223257 | Ga0207679_102232573 | 243 |
| 777 | 3300025961 | Ga0207712_10000222 | Ga0207712_1000022236 | 243 |
| 778 | 3300025981 | Ga0207640_10032087 | Ga0207640_100320873 | 243 |
| 779 | 3300025986 | Ga0207658_10000133 | Ga0207658_1000013335 | 243 |
| 780 | 3300025986 | Ga0207658_10003592 | Ga0207658_1000359213 | 243 |
| 781 | 3300026041 | Ga0207639_10009135 | Ga0207639_100091353 | 243 |
| 782 | 3300026041 | Ga0207639_10424020 | Ga0207639_104240202 | 243 |
| 783 | 3300026067 | Ga0207678_10000271 | Ga0207678_1000027136 | 243 |
| 784 | 3300026078 | Ga0207702_10002479 | Ga0207702_100024796 | 243 |
| 785 | 3300026088 | Ga0207641_10000022 | Ga0207641_10000022170 | 243 |
| 786 | 3300026095 | Ga0207676_10000056 | Ga0207676_1000005685 | 243 |
| 787 | 3300026142 | Ga0207698_10006086 | Ga0207698_100060863 | 243 |
| 788 | 3300028380 | Ga0268265_10000044 | Ga0268265_10000044153 | 243 |
| 789 | 3300031548 | Ga0307408_100026409 | Ga0307408_1000264093 | 243 |
| 790 | 3300031731 | Ga0307405_10045074 | Ga0307405_100450744 | 243 |
| 791 | 3300031911 | Ga0307412_10388292 | Ga0307412_103882922 | 243 |
| 792 | 3300032002 | Ga0307416_100112109 | Ga0307416_1001121095 | 243 |
| 793 | 3300032004 | Ga0307414_10409363 | Ga0307414_104093632 | 243 |
| 794 | 3300032126 | Ga0307415_100347879 | Ga0307415_1003478792 | 243 |
| 795 | 3300039437 | Ga0436365_1355696 | Ga0436365_1355696_1156_1911 | 243 |
| 796 | 3300039450 | Ga0436363_1066328 | Ga0436363_1066328_194_940 | 243 |
| 797 | 3300046453 | Ga0495627_000167 | Ga0495627_000167_48945_49682 | 243 |
| 798 | 3300046460 | Ga0495638_0000011 | Ga0495638_0000011_70536_71273 | 243 |
| 799 | 3300046506 | Ga0495583_0000251 | Ga0495583_0000251_70007_70744 | 243 |
| 800 | 3300046519 | Ga0495632_0000938 | Ga0495632_0000938_4045_4782 | 243 |
| 801 | 3300046524 | Ga0495648_0000036 | Ga0495648_0000036_70390_71127 | 243 |
| 802 | 3300046692 | Ga0495671_0000054 | Ga0495671_0000054_70026_70763 | 243 |
| 803 | 3300047469 | Ga0495673_0000158 | Ga0495673_0000158_70263_71000 | 243 |
| 804 | 3300047469 | Ga0495673_0027162 | Ga0495673_0027162_1059_1796 | 243 |
| 805 | 3300048907 | Ga0496104_0114913 | Ga0496104_0114913_783_1523 | 243 |
| 806 | 3300048908 | Ga0496105_0011723 | Ga0496105_0011723_2942_3682 | 243 |
| 807 | 3300048911 | Ga0496108_0713479 | Ga0496108_0713479_62_814 | 243 |
| 808 | 3300048912 | Ga0496109_0325677 | Ga0496109_0325677_524_1276 | 243 |
| 809 | 3300048914 | Ga0496111_0252747 | Ga0496111_0252747_257_1009 | 243 |
| 810 | 3300048920 | Ga0496117_0009524 | Ga0496117_0009524_2717_3454 | 243 |
| 811 | 3300048921 | Ga0496118_0020768 | Ga0496118_0020768_3837_4574 | 243 |
| 812 | 3300048923 | Ga0496120_0104411 | Ga0496120_0104411_731_1471 | 243 |
| 813 | 3300048925 | Ga0496122_0009142 | Ga0496122_0009142_316_1068 | 243 |
| 814 | 3300048927 | Ga0496124_0030412 | Ga0496124_0030412_2947_3693 | 243 |
| 815 | 3300048927 | Ga0496124_0147353 | Ga0496124_0147353_204_956 | 243 |
| 816 | 3300049663 | Ga0501223_000230 | Ga0501223_000230_2525_3256 | 243 |
| 817 | 3300049669 | Ga0501235_003856 | Ga0501235_003856_2192_2929 | 243 |
| 818 | 3300049705 | Ga0501225_0000080 | Ga0501225_0000080_11233_11964 | 243 |
| 819 | 3300049705 | Ga0501225_0039065 | Ga0501225_0039065_128_859 | 243 |
| 820 | 3300049822 | Ga0501035_0190442 | Ga0501035_0190442_622_1359 | 243 |
| 821 | 3300050512 | nmdc:mga0n895_426707_c1 | nmdc:mga0n895_426707_c1_455_1198 | 243 |
| 822 | 3300053177 | Ga0500636_0004813 | Ga0500636_0004813_4826_5572 | 243 |
| 823 | iso_pu_bacteria | 2775507255 | 2778123420 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3knu-assembly1.cif.gz_B | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.9328 | 3 | 213 |
| 3knu-assembly1.cif.gz_A | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.931 | 3 | 213 |
| 4ig6-assembly1.cif.gz_A | crystal structure of a trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum bound to s-adenosylhomocysteine | 0.9296 | 3 | 224 |
| 3knu-assembly2.cif.gz_D | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.9256 | 3 | 213 |
| 3knu-assembly2.cif.gz_C | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.9255 | 3 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iefB01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9659 | 3 | 159 | 3.40.1280.10 |
| 3iefB01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9355 | 3 | 159 | 3.40.1280.10 |
| 4yq2A02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9294 | 175 | 226 | 1.10.1270.20 |
| 3quvB02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9294 | 175 | 224 | 1.10.1270.20 |
| 5wyrA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9289 | 1 | 163 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4QIM4-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9693 | 3 | 133 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A528D6F4-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9617 | 1 | 167 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A2E3L645-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9609 | 2 | 188 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A439KNT5-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9573 | 1 | 148 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A528D6F4-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9561 | 1 | 167 |
GO:0002939
GO:0005829 GO:0052906 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar