F477722

General Info

Members Datasets Scaffolds Average Seq Length
727 305 714 105

Family's Representative Sequence

Representative Sequence 3300004799|Ga0058863_10049786|Ga0058863_100497861
Length 129
Sequence MADVNMDQIIDQLSNLTVMQIADLTKKLEEKWGVKAAPVAVAGVGGPAASGAPAEAAAEKTEFTVILSNAGGNKIQVIKAIREITNLGLKEAKDLVDGAPKEIKAGVSKDDAENIKKKIAEAGGTVEIK

Samples

Sample ID Description Type Environment
1 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003159 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003284 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
108 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
234 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
298 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
299 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
300 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
303 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.41
Metatranscriptomes 10.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 2.2
Rhizosphere 92.3
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006769J43182_102873 3300002863 Bacteria 598
2 Ga0006767J43181_102926 3300002868 Bacteria 7905
3 Ga0006763J43179_103249 3300002870 Bacteria 4479
4 Ga0006762J43184_101278 3300002872 Bacteria 726
5 Ga0006760J45825_102611 3300003158 Bacteria 1446
6 Ga0006771J45828_104384 3300003159 Bacteria 555
7 Ga0006765J45826_106834 3300003161 Bacteria 1405
8 Ga0006778J45830_1038270 3300003162 Bacteria 1578
9 Ga0006759J45824_1005533 3300003163 Bacteria 3794
10 Ga0006759J45824_1187716 3300003163 Bacteria 634
11 Ga0006773J48901_13004 3300003284 Bacteria 610
12 Ga0006758J48902_1007634 3300003300 Bacteria 7937
13 Ga0006770J48903_1018629 3300003305 Bacteria 2226
14 Ga0007417J51691_1046473 3300003544 Bacteria 687
15 Ga0007410J51695_1075587 3300003574 Bacteria 632
16 Ga0007410J51695_1111274 3300003574 Bacteria 638
17 Ga0032354_1006912 3300003693 Bacteria 8240
18 Ga0006766_112346 3300003717 Bacteria 503
19 Ga0058859_10064973 3300004798 Bacteria 1930
20 Ga0058859_11763153 3300004798 Bacteria 513
21 Ga0058859_11763832 3300004798 Bacteria 502
22 Ga0058859_11787064 3300004798 Bacteria 868
23 Ga0058863_10018461 3300004799 Bacteria 849
24 Ga0058863_10049786 3300004799 Bacteria 1035
25 Ga0058863_10078913 3300004799 Bacteria 2674
26 Ga0058863_10129461 3300004799 Bacteria 784
27 Ga0058863_10166919 3300004799 Bacteria 1085
28 Ga0058863_11695332 3300004799 Bacteria 619
29 Ga0058861_10048978 3300004800 Bacteria 1375
30 Ga0058861_10116376 3300004800 Bacteria 1167
31 Ga0058861_10179658 3300004800 Bacteria 681
32 Ga0058861_10180125 3300004800 Bacteria 1113
33 Ga0058861_11984899 3300004800 Bacteria 751
34 Ga0058860_12066015 3300004801 Bacteria 582
35 Ga0058860_12134580 3300004801 Bacteria 608
36 Ga0058860_12162593 3300004801 Bacteria 769
37 Ga0058862_10025574 3300004803 Bacteria 988
38 Ga0058862_10108482 3300004803 Bacteria 1795
39 Ga0058862_10209411 3300004803 Bacteria 1121
40 Ga0058862_10288134 3300004803 Bacteria 2172
41 Ga0058862_12833164 3300004803 Bacteria 664
42 Ga0070658_10072868 3300005327 Bacteria 2815
43 Ga0070658_10533132 3300005327 Bacteria 1015
44 Ga0070658_11145262 3300005327 Bacteria 676
45 Ga0070676_10002594 3300005328 Bacteria 9296
46 Ga0070683_100025558 3300005329 Bacteria 5305
47 Ga0070683_100098230 3300005329 Bacteria 2755
48 Ga0070683_100458546 3300005329 Bacteria 1216
49 Ga0070683_100543254 3300005329 Bacteria 1111
50 Ga0070683_100729654 3300005329 Bacteria 949
51 Ga0070683_101493666 3300005329 Bacteria 649
52 Ga0070690_100035259 3300005330 Bacteria 3138
53 Ga0070690_100117465 3300005330 Bacteria 1782
54 Ga0068869_100015118 3300005334 Bacteria 5168
55 Ga0068869_100053263 3300005334 Bacteria 2941
56 Ga0068869_100578358 3300005334 Bacteria 947
57 Ga0068869_101156998 3300005334 Bacteria 678
58 Ga0070666_10105484 3300005335 Bacteria 1946
59 Ga0070666_11110873 3300005335 Bacteria 588
60 Ga0070680_100353017 3300005336 Bacteria 1250
61 Ga0070680_100451887 3300005336 Bacteria 1097
62 Ga0070680_100494220 3300005336 Bacteria 1046
63 Ga0070680_100655247 3300005336 Bacteria 902
64 Ga0070682_100167591 3300005337 Bacteria 1523
65 Ga0068868_100018827 3300005338 Bacteria 5166
66 Ga0068868_100065914 3300005338 Bacteria 2878
67 Ga0068868_100717195 3300005338 Bacteria 896
68 Ga0068868_100862151 3300005338 Bacteria 821
69 Ga0070660_100007877 3300005339 Bacteria 7430
70 Ga0070660_100072704 3300005339 Bacteria 2688
71 Ga0070689_100039067 3300005340 Bacteria 3633
72 Ga0070689_100134950 3300005340 Bacteria 1981
73 Ga0070689_100366864 3300005340 Bacteria 1211
74 Ga0070689_100652949 3300005340 Bacteria 915
75 Ga0070689_100782984 3300005340 Bacteria 838
76 Ga0070691_10000755 3300005341 Bacteria 12780
77 Ga0070691_10097612 3300005341 Bacteria 1456
78 Ga0070691_10166060 3300005341 Bacteria 1141
79 Ga0070687_100037795 3300005343 Bacteria 2415
80 Ga0070661_100042849 3300005344 Bacteria 3305
81 Ga0070668_100289401 3300005347 Bacteria 1371
82 Ga0070668_101029542 3300005347 Bacteria 741
83 Ga0070668_101277357 3300005347 Bacteria 667
84 Ga0070669_100103891 3300005353 Bacteria 2147
85 Ga0070671_100180145 3300005355 Bacteria 1789
86 Ga0070671_100595966 3300005355 Bacteria 955
87 Ga0070674_100034146 3300005356 Bacteria 3394
88 Ga0070674_100069495 3300005356 Bacteria 2485
89 Ga0070674_100287914 3300005356 Bacteria 1305
90 Ga0070673_101959658 3300005364 Bacteria 556
91 Ga0070688_100359487 3300005365 Bacteria 1068
92 Ga0070688_100589681 3300005365 Bacteria 849
93 Ga0070688_100645216 3300005365 Bacteria 815
94 Ga0070659_100260883 3300005366 Bacteria 1438
95 Ga0070659_100403920 3300005366 Bacteria 1154
96 Ga0070667_100571196 3300005367 Bacteria 1040
97 Ga0070713_102030769 3300005436 Bacteria 557
98 Ga0070701_10034508 3300005438 Bacteria 2534
99 Ga0070701_10038918 3300005438 Bacteria 2409
100 Ga0070705_100003038 3300005440 Bacteria 8279
101 Ga0070705_100585101 3300005440 Bacteria 861
102 Ga0070700_100087468 3300005441 Bacteria 2025
103 Ga0070700_100520294 3300005441 Bacteria 919
104 Ga0070694_100286968 3300005444 Bacteria 1257
105 Ga0070663_100427185 3300005455 Bacteria 1088
106 Ga0070678_100060561 3300005456 Bacteria 2787
107 Ga0070678_100195566 3300005456 Bacteria 1665
108 Ga0070662_100008090 3300005457 Bacteria 6845
109 Ga0070681_10005341 3300005458 Bacteria 12402
110 Ga0070681_10168536 3300005458 Bacteria 2112
111 Ga0068867_100000709 3300005459 Bacteria 22216
112 Ga0068867_100124906 3300005459 Bacteria 1993
113 Ga0068867_100168337 3300005459 Bacteria 1733
114 Ga0070685_10393371 3300005466 Bacteria 958
115 Ga0070706_100993854 3300005467 Bacteria 774
116 Ga0070698_100024917 3300005471 Bacteria 6236
117 Ga0070699_100015032 3300005518 Bacteria 6652
118 Ga0070679_100003781 3300005530 Bacteria 13889
119 Ga0070679_100218948 3300005530 Bacteria 1865
120 Ga0070679_100297498 3300005530 Bacteria 1565
121 Ga0070679_100387283 3300005530 Bacteria 1344
122 Ga0070679_100407351 3300005530 Bacteria 1305
123 Ga0070679_100962179 3300005530 Bacteria 797
124 Ga0070679_101277769 3300005530 Bacteria 679
125 Ga0070684_100054146 3300005535 Bacteria 3495
126 Ga0070684_100057972 3300005535 Bacteria 3382
127 Ga0070684_100085526 3300005535 Bacteria 2797
128 Ga0070684_100241732 3300005535 Bacteria 1649
129 Ga0070684_100304971 3300005535 Bacteria 1461
130 Ga0070684_100340394 3300005535 Bacteria 1379
131 Ga0070684_100348102 3300005535 Bacteria 1363
132 Ga0070684_100446964 3300005535 Bacteria 1194
133 Ga0070684_101975018 3300005535 Bacteria 551
134 Ga0068853_100010638 3300005539 Bacteria 7444
135 Ga0068853_100060122 3300005539 Bacteria 3282
136 Ga0068853_100102311 3300005539 Bacteria 2535
137 Ga0068853_100235147 3300005539 Bacteria 1677
138 Ga0068853_100462306 3300005539 Bacteria 1194
139 Ga0068853_101090780 3300005539 Bacteria 770
140 Ga0068853_101927933 3300005539 Bacteria 573
141 Ga0070686_100012677 3300005544 Bacteria 4808
142 Ga0070696_101140106 3300005546 Bacteria 657
143 Ga0070696_101371579 3300005546 Bacteria 602
144 Ga0070693_100168531 3300005547 Bacteria 1400
145 Ga0070693_100620876 3300005547 Bacteria 783
146 Ga0070665_100178042 3300005548 Bacteria 2127
147 Ga0070665_100586592 3300005548 Bacteria 1127
148 Ga0070665_101444134 3300005548 Bacteria 697
149 Ga0068855_100033833 3300005563 Bacteria 6097
150 Ga0068855_100146442 3300005563 Bacteria 2688
151 Ga0068855_100373998 3300005563 Bacteria 1565
152 Ga0068855_100735843 3300005563 Bacteria 1053
153 Ga0068855_101868494 3300005563 Bacteria 609
154 Ga0068857_100003025 3300005577 Bacteria 13896
155 Ga0068857_100042568 3300005577 Bacteria 4030
156 Ga0068857_100127402 3300005577 Bacteria 2294
157 Ga0068857_100394141 3300005577 Bacteria 1288
158 Ga0068854_100331442 3300005578 Bacteria 1240
159 Ga0068856_100000278 3300005614 Bacteria 55608
160 Ga0068856_100139794 3300005614 Bacteria 2428
161 Ga0068856_100204627 3300005614 Bacteria 1988
162 Ga0068856_100334387 3300005614 Bacteria 1532
163 Ga0068856_100374426 3300005614 Bacteria 1443
164 Ga0068856_100656433 3300005614 Bacteria 1069
165 Ga0068856_101099063 3300005614 Bacteria 812
166 Ga0068856_101404634 3300005614 Bacteria 712
167 Ga0068856_101461059 3300005614 Bacteria 698
168 Ga0070702_100288555 3300005615 Bacteria 1130
169 Ga0068852_100116427 3300005616 Bacteria 2438
170 Ga0068852_100140853 3300005616 Bacteria 2232
171 Ga0068852_100242015 3300005616 Bacteria 1725
172 Ga0068859_100089831 3300005617 Bacteria 3122
173 Ga0068859_100122928 3300005617 Bacteria 2662
174 Ga0068859_100419957 3300005617 Bacteria 1434
175 Ga0068859_100942883 3300005617 Bacteria 947
176 Ga0068859_101686387 3300005617 Bacteria 700
177 Ga0068859_101861302 3300005617 Bacteria 665
178 Ga0068864_100180649 3300005618 Bacteria 1929
179 Ga0068864_100493733 3300005618 Bacteria 1177
180 Ga0068864_101188960 3300005618 Bacteria 761
181 Ga0068866_10000494 3300005718 Bacteria 18128
182 Ga0068866_10078882 3300005718 Bacteria 1763
183 Ga0068866_10205223 3300005718 Bacteria 1180
184 Ga0068866_10277600 3300005718 Bacteria 1037
185 Ga0068861_100041696 3300005719 Bacteria 3438
186 Ga0068861_100428210 3300005719 Bacteria 1180
187 Ga0068861_101137646 3300005719 Bacteria 752
188 Ga0068851_10733654 3300005834 Bacteria 610
189 Ga0068870_11109853 3300005840 Bacteria 569
190 Ga0068863_100685303 3300005841 Bacteria 1018
191 Ga0068863_101967295 3300005841 Bacteria 595
192 Ga0068863_102051601 3300005841 Bacteria 582
193 Ga0068858_100022470 3300005842 Bacteria 5886
194 Ga0068858_100033144 3300005842 Bacteria 4796
195 Ga0068858_100072533 3300005842 Bacteria 3194
196 Ga0068858_100403025 3300005842 Bacteria 1314
197 Ga0068860_100016230 3300005843 Bacteria 7261
198 Ga0068860_100068561 3300005843 Bacteria 3370
199 Ga0068860_100879434 3300005843 Bacteria 911
200 Ga0068862_101190978 3300005844 Bacteria 760
201 Ga0070717_10018330 3300006028 Bacteria 5462
202 Ga0075362_10630114 3300006177 Bacteria 556
203 Ga0075366_10430895 3300006195 Bacteria 813
204 Ga0075366_11007148 3300006195 Bacteria 520
205 Ga0097621_100100789 3300006237 Bacteria 2429
206 Ga0097621_100183694 3300006237 Bacteria 1808
207 Ga0097621_100682458 3300006237 Bacteria 944
208 Ga0097621_100974194 3300006237 Bacteria 792
209 Ga0097621_101214111 3300006237 Bacteria 710
210 Ga0097621_101235175 3300006237 Bacteria 704
211 Ga0068871_100028407 3300006358 Bacteria 4384
212 Ga0068871_100181615 3300006358 Bacteria 1808
213 Ga0068871_100998036 3300006358 Bacteria 779
214 Ga0068871_101144825 3300006358 Bacteria 728
215 Ga0075428_100049476 3300006844 Bacteria 4611
216 Ga0075428_100204166 3300006844 Bacteria 2136
217 Ga0075428_101413782 3300006844 Bacteria 730
218 Ga0075433_10369358 3300006852 Bacteria 1267
219 Ga0075429_100358132 3300006880 Bacteria 1277
220 Ga0068865_100032704 3300006881 Bacteria 3477
221 Ga0068865_100036010 3300006881 Bacteria 3333
222 Ga0068865_100058801 3300006881 Bacteria 2687
223 Ga0068865_101225941 3300006881 Bacteria 665
224 Ga0097620_100089828 3300006931 Bacteria 3122
225 Ga0097620_100122935 3300006931 Bacteria 2662
226 Ga0097620_100419957 3300006931 Bacteria 1434
227 Ga0097620_100942831 3300006931 Bacteria 947
228 Ga0097620_101686139 3300006931 Bacteria 700
229 Ga0097620_101861331 3300006931 Bacteria 665
230 Ga0075435_100307300 3300007076 Bacteria 1357
231 Ga0105251_10131686 3300009011 Bacteria 1133
232 Ga0105240_10000795 3300009093 Bacteria 57129
233 Ga0105240_10020993 3300009093 Bacteria 8692
234 Ga0105240_10073563 3300009093 Bacteria 4219
235 Ga0105240_10245062 3300009093 Bacteria 2076
236 Ga0105240_10625743 3300009093 Bacteria 1182
237 Ga0105240_10748662 3300009093 Bacteria 1062
238 Ga0111539_10016296 3300009094 Bacteria 9217
239 Ga0111539_10217903 3300009094 Bacteria 2223
240 Ga0111539_10532203 3300009094 Bacteria 1369
241 Ga0111539_10662820 3300009094 Bacteria 1215
242 Ga0105245_10012171 3300009098 Bacteria 7483
243 Ga0105245_10081277 3300009098 Bacteria 2962
244 Ga0105245_10127838 3300009098 Bacteria 2380
245 Ga0105245_10189740 3300009098 Bacteria 1968
246 Ga0105245_11307417 3300009098 Bacteria 774
247 Ga0105245_11563468 3300009098 Bacteria 711
248 Ga0105245_11733529 3300009098 Bacteria 677
249 Ga0105247_10003690 3300009101 Bacteria 9936
250 Ga0105247_10327708 3300009101 Bacteria 1070
251 Ga0114129_10144414 3300009147 Bacteria 3260
252 Ga0114129_12390434 3300009147 Bacteria 633
253 Ga0114129_12415411 3300009147 Bacteria 629
254 Ga0105243_10029435 3300009148 Bacteria 4223
255 Ga0105243_10047500 3300009148 Bacteria 3380
256 Ga0105243_10056116 3300009148 Bacteria 3131
257 Ga0105243_10138770 3300009148 Bacteria 2071
258 Ga0105243_12302616 3300009148 Bacteria 576
259 Ga0105241_10100942 3300009174 Bacteria 2294
260 Ga0105241_10108396 3300009174 Bacteria 2220
261 Ga0105241_10727105 3300009174 Bacteria 908
262 Ga0105241_10739524 3300009174 Bacteria 901
263 Ga0105241_12103105 3300009174 Bacteria 558
264 Ga0105242_10024598 3300009176 Bacteria 4757
265 Ga0105242_10097645 3300009176 Bacteria 2484
266 Ga0105242_10102984 3300009176 Bacteria 2421
267 Ga0105242_10232968 3300009176 Bacteria 1651
268 Ga0105242_10411781 3300009176 Bacteria 1264
269 Ga0105242_10752040 3300009176 Bacteria 960
270 Ga0105242_11385631 3300009176 Bacteria 730
271 Ga0105248_10014122 3300009177 Bacteria 8790
272 Ga0105248_10091573 3300009177 Bacteria 3424
273 Ga0105248_10168453 3300009177 Bacteria 2469
274 Ga0105248_10319029 3300009177 Bacteria 1750
275 Ga0105248_10956879 3300009177 Bacteria 967
276 Ga0105248_11548992 3300009177 Bacteria 751
277 Ga0105237_10016417 3300009545 Bacteria 7693
278 Ga0105237_10098216 3300009545 Bacteria 2919
279 Ga0105238_10003657 3300009551 Bacteria 15336
280 Ga0105238_10018959 3300009551 Bacteria 7007
281 Ga0105238_10049536 3300009551 Bacteria 4230
282 Ga0105238_10249273 3300009551 Bacteria 1754
283 Ga0105238_10843313 3300009551 Bacteria 933
284 Ga0105238_11680374 3300009551 Bacteria 666
285 Ga0105238_13076691 3300009551 Unclassified 500
286 Ga0105249_10020097 3300009553 Bacteria 5966
287 Ga0105249_11516322 3300009553 Bacteria 743
288 Ga0105249_11711735 3300009553 Bacteria 701
289 Ga0105239_10128219 3300010375 Bacteria 2821
290 Ga0105239_10193386 3300010375 Bacteria 2278
291 Ga0105239_10201646 3300010375 Bacteria 2229
292 Ga0105239_10273406 3300010375 Bacteria 1901
293 Ga0105239_11004595 3300010375 Bacteria 959
294 Ga0105239_11881027 3300010375 Bacteria 694
295 Ga0105246_10090485 3300011119 Bacteria 2204
296 Ga0105246_10153246 3300011119 Bacteria 1747
297 Ga0105246_10496800 3300011119 Bacteria 1035
298 Ga0105246_11360627 3300011119 Bacteria 661
299 Ga0157344_1002277 3300012476 Bacteria 1005
300 Ga0157342_1012942 3300012507 Bacteria 885
301 Ga0157371_10663046 3300013102 Bacteria 779
302 Ga0157370_10011035 3300013104 Bacteria 9476
303 Ga0157370_10012756 3300013104 Bacteria 8692
304 Ga0157370_10183009 3300013104 Bacteria 1946
305 Ga0157370_10938980 3300013104 Bacteria 784
306 Ga0157370_12023375 3300013104 Bacteria 516
307 Ga0157370_12087428 3300013104 Bacteria 508
308 Ga0157369_10008752 3300013105 Bacteria 11593
309 Ga0157369_10009031 3300013105 Bacteria 11414
310 Ga0157369_10156692 3300013105 Bacteria 2405
311 Ga0157369_10320642 3300013105 Bacteria 1611
312 Ga0157369_10347380 3300013105 Bacteria 1541
313 Ga0157374_10052787 3300013296 Bacteria 3788
314 Ga0157374_10078673 3300013296 Bacteria 3124
315 Ga0157374_10340056 3300013296 Bacteria 1490
316 Ga0157374_10795219 3300013296 Bacteria 961
317 Ga0157374_11172774 3300013296 Bacteria 789
318 Ga0157378_10031351 3300013297 Bacteria 4697
319 Ga0157378_10125705 3300013297 Bacteria 2368
320 Ga0157378_10182814 3300013297 Bacteria 1973
321 Ga0157378_10186958 3300013297 Bacteria 1952
322 Ga0157378_10344488 3300013297 Bacteria 1454
323 Ga0157378_10384805 3300013297 Bacteria 1378
324 Ga0157378_10907978 3300013297 Bacteria 912
325 Ga0163162_10822161 3300013306 Bacteria 1045
326 Ga0163162_11429626 3300013306 Bacteria 787
327 Ga0157372_10016975 3300013307 Bacteria 7815
328 Ga0157372_10053170 3300013307 Bacteria 4512
329 Ga0157372_10107716 3300013307 Bacteria 3189
330 Ga0157372_10190087 3300013307 Bacteria 2378
331 Ga0157372_10386314 3300013307 Bacteria 1631
332 Ga0157372_11662655 3300013307 Bacteria 735
333 Ga0157375_10031525 3300013308 Bacteria 5013
334 Ga0157375_10329880 3300013308 Bacteria 1691
335 Ga0157375_10355595 3300013308 Bacteria 1631
336 Ga0157375_11110152 3300013308 Bacteria 926
337 Ga0163163_10191391 3300014325 Bacteria 2094
338 Ga0163163_10553785 3300014325 Bacteria 1212
339 Ga0163163_11637112 3300014325 Bacteria 705
340 Ga0157377_11248264 3300014745 Bacteria 578
341 Ga0157379_10045606 3300014968 Bacteria 3912
342 Ga0157379_10249062 3300014968 Bacteria 1612
343 Ga0157379_10311422 3300014968 Bacteria 1436
344 Ga0157379_11105580 3300014968 Bacteria 759
345 Ga0157376_10041717 3300014969 Bacteria 3759
346 Ga0157376_10195901 3300014969 Bacteria 1856
347 Ga0157376_10253591 3300014969 Bacteria 1645
348 Ga0157376_10402357 3300014969 Bacteria 1324
349 Ga0163161_10014816 3300017792 Bacteria 5432
350 Ga0206356_10155774 3300020070 Bacteria 1669
351 Ga0206356_10445605 3300020070 Bacteria 1370
352 Ga0206356_10751596 3300020070 Bacteria 903
353 Ga0206352_10380723 3300020078 Bacteria 688
354 Ga0206352_10440647 3300020078 Bacteria 667
355 Ga0206352_10458663 3300020078 Bacteria 513
356 Ga0206352_10984759 3300020078 Bacteria 650
357 Ga0206352_11159890 3300020078 Bacteria 691
358 Ga0206352_11360316 3300020078 Bacteria 1563
359 Ga0213874_10447126 3300021377 Unclassified 509
360 Ga0213876_10151394 3300021384 Bacteria 1234
361 Ga0224712_10387618 3300022467 Bacteria 665
362 Ga0207656_10463585 3300025321 Bacteria 641
363 Ga0207642_10021290 3300025899 Bacteria 2550
364 Ga0207642_10094851 3300025899 Bacteria 1483
365 Ga0207642_10161883 3300025899 Bacteria 1202
366 Ga0207642_10989180 3300025899 Bacteria 541
367 Ga0207710_10000970 3300025900 Bacteria 15084
368 Ga0207710_10421569 3300025900 Bacteria 687
369 Ga0207680_10008975 3300025903 Bacteria 4935
370 Ga0207680_10367559 3300025903 Bacteria 1012
371 Ga0207685_10733685 3300025905 Bacteria 540
372 Ga0207699_10995624 3300025906 Bacteria 620
373 Ga0207645_10001488 3300025907 Bacteria 19134
374 Ga0207684_10371386 3300025910 Bacteria 1230
375 Ga0207654_10010792 3300025911 Bacteria 4650
376 Ga0207654_10030109 3300025911 Bacteria 2977
377 Ga0207654_10039497 3300025911 Bacteria 2655
378 Ga0207654_10910602 3300025911 Bacteria 638
379 Ga0207654_11322148 3300025911 Bacteria 525
380 Ga0207707_10000208 3300025912 Bacteria 62369
381 Ga0207707_10042874 3300025912 Bacteria 3948
382 Ga0207707_10216497 3300025912 Bacteria 1667
383 Ga0207707_10542140 3300025912 Bacteria 989
384 Ga0207707_10980627 3300025912 Bacteria 694
385 Ga0207707_11099382 3300025912 Bacteria 648
386 Ga0207695_10001980 3300025913 Bacteria 31627
387 Ga0207695_10011622 3300025913 Bacteria 10648
388 Ga0207695_10075068 3300025913 Bacteria 3441
389 Ga0207695_10108928 3300025913 Bacteria 2753
390 Ga0207695_10293964 3300025913 Bacteria 1516
391 Ga0207695_10575253 3300025913 Bacteria 1008
392 Ga0207695_10815990 3300025913 Bacteria 813
393 Ga0207671_10009643 3300025914 Bacteria 8049
394 Ga0207671_10023485 3300025914 Bacteria 4651
395 Ga0207671_10038271 3300025914 Bacteria 3555
396 Ga0207671_10307218 3300025914 Bacteria 1253
397 Ga0207693_11133319 3300025915 Bacteria 593
398 Ga0207663_11200895 3300025916 Bacteria 611
399 Ga0207660_10039644 3300025917 Bacteria 3294
400 Ga0207660_10211310 3300025917 Bacteria 1519
401 Ga0207660_10222965 3300025917 Bacteria 1480
402 Ga0207660_10374121 3300025917 Bacteria 1144
403 Ga0207660_11141456 3300025917 Bacteria 635
404 Ga0207660_11337923 3300025917 Bacteria 581
405 Ga0207662_10053691 3300025918 Bacteria 2401
406 Ga0207662_10299640 3300025918 Bacteria 1068
407 Ga0207657_10106313 3300025919 Bacteria 2322
408 Ga0207657_10404054 3300025919 Bacteria 1074
409 Ga0207649_10023134 3300025920 Bacteria 3596
410 Ga0207652_10001483 3300025921 Bacteria 20760
411 Ga0207652_10117930 3300025921 Bacteria 2358
412 Ga0207652_10186689 3300025921 Bacteria 1864
413 Ga0207652_10322615 3300025921 Bacteria 1394
414 Ga0207652_10325658 3300025921 Bacteria 1387
415 Ga0207652_10470139 3300025921 Bacteria 1133
416 Ga0207681_10061447 3300025923 Bacteria 2582
417 Ga0207694_10000800 3300025924 Bacteria 28252
418 Ga0207694_10019493 3300025924 Bacteria 5127
419 Ga0207694_10041556 3300025924 Bacteria 3544
420 Ga0207694_10110424 3300025924 Bacteria 2187
421 Ga0207694_10186966 3300025924 Bacteria 1681
422 Ga0207694_10343034 3300025924 Bacteria 1235
423 Ga0207687_10011839 3300025927 Bacteria 5707
424 Ga0207687_10032291 3300025927 Bacteria 3545
425 Ga0207687_10247839 3300025927 Bacteria 1414
426 Ga0207687_11244070 3300025927 Bacteria 640
427 Ga0207644_10302899 3300025931 Bacteria 1288
428 Ga0207644_10533861 3300025931 Bacteria 970
429 Ga0207690_10224806 3300025932 Bacteria 1438
430 Ga0207706_10000025 3300025933 Bacteria 150958
431 Ga0207686_10000932 3300025934 Bacteria 17499
432 Ga0207686_10014805 3300025934 Bacteria 4351
433 Ga0207686_10044279 3300025934 Bacteria 2732
434 Ga0207686_10098042 3300025934 Bacteria 1951
435 Ga0207686_10237389 3300025934 Bacteria 1325
436 Ga0207686_10245841 3300025934 Bacteria 1304
437 Ga0207709_10085508 3300025935 Bacteria 2045
438 Ga0207709_10217793 3300025935 Bacteria 1375
439 Ga0207709_10320751 3300025935 Bacteria 1159
440 Ga0207709_10334371 3300025935 Bacteria 1138
441 Ga0207709_10350411 3300025935 Bacteria 1114
442 Ga0207709_11752647 3300025935 Bacteria 516
443 Ga0207670_10005394 3300025936 Bacteria 7014
444 Ga0207670_10183840 3300025936 Bacteria 1576
445 Ga0207670_10680428 3300025936 Bacteria 850
446 Ga0207670_10721505 3300025936 Bacteria 826
447 Ga0207669_10039989 3300025937 Bacteria 2716
448 Ga0207669_10118315 3300025937 Bacteria 1792
449 Ga0207704_10046483 3300025938 Bacteria 2587
450 Ga0207704_10084243 3300025938 Bacteria 2066
451 Ga0207704_10380955 3300025938 Bacteria 1107
452 Ga0207711_10001923 3300025941 Bacteria 18862
453 Ga0207711_10036628 3300025941 Bacteria 4163
454 Ga0207711_10115521 3300025941 Bacteria 2392
455 Ga0207711_10132935 3300025941 Bacteria 2232
456 Ga0207711_10670876 3300025941 Bacteria 967
457 Ga0207689_10006953 3300025942 Bacteria 9947
458 Ga0207689_10104975 3300025942 Bacteria 2321
459 Ga0207689_10113109 3300025942 Bacteria 2231
460 Ga0207661_10003943 3300025944 Bacteria 10365
461 Ga0207661_10053133 3300025944 Bacteria 3240
462 Ga0207661_11187380 3300025944 Bacteria 702
463 Ga0207679_10062796 3300025945 Bacteria 2770
464 Ga0207667_10003608 3300025949 Bacteria 19092
465 Ga0207667_10015384 3300025949 Bacteria 8696
466 Ga0207667_10123512 3300025949 Bacteria 2667
467 Ga0207667_10320133 3300025949 Bacteria 1584
468 Ga0207712_10908089 3300025961 Bacteria 778
469 Ga0207668_10612124 3300025972 Bacteria 950
470 Ga0207640_10004934 3300025981 Bacteria 7249
471 Ga0207640_11105396 3300025981 Bacteria 701
472 Ga0207677_10043856 3300026023 Bacteria 2976
473 Ga0207677_10080730 3300026023 Bacteria 2331
474 Ga0207703_10008858 3300026035 Bacteria 7931
475 Ga0207703_10013093 3300026035 Bacteria 6466
476 Ga0207703_10021117 3300026035 Bacteria 5096
477 Ga0207703_10524715 3300026035 Bacteria 1114
478 Ga0207639_10014533 3300026041 Bacteria 5541
479 Ga0207639_10021804 3300026041 Bacteria 4604
480 Ga0207639_10125052 3300026041 Bacteria 2119
481 Ga0207639_10131680 3300026041 Bacteria 2071
482 Ga0207639_11804462 3300026041 Bacteria 572
483 Ga0207678_10527438 3300026067 Bacteria 1031
484 Ga0207708_10130203 3300026075 Bacteria 1967
485 Ga0207708_10496663 3300026075 Bacteria 1022
486 Ga0207702_10001668 3300026078 Bacteria 21933
487 Ga0207702_10070106 3300026078 Bacteria 3014
488 Ga0207702_10111508 3300026078 Bacteria 2433
489 Ga0207702_10152079 3300026078 Bacteria 2106
490 Ga0207702_10152751 3300026078 Bacteria 2102
491 Ga0207702_10406779 3300026078 Bacteria 1313
492 Ga0207641_10054321 3300026088 Bacteria 3398
493 Ga0207641_10257739 3300026088 Bacteria 1632
494 Ga0207641_10451073 3300026088 Bacteria 1243
495 Ga0207648_10003523 3300026089 Bacteria 16389
496 Ga0207648_10088131 3300026089 Bacteria 2710
497 Ga0207676_10138487 3300026095 Bacteria 2080
498 Ga0207676_10224198 3300026095 Bacteria 1676
499 Ga0207676_10237076 3300026095 Bacteria 1634
500 Ga0207676_10561774 3300026095 Bacteria 1091
501 Ga0207676_11124089 3300026095 Bacteria 777
502 Ga0207674_10000310 3300026116 Bacteria 62057
503 Ga0207674_10013667 3300026116 Bacteria 8992
504 Ga0207674_10015138 3300026116 Bacteria 8487
505 Ga0207674_10103448 3300026116 Bacteria 2827
506 Ga0207674_11365689 3300026116 Bacteria 678
507 Ga0207675_100119945 3300026118 Bacteria 2488
508 Ga0207675_100198537 3300026118 Bacteria 1926
509 Ga0207683_10025790 3300026121 Bacteria 5071
510 Ga0207683_10025820 3300026121 Bacteria 5068
511 Ga0207698_10052131 3300026142 Bacteria 3133
512 Ga0207698_10121656 3300026142 Bacteria 2210
513 Ga0207698_10206145 3300026142 Bacteria 1765
514 Ga0207428_10016333 3300027907 Bacteria 6387
515 Ga0268266_10025380 3300028379 Bacteria 5041
516 Ga0268266_10739487 3300028379 Bacteria 949
517 Ga0268266_10974787 3300028379 Bacteria 820
518 Ga0268265_10256127 3300028380 Bacteria 1553
519 Ga0268264_10022095 3300028381 Bacteria 5192
520 Ga0268264_10054422 3300028381 Bacteria 3342
521 Ga0268264_10219525 3300028381 Bacteria 1749
522 Ga0268264_10803706 3300028381 Bacteria 940
523 Ga0265337_1041617 3300028556 Bacteria 1321
524 Ga0265334_10040083 3300028573 Bacteria 1836
525 Ga0265323_10000813 3300028653 Bacteria 16740
526 Ga0265323_10010096 3300028653 Bacteria 3833
527 Ga0265323_10220226 3300028653 Bacteria 594
528 Ga0265322_10001588 3300028654 Bacteria 7290
529 Ga0265322_10056466 3300028654 Bacteria 1114
530 Ga0307517_10044430 3300028786 Bacteria 4699
531 Ga0307515_10019188 3300028794 Bacteria 12327
532 Ga0265338_10180892 3300028800 Bacteria 1607
533 Ga0265338_10197518 3300028800 Bacteria 1519
534 Ga0265324_10001138 3300029957 Bacteria 15932
535 Ga0265766_1003084 3300030863 Bacteria 956
536 Ga0265764_106806 3300030882 Bacteria 665
537 Ga0265769_114939 3300030888 Bacteria 574
538 Ga0265768_104375 3300030963 Bacteria 794
539 Ga0265330_10001538 3300031235 Bacteria 13278
540 Ga0265330_10023175 3300031235 Bacteria 2821
541 Ga0265330_10038180 3300031235 Bacteria 2135
542 Ga0265332_10041964 3300031238 Bacteria 1979
543 Ga0265320_10334821 3300031240 Bacteria 669
544 Ga0265329_10000810 3300031242 Bacteria 15899
545 Ga0265329_10003030 3300031242 Bacteria 7460
546 Ga0265339_10000001 3300031249 Bacteria 613713
547 Ga0265339_10039721 3300031249 Bacteria 2619
548 Ga0265339_10182652 3300031249 Bacteria 1044
549 Ga0265316_10003476 3300031344 Bacteria 15921
550 Ga0265316_10003553 3300031344 Bacteria 15722
551 Ga0265316_10008144 3300031344 Bacteria 9756
552 Ga0265316_10407563 3300031344 Bacteria 978
553 Ga0307513_10359505 3300031456 Bacteria 1201
554 Ga0307509_10000112 3300031507 Bacteria 117028
555 Ga0307509_10117324 3300031507 Bacteria 2649
556 Ga0307509_10421613 3300031507 Bacteria 1035
557 Ga0265313_10004179 3300031595 Bacteria 11210
558 Ga0265313_10006342 3300031595 Bacteria 8414
559 Ga0307514_10050235 3300031649 Bacteria 3239
560 Ga0265314_10002144 3300031711 Bacteria 20676
561 Ga0265314_10002901 3300031711 Bacteria 17019
562 Ga0265314_10354818 3300031711 Bacteria 806
563 Ga0265342_10002849 3300031712 Bacteria 14592
564 Ga0265342_10003171 3300031712 Bacteria 13684
565 Ga0265342_10095154 3300031712 Bacteria 1703
566 Ga0265342_10117343 3300031712 Bacteria 1501
567 Ga0265342_10305733 3300031712 Bacteria 836
568 Ga0316576_10085280 3300031727 Bacteria 2348
569 Ga0316576_10169449 3300031727 Bacteria 1648
570 Ga0316576_11090246 3300031727 Bacteria 567
571 Ga0307516_10068914 3300031730 Bacteria 3404
572 Ga0307405_10023738 3300031731 Bacteria 3491
573 Ga0307405_10653444 3300031731 Bacteria 865
574 Ga0307415_100182310 3300032126 Bacteria 1648
575 Ga0307415_100917700 3300032126 Bacteria 808
576 Ga0307507_10155075 3300033179 Bacteria 1710
577 Ga0316592_1015053 3300033524 Bacteria 1608
578 Ga0316592_1034587 3300033524 Bacteria 1107
579 Ga0316592_1077059 3300033524 Bacteria 757
580 Ga0316592_1168513 3300033524 Bacteria 521
581 Ga0316586_1042064 3300033527 Bacteria 805
582 Ga0316586_1047656 3300033527 Bacteria 763
583 Ga0316588_1000219 3300033528 Bacteria 6805
584 Ga0316588_1010779 3300033528 Bacteria 1936
585 Ga0316588_1039464 3300033528 Bacteria 1126
586 Ga0316588_1167374 3300033528 Bacteria 568
587 Ga0316587_1028265 3300033529 Bacteria 983
588 Ga0373950_0000077 3300034818 Bacteria 39197
589 Ga0373949_0000225 3300035090 Bacteria 21493
590 Ga0373936_0000006 3300035113 Bacteria 318697
591 Ga0373941_0034585 3300035115 Bacteria 1526
592 Ga0373954_0508665 3300035118 Bacteria 597
593 Ga0373956_0148674 3300035119 Bacteria 1102
594 Ga0373943_0090766 3300035170 Bacteria 1582
595 Ga0373955_0075526 3300035172 Bacteria 1894
596 Ga0373961_0000367 3300035241 Bacteria 19355
597 Ga0373961_0075828 3300035241 Bacteria 1049
598 Ga0373935_0148891 3300035692 Bacteria 1587
599 Ga0373935_0494292 3300035692 Bacteria 888
600 Ga0373927_0234406 3300035695 Bacteria 1206
601 Ga0373947_0170258 3300035725 Bacteria 1413
602 Ga0373947_0567815 3300035725 Bacteria 773
603 Ga0265778_001330 3300036457 Bacteria 2231
604 Ga0373925_0010573 3300037068 Bacteria 6693
605 Ga0373925_0859294 3300037068 Bacteria 748
606 Ga0436365_0593949 3300039437 Bacteria 1901
607 Ga0436365_0629347 3300039437 Bacteria 836
608 Ga0436365_1790089 3300039437 Unclassified 1193
609 Ga0436360_0147680 3300039438 Bacteria 3715
610 Ga0436360_1132549 3300039438 Bacteria 579
611 Ga0436361_0484302 3300039447 Bacteria 6682
612 Ga0436363_0308745 3300039450 Bacteria 1962
613 Ga0436363_1500563 3300039450 Bacteria 2666
614 Ga0451797_0755971 3300041453 Bacteria 778
615 Ga0451805_102149 3300041461 Bacteria 868
616 Ga0451807_2653739 3300041486 Bacteria 1109
617 Ga0451577_0035060 3300042876 Bacteria 4520
618 Ga0451577_0043022 3300042876 Bacteria 4047
619 Ga0453683_0072285 3300044673 Bacteria 2159
620 Ga0466963_0142576 3300044694 Bacteria 1661
621 Ga0466964_0229274 3300044706 Bacteria 906
622 Ga0453684_0000116 3300044712 Bacteria 352304
623 Ga0453684_0120898 3300044712 Bacteria 3162
624 Ga0453684_0298379 3300044712 Bacteria 1832
625 Ga0453684_0542260 3300044712 Bacteria 1282
626 Ga0453684_0699489 3300044712 Bacteria 1101
627 Ga0453684_0763571 3300044712 Bacteria 1045
628 Ga0453684_1421883 3300044712 Bacteria 718
629 Ga0453684_1466812 3300044712 Bacteria 705
630 Ga0466957_0850078 3300044842 Bacteria 650
631 Ga0466959_0031428 3300045049 Bacteria 3928
632 Ga0451576_0037161 3300045051 Bacteria 5159
633 Ga0451576_0118318 3300045051 Bacteria 2758
634 Ga0451576_0321743 3300045051 Bacteria 1618
635 Ga0451576_1255267 3300045051 Bacteria 773
636 Ga0466967_1272037 3300045976 Bacteria 733
637 Ga0495650_0287647 3300046471 Bacteria 552
638 Ga0495580_0043038 3300046472 Bacteria 3215
639 Ga0495580_0144978 3300046472 Bacteria 1646
640 Ga0495596_0287436 3300046500 Bacteria 639
641 Ga0495628_0961816 3300046516 Bacteria 589
642 Ga0495630_0849855 3300046517 Bacteria 696
643 Ga0495633_0500120 3300046558 Bacteria 548
644 Ga0495667_0237139 3300046559 Bacteria 1162
645 Ga0495657_0643662 3300046675 Bacteria 612
646 Ga0495623_0163091 3300046679 Bacteria 1308
647 Ga0495680_0863936 3300047322 Bacteria 587
648 Ga0495675_0080546 3300047444 Bacteria 2051
649 Ga0495686_0025181 3300047472 Bacteria 3902
650 Ga0495686_0045414 3300047472 Bacteria 2779
651 Ga0496100_1331223 3300048903 Bacteria 567
652 Ga0496102_0119576 3300048905 Bacteria 2460
653 Ga0496104_0226938 3300048907 Bacteria 1780
654 Ga0496104_0650438 3300048907 Bacteria 963
655 Ga0496106_0082706 3300048909 Bacteria 2468
656 Ga0496106_1456320 3300048909 Bacteria 528
657 Ga0496107_0919005 3300048910 Bacteria 637
658 Ga0496108_0218168 3300048911 Bacteria 1657
659 Ga0496109_1352099 3300048912 Bacteria 648
660 Ga0496112_0007223 3300048915 Bacteria 9844
661 Ga0496112_0375219 3300048915 Bacteria 1364
662 Ga0496114_0024308 3300048917 Bacteria 4945
663 Ga0496115_0220972 3300048918 Bacteria 1563
664 Ga0501309_062099 3300049129 Bacteria 603
665 Ga0501310_037734 3300049130 Bacteria 663
666 Ga0501305_007281 3300049161 Bacteria 1400
667 Ga0501307_005813 3300049162 Bacteria 1312
668 Ga0501307_057851 3300049162 Bacteria 596
669 Ga0501312_071219 3300049528 Bacteria 617
670 Ga0501313_042794 3300049529 Bacteria 612
671 Ga0501317_042186 3300049533 Bacteria 700
672 Ga0501323_029790 3300049539 Bacteria 761
673 Ga0501032_0358963 3300049569 Bacteria 938
674 Ga0501034_0058539 3300049571 Bacteria 3873
675 Ga0501034_0180779 3300049571 Bacteria 2074
676 Ga0501036_0031623 3300049572 Bacteria 4473
677 Ga0501036_0632006 3300049572 Bacteria 887
678 Ga0501046_0193596 3300049580 Bacteria 1516
679 Ga0501047_0054863 3300049581 Bacteria 3854
680 Ga0501069_0028958 3300049585 Bacteria 3038
681 Ga0501069_0053468 3300049585 Bacteria 2249
682 Ga0501070_0038089 3300049586 Bacteria 4012
683 Ga0501070_0072970 3300049586 Bacteria 2840
684 Ga0501070_0548583 3300049586 Bacteria 925
685 Ga0501071_0066878 3300049587 Bacteria 2613
686 Ga0501072_1083997 3300049588 Bacteria 623
687 Ga0501073_0030016 3300049589 Bacteria 3883
688 Ga0501074_0022208 3300049590 Bacteria 4610
689 Ga0501077_0309008 3300049593 Bacteria 1008
690 Ga0501079_0159978 3300049741 Bacteria 1756
691 Ga0501080_0063062 3300049742 Bacteria 3449
692 Ga0501081_0386188 3300049743 Bacteria 1035
693 Ga0501083_0027701 3300049744 Bacteria 3908
694 nmdc:mga0k408_572499_c1 3300050493 Bacteria 667
695 nmdc:mga0k408_839934_c1 3300050493 Bacteria 534
696 nmdc:mga08y16_14232_c1 3300050511 Bacteria 8373
697 nmdc:mga08y16_443260_c1 3300050511 Bacteria 1325
698 nmdc:mga08y16_684200_c1 3300050511 Bacteria 1027
699 nmdc:mga0rr50_171829_c1 3300050513 Bacteria 1766
700 nmdc:mga0a205_215651_c1 3300050515 Bacteria 1806
701 Ga0500646_0010523 3300053090 Bacteria 2373
702 Ga0500583_0112280 3300053092 Bacteria 1343
703 Ga0500583_0377595 3300053092 Bacteria 683
704 Ga0500651_0494703 3300053093 Bacteria 675
705 Ga0500566_0049878 3300053094 Bacteria 2398
706 Ga0500654_071919 3300053099 Bacteria 1679
707 Ga0500555_141066 3300053103 Bacteria 594
708 Ga0500562_034374 3300053108 Bacteria 1341
709 Ga0500597_157237 3300053120 Bacteria 973
710 Ga0500614_006909 3300053123 Bacteria 2386
711 Ga0500642_0007926 3300053130 Bacteria 3600
712 Ga0500642_0031474 3300053130 Bacteria 2217
713 Ga0501082_0057753 3300060353 Bacteria 3342
714 Ga0501082_0406418 3300060353 Bacteria 1188

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_11133319 Ga0207693_111333192 84
2 3300046559 Ga0495667_0237139 Ga0495667_0237139_455_841 88
3 3300010375 Ga0105239_11004595 Ga0105239_110045951 89
4 3300005455 Ga0070663_100427185 Ga0070663_1004271852 90
5 3300044712 Ga0453684_1421883 Ga0453684_1421883_340_681 91
6 3300046675 Ga0495657_0643662 Ga0495657_0643662_69_449 91
7 3300044712 Ga0453684_0120898 Ga0453684_0120898_26_373 92
8 3300005334 Ga0068869_100578358 Ga0068869_1005783581 95
9 3300005335 Ga0070666_10105484 Ga0070666_101054841 95
10 3300005336 Ga0070680_100655247 Ga0070680_1006552472 95
11 3300005338 Ga0068868_100018827 Ga0068868_1000188276 95
12 3300005355 Ga0070671_100180145 Ga0070671_1001801452 95
13 3300005366 Ga0070659_100260883 Ga0070659_1002608833 95
14 3300005367 Ga0070667_100571196 Ga0070667_1005711961 95
15 3300005436 Ga0070713_102030769 Ga0070713_1020307691 95
16 3300005459 Ga0068867_100168337 Ga0068867_1001683372 95
17 3300005518 Ga0070699_100015032 Ga0070699_1000150321 95
18 3300005530 Ga0070679_100387283 Ga0070679_1003872833 95
19 3300005535 Ga0070684_100085526 Ga0070684_1000855263 95
20 3300005535 Ga0070684_100241732 Ga0070684_1002417321 95
21 3300005539 Ga0068853_100060122 Ga0068853_1000601224 95
22 3300005539 Ga0068853_100235147 Ga0068853_1002351471 95
23 3300005539 Ga0068853_100462306 Ga0068853_1004623062 95
24 3300005547 Ga0070693_100168531 Ga0070693_1001685312 95
25 3300005548 Ga0070665_100178042 Ga0070665_1001780421 95
26 3300005548 Ga0070665_100586592 Ga0070665_1005865921 95
27 3300005563 Ga0068855_100146442 Ga0068855_1001464422 95
28 3300005563 Ga0068855_100735843 Ga0068855_1007358432 95
29 3300005577 Ga0068857_100042568 Ga0068857_1000425682 95
30 3300005577 Ga0068857_100127402 Ga0068857_1001274022 95
31 3300005578 Ga0068854_100331442 Ga0068854_1003314422 95
32 3300005614 Ga0068856_100139794 Ga0068856_1001397943 95
33 3300005617 Ga0068859_100089831 Ga0068859_1000898312 95
34 3300005718 Ga0068866_10078882 Ga0068866_100788821 95
35 3300005841 Ga0068863_101967295 Ga0068863_1019672951 95
36 3300005842 Ga0068858_100033144 Ga0068858_1000331448 95
37 3300005842 Ga0068858_100403025 Ga0068858_1004030252 95
38 3300005843 Ga0068860_100016230 Ga0068860_1000162303 95
39 3300006237 Ga0097621_100974194 Ga0097621_1009741942 95
40 3300006237 Ga0097621_101214111 Ga0097621_1012141111 95
41 3300006237 Ga0097621_101235175 Ga0097621_1012351751 95
42 3300006358 Ga0068871_100181615 Ga0068871_1001816152 95
43 3300006358 Ga0068871_100998036 Ga0068871_1009980361 95
44 3300006358 Ga0068871_101144825 Ga0068871_1011448252 95
45 3300006881 Ga0068865_100036010 Ga0068865_1000360104 95
46 3300006931 Ga0097620_100089828 Ga0097620_1000898282 95
47 3300009011 Ga0105251_10131686 Ga0105251_101316861 95
48 3300009093 Ga0105240_10625743 Ga0105240_106257431 95
49 3300009093 Ga0105240_10748662 Ga0105240_107486622 95
50 3300009098 Ga0105245_10127838 Ga0105245_101278382 95
51 3300009098 Ga0105245_11733529 Ga0105245_117335292 95
52 3300009101 Ga0105247_10327708 Ga0105247_103277081 95
53 3300009147 Ga0114129_10144414 Ga0114129_101444142 95
54 3300009148 Ga0105243_10138770 Ga0105243_101387702 95
55 3300009174 Ga0105241_10727105 Ga0105241_107271051 95
56 3300009174 Ga0105241_10739524 Ga0105241_107395242 95
57 3300009174 Ga0105241_12103105 Ga0105241_121031052 95
58 3300009176 Ga0105242_10232968 Ga0105242_102329681 95
59 3300009176 Ga0105242_11385631 Ga0105242_113856311 95
60 3300009177 Ga0105248_10168453 Ga0105248_101684533 95
61 3300009177 Ga0105248_10319029 Ga0105248_103190293 95
62 3300009551 Ga0105238_10018959 Ga0105238_100189591 95
63 3300009551 Ga0105238_10049536 Ga0105238_100495362 95
64 3300009551 Ga0105238_13076691 Ga0105238_130766911 95
65 3300009553 Ga0105249_11711735 Ga0105249_117117351 95
66 3300010375 Ga0105239_10273406 Ga0105239_102734061 95
67 3300010375 Ga0105239_11881027 Ga0105239_118810272 95
68 3300011119 Ga0105246_10153246 Ga0105246_101532462 95
69 3300013102 Ga0157371_10663046 Ga0157371_106630461 95
70 3300013104 Ga0157370_10183009 Ga0157370_101830092 95
71 3300013105 Ga0157369_10320642 Ga0157369_103206422 95
72 3300013296 Ga0157374_10795219 Ga0157374_107952192 95
73 3300013296 Ga0157374_11172774 Ga0157374_111727742 95
74 3300013297 Ga0157378_10125705 Ga0157378_101257052 95
75 3300013297 Ga0157378_10182814 Ga0157378_101828141 95
76 3300013306 Ga0163162_10822161 Ga0163162_108221611 95
77 3300013307 Ga0157372_11662655 Ga0157372_116626551 95
78 3300013308 Ga0157375_10355595 Ga0157375_103555952 95
79 3300014325 Ga0163163_10191391 Ga0163163_101913913 95
80 3300014325 Ga0163163_11637112 Ga0163163_116371122 95
81 3300014968 Ga0157379_10249062 Ga0157379_102490621 95
82 3300014968 Ga0157379_10311422 Ga0157379_103114223 95
83 3300014969 Ga0157376_10195901 Ga0157376_101959012 95
84 3300021377 Ga0213874_10447126 Ga0213874_104471261 95
85 3300025900 Ga0207710_10421569 Ga0207710_104215692 95
86 3300025903 Ga0207680_10367559 Ga0207680_103675591 95
87 3300025911 Ga0207654_10030109 Ga0207654_100301091 95
88 3300025911 Ga0207654_10910602 Ga0207654_109106021 95
89 3300025912 Ga0207707_10042874 Ga0207707_100428748 95
90 3300025912 Ga0207707_11099382 Ga0207707_110993821 95
91 3300025913 Ga0207695_10075068 Ga0207695_100750682 95
92 3300025913 Ga0207695_10575253 Ga0207695_105752532 95
93 3300025913 Ga0207695_10815990 Ga0207695_108159901 95
94 3300025914 Ga0207671_10038271 Ga0207671_100382714 95
95 3300025917 Ga0207660_10211310 Ga0207660_102113102 95
96 3300025921 Ga0207652_10325658 Ga0207652_103256583 95
97 3300025924 Ga0207694_10019493 Ga0207694_100194932 95
98 3300025924 Ga0207694_10041556 Ga0207694_100415562 95
99 3300025931 Ga0207644_10302899 Ga0207644_103028991 95
100 3300025932 Ga0207690_10224806 Ga0207690_102248062 95
101 3300025934 Ga0207686_10014805 Ga0207686_100148055 95
102 3300025935 Ga0207709_10334371 Ga0207709_103343712 95
103 3300025938 Ga0207704_10380955 Ga0207704_103809552 95
104 3300025941 Ga0207711_10115521 Ga0207711_101155214 95
105 3300025941 Ga0207711_10132935 Ga0207711_101329352 95
106 3300025942 Ga0207689_10113109 Ga0207689_101131093 95
107 3300025945 Ga0207679_10062796 Ga0207679_100627963 95
108 3300025949 Ga0207667_10123512 Ga0207667_101235122 95
109 3300025949 Ga0207667_10320133 Ga0207667_103201333 95
110 3300026023 Ga0207677_10080730 Ga0207677_100807302 95
111 3300026035 Ga0207703_10008858 Ga0207703_100088582 95
112 3300026035 Ga0207703_10013093 Ga0207703_100130933 95
113 3300026041 Ga0207639_10021804 Ga0207639_100218048 95
114 3300026041 Ga0207639_10131680 Ga0207639_101316801 95
115 3300026078 Ga0207702_10070106 Ga0207702_100701063 95
116 3300026078 Ga0207702_10406779 Ga0207702_104067791 95
117 3300026088 Ga0207641_10451073 Ga0207641_104510732 95
118 3300026095 Ga0207676_10561774 Ga0207676_105617743 95
119 3300026116 Ga0207674_10013667 Ga0207674_100136673 95
120 3300026116 Ga0207674_10015138 Ga0207674_100151383 95
121 3300028379 Ga0268266_10025380 Ga0268266_100253802 95
122 3300028379 Ga0268266_10974787 Ga0268266_109747872 95
123 3300028381 Ga0268264_10022095 Ga0268264_100220952 95
124 3300031711 Ga0265314_10002144 Ga0265314_1000214413 95
125 3300031712 Ga0265342_10117343 Ga0265342_101173432 95
126 3300035115 Ga0373941_0034585 Ga0373941_0034585_288_671 95
127 3300035241 Ga0373961_0075828 Ga0373961_0075828_652_1035 95
128 3300037068 Ga0373925_0859294 Ga0373925_0859294_212_592 95
129 3300039438 Ga0436360_0147680 Ga0436360_0147680_3226_3609 95
130 3300039450 Ga0436363_1500563 Ga0436363_1500563_816_1199 95
131 3300046517 Ga0495630_0849855 Ga0495630_0849855_104_484 95
132 3300046558 Ga0495633_0500120 Ga0495633_0500120_38_418 95
133 3300048915 Ga0496112_0375219 Ga0496112_0375219_71_451 95
134 3300005327 Ga0070658_10072868 Ga0070658_100728683 97
135 3300005329 Ga0070683_100458546 Ga0070683_1004585462 97
136 3300005329 Ga0070683_101493666 Ga0070683_1014936662 97
137 3300005340 Ga0070689_100366864 Ga0070689_1003668641 97
138 3300005347 Ga0070668_101029542 Ga0070668_1010295422 97
139 3300005365 Ga0070688_100645216 Ga0070688_1006452162 97
140 3300005466 Ga0070685_10393371 Ga0070685_103933712 97
141 3300005535 Ga0070684_100446964 Ga0070684_1004469642 97
142 3300005539 Ga0068853_101090780 Ga0068853_1010907802 97
143 3300005563 Ga0068855_100033833 Ga0068855_1000338333 97
144 3300005614 Ga0068856_101404634 Ga0068856_1014046342 97
145 3300005617 Ga0068859_100942883 Ga0068859_1009428833 97
146 3300005719 Ga0068861_100428210 Ga0068861_1004282103 97
147 3300005834 Ga0068851_10733654 Ga0068851_107336541 97
148 3300005842 Ga0068858_100022470 Ga0068858_1000224702 97
149 3300006237 Ga0097621_100682458 Ga0097621_1006824582 97
150 3300006931 Ga0097620_100942831 Ga0097620_1009428313 97
151 3300009093 Ga0105240_10245062 Ga0105240_102450623 97
152 3300009148 Ga0105243_10047500 Ga0105243_100475001 97
153 3300009176 Ga0105242_10411781 Ga0105242_104117813 97
154 3300009176 Ga0105242_10752040 Ga0105242_107520401 97
155 3300009177 Ga0105248_10014122 Ga0105248_100141222 97
156 3300009545 Ga0105237_10016417 Ga0105237_100164174 97
157 3300009553 Ga0105249_10020097 Ga0105249_100200972 97
158 3300010375 Ga0105239_10193386 Ga0105239_101933861 97
159 3300011119 Ga0105246_10090485 Ga0105246_100904852 97
160 3300013104 Ga0157370_10011035 Ga0157370_100110352 97
161 3300013105 Ga0157369_10008752 Ga0157369_1000875213 97
162 3300013105 Ga0157369_10156692 Ga0157369_101566923 97
163 3300013296 Ga0157374_10078673 Ga0157374_100786732 97
164 3300013297 Ga0157378_10344488 Ga0157378_103444882 97
165 3300013297 Ga0157378_10907978 Ga0157378_109079782 97
166 3300013307 Ga0157372_10053170 Ga0157372_100531701 97
167 3300013307 Ga0157372_10386314 Ga0157372_103863143 97
168 3300013308 Ga0157375_10031525 Ga0157375_100315253 97
169 3300014969 Ga0157376_10402357 Ga0157376_104023573 97
170 3300020078 Ga0206352_10984759 Ga0206352_109847591 97
171 3300025899 Ga0207642_10161883 Ga0207642_101618832 97
172 3300025911 Ga0207654_11322148 Ga0207654_113221481 97
173 3300025913 Ga0207695_10108928 Ga0207695_101089283 97
174 3300025914 Ga0207671_10009643 Ga0207671_100096433 97
175 3300025916 Ga0207663_11200895 Ga0207663_112008951 97
176 3300025924 Ga0207694_10110424 Ga0207694_101104242 97
177 3300025927 Ga0207687_10032291 Ga0207687_100322912 97
178 3300025927 Ga0207687_11244070 Ga0207687_112440701 97
179 3300025934 Ga0207686_10044279 Ga0207686_100442792 97
180 3300025934 Ga0207686_10245841 Ga0207686_102458411 97
181 3300025935 Ga0207709_10217793 Ga0207709_102177932 97
182 3300025935 Ga0207709_10350411 Ga0207709_103504111 97
183 3300025936 Ga0207670_10680428 Ga0207670_106804281 97
184 3300025941 Ga0207711_10001923 Ga0207711_100019232 97
185 3300025949 Ga0207667_10003608 Ga0207667_100036089 97
186 3300025972 Ga0207668_10612124 Ga0207668_106121241 97
187 3300026035 Ga0207703_10021117 Ga0207703_100211177 97
188 3300026035 Ga0207703_10524715 Ga0207703_105247152 97
189 3300026041 Ga0207639_11804462 Ga0207639_118044621 97
190 3300026078 Ga0207702_10152079 Ga0207702_101520791 97
191 3300026078 Ga0207702_10152751 Ga0207702_101527511 97
192 3300026095 Ga0207676_10237076 Ga0207676_102370763 97
193 3300028381 Ga0268264_10219525 Ga0268264_102195253 97
194 3300035170 Ga0373943_0090766 Ga0373943_0090766_323_703 97
195 3300035695 Ga0373927_0234406 Ga0373927_0234406_293_673 97
196 3300035725 Ga0373947_0170258 Ga0373947_0170258_914_1294 97
197 3300037068 Ga0373925_0010573 Ga0373925_0010573_4118_4498 97
198 3300004803 Ga0058862_12833164 Ga0058862_128331641 98
199 3300005329 Ga0070683_100025558 Ga0070683_1000255582 98
200 3300005334 Ga0068869_101156998 Ga0068869_1011569982 98
201 3300005336 Ga0070680_100353017 Ga0070680_1003530172 98
202 3300005339 Ga0070660_100007877 Ga0070660_1000078779 98
203 3300005341 Ga0070691_10000755 Ga0070691_100007552 98
204 3300005344 Ga0070661_100042849 Ga0070661_1000428493 98
205 3300005458 Ga0070681_10005341 Ga0070681_100053414 98
206 3300005530 Ga0070679_100003781 Ga0070679_1000037814 98
207 3300005535 Ga0070684_100057972 Ga0070684_1000579722 98
208 3300005539 Ga0068853_100010638 Ga0068853_1000106382 98
209 3300005577 Ga0068857_100003025 Ga0068857_1000030253 98
210 3300005614 Ga0068856_100000278 Ga0068856_10000027844 98
211 3300005615 Ga0070702_100288555 Ga0070702_1002885552 98
212 3300005616 Ga0068852_100116427 Ga0068852_1001164273 98
213 3300005618 Ga0068864_101188960 Ga0068864_1011889602 98
214 3300009093 Ga0105240_10020993 Ga0105240_100209934 98
215 3300009098 Ga0105245_11563468 Ga0105245_115634682 98
216 3300009174 Ga0105241_10108396 Ga0105241_101083962 98
217 3300009177 Ga0105248_10956879 Ga0105248_109568792 98
218 3300009545 Ga0105237_10098216 Ga0105237_100982164 98
219 3300009551 Ga0105238_10003657 Ga0105238_1000365711 98
220 3300009551 Ga0105238_11680374 Ga0105238_116803741 98
221 3300010375 Ga0105239_10201646 Ga0105239_102016462 98
222 3300011119 Ga0105246_10496800 Ga0105246_104968002 98
223 3300013104 Ga0157370_10012756 Ga0157370_100127564 98
224 3300013104 Ga0157370_12023375 Ga0157370_120233751 98
225 3300013105 Ga0157369_10009031 Ga0157369_100090313 98
226 3300013307 Ga0157372_10016975 Ga0157372_100169753 98
227 3300013308 Ga0157375_10329880 Ga0157375_103298803 98
228 3300020070 Ga0206356_10751596 Ga0206356_107515961 98
229 3300020078 Ga0206352_10380723 Ga0206352_103807232 98
230 3300021384 Ga0213876_10151394 Ga0213876_101513942 98
231 3300025905 Ga0207685_10733685 Ga0207685_107336852 98
232 3300025911 Ga0207654_10010792 Ga0207654_100107925 98
233 3300025912 Ga0207707_10000208 Ga0207707_1000020821 98
234 3300025913 Ga0207695_10001980 Ga0207695_1000198013 98
235 3300025914 Ga0207671_10023485 Ga0207671_100234852 98
236 3300025917 Ga0207660_10039644 Ga0207660_100396445 98
237 3300025919 Ga0207657_10106313 Ga0207657_101063134 98
238 3300025920 Ga0207649_10023134 Ga0207649_100231343 98
239 3300025921 Ga0207652_10001483 Ga0207652_100014832 98
240 3300025924 Ga0207694_10000800 Ga0207694_1000080010 98
241 3300025935 Ga0207709_11752647 Ga0207709_117526471 98
242 3300025941 Ga0207711_10670876 Ga0207711_106708762 98
243 3300025944 Ga0207661_10003943 Ga0207661_100039432 98
244 3300025949 Ga0207667_10015384 Ga0207667_100153844 98
245 3300026041 Ga0207639_10014533 Ga0207639_100145332 98
246 3300026078 Ga0207702_10001668 Ga0207702_1000166814 98
247 3300026095 Ga0207676_11124089 Ga0207676_111240891 98
248 3300026116 Ga0207674_10000310 Ga0207674_1000031041 98
249 3300026142 Ga0207698_10052131 Ga0207698_100521312 98
250 3300031595 Ga0265313_10004179 Ga0265313_100041793 98
251 3300031712 Ga0265342_10003171 Ga0265342_100031713 98
252 3300035118 Ga0373954_0508665 Ga0373954_0508665_182_553 98
253 3300035692 Ga0373935_0494292 Ga0373935_0494292_477_857 98
254 3300039437 Ga0436365_1790089 Ga0436365_1790089_264_647 98
255 3300046472 Ga0495580_0043038 Ga0495580_0043038_2475_2852 98
256 3300046472 Ga0495580_0144978 Ga0495580_0144978_700_1080 98
257 3300048903 Ga0496100_1331223 Ga0496100_1331223_170_550 98
258 3300048907 Ga0496104_0226938 Ga0496104_0226938_504_884 98
259 3300006844 Ga0075428_100049476 Ga0075428_1000494764 101
260 3300009147 Ga0114129_12415411 Ga0114129_124154111 101
261 3300031344 Ga0265316_10407563 Ga0265316_104075632 101
262 3300044712 Ga0453684_0542260 Ga0453684_0542260_429_803 101
263 3300044712 Ga0453684_0699489 Ga0453684_0699489_321_698 101
264 3300044712 Ga0453684_0763571 Ga0453684_0763571_379_756 101
265 3300045051 Ga0451576_1255267 Ga0451576_1255267_351_728 101
266 3300049161 Ga0501305_007281 Ga0501305_007281_968_1354 101
267 3300005338 Ga0068868_100717195 Ga0068868_1007171951 102
268 3300005535 Ga0070684_101975018 Ga0070684_1019750181 102
269 3300005546 Ga0070696_101140106 Ga0070696_1011401061 102
270 3300005617 Ga0068859_101861302 Ga0068859_1018613022 102
271 3300006931 Ga0097620_101861331 Ga0097620_1018613312 102
272 3300009551 Ga0105238_10843313 Ga0105238_108433132 102
273 3300031649 Ga0307514_10050235 Ga0307514_100502354 102
274 3300045976 Ga0466967_1272037 Ga0466967_1272037_288_662 102
275 3300049130 Ga0501310_037734 Ga0501310_037734_39_425 102
276 3300005334 Ga0068869_100053263 Ga0068869_1000532632 103
277 3300005340 Ga0070689_100134950 Ga0070689_1001349502 103
278 3300005356 Ga0070674_100069495 Ga0070674_1000694952 103
279 3300005365 Ga0070688_100359487 Ga0070688_1003594871 103
280 3300005365 Ga0070688_100589681 Ga0070688_1005896812 103
281 3300005471 Ga0070698_100024917 Ga0070698_1000249178 103
282 3300005617 Ga0068859_100419957 Ga0068859_1004199571 103
283 3300005841 Ga0068863_100685303 Ga0068863_1006853032 103
284 3300006931 Ga0097620_100419957 Ga0097620_1004199571 103
285 3300009098 Ga0105245_10189740 Ga0105245_101897402 103
286 3300009148 Ga0105243_10056116 Ga0105243_100561164 103
287 3300013297 Ga0157378_10384805 Ga0157378_103848052 103
288 3300025927 Ga0207687_10247839 Ga0207687_102478393 103
289 3300025936 Ga0207670_10183840 Ga0207670_101838402 103
290 3300025937 Ga0207669_10039989 Ga0207669_100399892 103
291 3300025942 Ga0207689_10104975 Ga0207689_101049752 103
292 3300026088 Ga0207641_10054321 Ga0207641_100543213 103
293 3300026095 Ga0207676_10224198 Ga0207676_102241981 103
294 3300028380 Ga0268265_10256127 Ga0268265_102561272 103
295 3300028381 Ga0268264_10803706 Ga0268264_108037061 103
296 3300031507 Ga0307509_10000112 Ga0307509_1000011275 103
297 3300031507 Ga0307509_10117324 Ga0307509_101173242 103
298 3300031730 Ga0307516_10068914 Ga0307516_100689142 103
299 3300048909 Ga0496106_1456320 Ga0496106_1456320_11_385 103
300 3300053092 Ga0500583_0377595 Ga0500583_0377595_275_658 103
301 3300053103 Ga0500555_141066 Ga0500555_141066_85_474 103
302 3300004801 Ga0058860_12134580 Ga0058860_121345801 104
303 3300005530 Ga0070679_100962179 Ga0070679_1009621791 104
304 3300005539 Ga0068853_101927933 Ga0068853_1019279331 104
305 3300005548 Ga0070665_101444134 Ga0070665_1014441342 104
306 3300005617 Ga0068859_100419957 Ga0068859_1004199572 104
307 3300005618 Ga0068864_100493733 Ga0068864_1004937332 104
308 3300006028 Ga0070717_10018330 Ga0070717_100183302 104
309 3300006931 Ga0097620_100419957 Ga0097620_1004199572 104
310 3300009094 Ga0111539_10016296 Ga0111539_100162962 104
311 3300025321 Ga0207656_10463585 Ga0207656_104635852 104
312 3300025906 Ga0207699_10995624 Ga0207699_109956241 104
313 3300025918 Ga0207662_10299640 Ga0207662_102996402 104
314 3300026088 Ga0207641_10054321 Ga0207641_100543212 104
315 3300026095 Ga0207676_10224198 Ga0207676_102241982 104
316 3300027907 Ga0207428_10016333 Ga0207428_100163339 104
317 3300028379 Ga0268266_10739487 Ga0268266_107394872 104
318 3300028653 Ga0265323_10220226 Ga0265323_102202261 104
319 3300028800 Ga0265338_10180892 Ga0265338_101808923 104
320 3300031235 Ga0265330_10001538 Ga0265330_100015383 104
321 3300031344 Ga0265316_10008144 Ga0265316_100081443 104
322 3300031456 Ga0307513_10359505 Ga0307513_103595051 104
323 3300031712 Ga0265342_10305733 Ga0265342_103057332 104
324 3300035113 Ga0373936_0000006 Ga0373936_0000006_103121_103507 104
325 3300035119 Ga0373956_0148674 Ga0373956_0148674_421_804 104
326 3300035172 Ga0373955_0075526 Ga0373955_0075526_920_1303 104
327 3300035725 Ga0373947_0567815 Ga0373947_0567815_53_436 104
328 3300041461 Ga0451805_102149 Ga0451805_102149_66_437 104
329 3300047472 Ga0495686_0025181 Ga0495686_0025181_2867_3253 104
330 3300048911 Ga0496108_0218168 Ga0496108_0218168_380_763 104
331 3300049533 Ga0501317_042186 Ga0501317_042186_195_572 104
332 3300050511 nmdc:mga08y16_14232_c1 nmdc:mga08y16_14232_c1_1153_1533 104
333 3300005328 Ga0070676_10002594 Ga0070676_100025948 105
334 3300005330 Ga0070690_100117465 Ga0070690_1001174653 105
335 3300005334 Ga0068869_100015118 Ga0068869_1000151184 105
336 3300005339 Ga0070660_100072704 Ga0070660_1000727041 105
337 3300005340 Ga0070689_100652949 Ga0070689_1006529491 105
338 3300005341 Ga0070691_10097612 Ga0070691_100976122 105
339 3300005347 Ga0070668_100289401 Ga0070668_1002894013 105
340 3300005353 Ga0070669_100103891 Ga0070669_1001038912 105
341 3300005355 Ga0070671_100595966 Ga0070671_1005959662 105
342 3300005356 Ga0070674_100034146 Ga0070674_1000341462 105
343 3300005366 Ga0070659_100403920 Ga0070659_1004039202 105
344 3300005438 Ga0070701_10038918 Ga0070701_100389183 105
345 3300005440 Ga0070705_100003038 Ga0070705_1000030382 105
346 3300005444 Ga0070694_100286968 Ga0070694_1002869681 105
347 3300005456 Ga0070678_100060561 Ga0070678_1000605614 105
348 3300005457 Ga0070662_100008090 Ga0070662_1000080902 105
349 3300005459 Ga0068867_100000709 Ga0068867_1000007093 105
350 3300005467 Ga0070706_100993854 Ga0070706_1009938542 105
351 3300005530 Ga0070679_100297498 Ga0070679_1002974982 105
352 3300005535 Ga0070684_100348102 Ga0070684_1003481022 105
353 3300005539 Ga0068853_100102311 Ga0068853_1001023112 105
354 3300005544 Ga0070686_100012677 Ga0070686_1000126772 105
355 3300005616 Ga0068852_100242015 Ga0068852_1002420153 105
356 3300005617 Ga0068859_100122928 Ga0068859_1001229282 105
357 3300005718 Ga0068866_10000494 Ga0068866_1000049410 105
358 3300005719 Ga0068861_100041696 Ga0068861_1000416965 105
359 3300005841 Ga0068863_102051601 Ga0068863_1020516012 105
360 3300005842 Ga0068858_100072533 Ga0068858_1000725332 105
361 3300005843 Ga0068860_100068561 Ga0068860_1000685617 105
362 3300006177 Ga0075362_10630114 Ga0075362_106301141 105
363 3300006237 Ga0097621_100183694 Ga0097621_1001836943 105
364 3300006844 Ga0075428_100204166 Ga0075428_1002041663 105
365 3300006880 Ga0075429_100358132 Ga0075429_1003581322 105
366 3300006881 Ga0068865_100032704 Ga0068865_1000327044 105
367 3300006931 Ga0097620_100122935 Ga0097620_1001229352 105
368 3300009093 Ga0105240_10073563 Ga0105240_100735632 105
369 3300009098 Ga0105245_10081277 Ga0105245_100812772 105
370 3300009148 Ga0105243_10029435 Ga0105243_100294352 105
371 3300009174 Ga0105241_10100942 Ga0105241_101009423 105
372 3300009176 Ga0105242_10024598 Ga0105242_100245982 105
373 3300009177 Ga0105248_10091573 Ga0105248_100915732 105
374 3300009551 Ga0105238_10249273 Ga0105238_102492732 105
375 3300009553 Ga0105249_11516322 Ga0105249_115163221 105
376 3300010375 Ga0105239_10128219 Ga0105239_101282192 105
377 3300013306 Ga0163162_11429626 Ga0163162_114296262 105
378 3300013307 Ga0157372_10107716 Ga0157372_101077162 105
379 3300014745 Ga0157377_11248264 Ga0157377_112482641 105
380 3300014968 Ga0157379_10045606 Ga0157379_100456063 105
381 3300017792 Ga0163161_10014816 Ga0163161_100148162 105
382 3300025899 Ga0207642_10021290 Ga0207642_100212904 105
383 3300025903 Ga0207680_10008975 Ga0207680_100089752 105
384 3300025907 Ga0207645_10001488 Ga0207645_1000148818 105
385 3300025910 Ga0207684_10371386 Ga0207684_103713861 105
386 3300025911 Ga0207654_10039497 Ga0207654_100394972 105
387 3300025913 Ga0207695_10293964 Ga0207695_102939642 105
388 3300025919 Ga0207657_10404054 Ga0207657_104040542 105
389 3300025923 Ga0207681_10061447 Ga0207681_100614472 105
390 3300025924 Ga0207694_10343034 Ga0207694_103430342 105
391 3300025931 Ga0207644_10533861 Ga0207644_105338612 105
392 3300025933 Ga0207706_10000025 Ga0207706_1000002587 105
393 3300025934 Ga0207686_10000932 Ga0207686_1000093215 105
394 3300025935 Ga0207709_10085508 Ga0207709_100855082 105
395 3300025936 Ga0207670_10721505 Ga0207670_107215052 105
396 3300025937 Ga0207669_10118315 Ga0207669_101183152 105
397 3300025938 Ga0207704_10046483 Ga0207704_100464833 105
398 3300025941 Ga0207711_10036628 Ga0207711_100366282 105
399 3300025942 Ga0207689_10006953 Ga0207689_100069533 105
400 3300025961 Ga0207712_10908089 Ga0207712_109080892 105
401 3300025981 Ga0207640_10004934 Ga0207640_100049342 105
402 3300026041 Ga0207639_10125052 Ga0207639_101250521 105
403 3300026067 Ga0207678_10527438 Ga0207678_105274382 105
404 3300026089 Ga0207648_10003523 Ga0207648_100035235 105
405 3300026118 Ga0207675_100119945 Ga0207675_1001199452 105
406 3300026121 Ga0207683_10025790 Ga0207683_1002579013 105
407 3300026142 Ga0207698_10206145 Ga0207698_102061453 105
408 3300028381 Ga0268264_10054422 Ga0268264_100544222 105
409 3300028653 Ga0265323_10010096 Ga0265323_100100962 105
410 3300028654 Ga0265322_10001588 Ga0265322_100015882 105
411 3300031235 Ga0265330_10038180 Ga0265330_100381802 105
412 3300031238 Ga0265332_10041964 Ga0265332_100419642 105
413 3300031242 Ga0265329_10000810 Ga0265329_100008109 105
414 3300031249 Ga0265339_10039721 Ga0265339_100397213 105
415 3300031344 Ga0265316_10003476 Ga0265316_100034767 105
416 3300031507 Ga0307509_10421613 Ga0307509_104216132 105
417 3300031711 Ga0265314_10354818 Ga0265314_103548181 105
418 3300031712 Ga0265342_10002849 Ga0265342_100028495 105
419 3300033179 Ga0307507_10155075 Ga0307507_101550751 105
420 3300035692 Ga0373935_0148891 Ga0373935_0148891_1076_1462 105
421 3300041486 Ga0451807_2653739 Ga0451807_2653739_701_1078 105
422 3300042876 Ga0451577_0043022 Ga0451577_0043022_1589_1978 105
423 3300045051 Ga0451576_0321743 Ga0451576_0321743_690_1079 105
424 3300048905 Ga0496102_0119576 Ga0496102_0119576_1627_2016 105
425 3300048909 Ga0496106_0082706 Ga0496106_0082706_601_990 105
426 3300048917 Ga0496114_0024308 Ga0496114_0024308_2490_2879 105
427 3300049528 Ga0501312_071219 Ga0501312_071219_211_597 105
428 3300049571 Ga0501034_0180779 Ga0501034_0180779_176_562 105
429 3300049580 Ga0501046_0193596 Ga0501046_0193596_26_412 105
430 3300049581 Ga0501047_0054863 Ga0501047_0054863_1675_2061 105
431 3300049593 Ga0501077_0309008 Ga0501077_0309008_48_431 105
432 3300053130 Ga0500642_0031474 Ga0500642_0031474_992_1372 105
433 3300004799 Ga0058863_11695332 Ga0058863_116953321 106
434 3300005330 Ga0070690_100035259 Ga0070690_1000352592 106
435 3300005347 Ga0070668_101277357 Ga0070668_1012773571 106
436 3300005364 Ga0070673_101959658 Ga0070673_1019596582 106
437 3300005440 Ga0070705_100585101 Ga0070705_1005851012 106
438 3300005614 Ga0068856_101461059 Ga0068856_1014610592 106
439 3300005616 Ga0068852_100140853 Ga0068852_1001408533 106
440 3300007076 Ga0075435_100307300 Ga0075435_1003073002 106
441 3300009098 Ga0105245_10012171 Ga0105245_100121718 106
442 3300009098 Ga0105245_11307417 Ga0105245_113074172 106
443 3300009177 Ga0105248_11548992 Ga0105248_115489921 106
444 3300012476 Ga0157344_1002277 Ga0157344_10022771 106
445 3300012507 Ga0157342_1012942 Ga0157342_10129422 106
446 3300013104 Ga0157370_10938980 Ga0157370_109389801 106
447 3300013296 Ga0157374_10052787 Ga0157374_100527875 106
448 3300013297 Ga0157378_10186958 Ga0157378_101869582 106
449 3300014969 Ga0157376_10041717 Ga0157376_100417172 106
450 3300022467 Ga0224712_10387618 Ga0224712_103876182 106
451 3300025927 Ga0207687_10011839 Ga0207687_100118392 106
452 3300026142 Ga0207698_10121656 Ga0207698_101216562 106
453 3300028786 Ga0307517_10044430 Ga0307517_100444302 106
454 3300031731 Ga0307405_10023738 Ga0307405_100237382 106
455 3300032126 Ga0307415_100182310 Ga0307415_1001823102 106
456 3300032126 Ga0307415_100917700 Ga0307415_1009177001 106
457 3300035241 Ga0373961_0000367 Ga0373961_0000367_15256_15642 106
458 3300039437 Ga0436365_0593949 Ga0436365_0593949_18_407 106
459 3300048907 Ga0496104_0650438 Ga0496104_0650438_289_675 106
460 3300049162 Ga0501307_057851 Ga0501307_057851_191_568 106
461 3300050513 nmdc:mga0rr50_171829_c1 nmdc:mga0rr50_171829_c1_495_875 106
462 3300053090 Ga0500646_0010523 Ga0500646_0010523_1219_1605 106
463 3300053094 Ga0500566_0049878 Ga0500566_0049878_1261_1641 106
464 3300053099 Ga0500654_071919 Ga0500654_071919_621_1007 106
465 3300053108 Ga0500562_034374 Ga0500562_034374_30_416 106
466 3300004798 Ga0058859_11763832 Ga0058859_117638321 107
467 3300004800 Ga0058861_10179658 Ga0058861_101796581 107
468 3300005327 Ga0070658_10533132 Ga0070658_105331322 107
469 3300005340 Ga0070689_100039067 Ga0070689_1000390672 107
470 3300005441 Ga0070700_100087468 Ga0070700_1000874682 107
471 3300005530 Ga0070679_101277769 Ga0070679_1012777691 107
472 3300005563 Ga0068855_100373998 Ga0068855_1003739982 107
473 3300005614 Ga0068856_101099063 Ga0068856_1010990632 107
474 3300006195 Ga0075366_10430895 Ga0075366_104308952 107
475 3300006195 Ga0075366_11007148 Ga0075366_110071481 107
476 3300006844 Ga0075428_101413782 Ga0075428_1014137821 107
477 3300009094 Ga0111539_10532203 Ga0111539_105322031 107
478 3300009101 Ga0105247_10003690 Ga0105247_100036908 107
479 3300014968 Ga0157379_11105580 Ga0157379_111055801 107
480 3300025900 Ga0207710_10000970 Ga0207710_100009702 107
481 3300025917 Ga0207660_11337923 Ga0207660_113379231 107
482 3300025936 Ga0207670_10005394 Ga0207670_100053943 107
483 3300026075 Ga0207708_10130203 Ga0207708_101302032 107
484 3300026116 Ga0207674_11365689 Ga0207674_113656891 107
485 3300028556 Ga0265337_1041617 Ga0265337_10416171 107
486 3300028573 Ga0265334_10040083 Ga0265334_100400833 107
487 3300028653 Ga0265323_10000813 Ga0265323_1000081312 107
488 3300028654 Ga0265322_10056466 Ga0265322_100564661 107
489 3300028800 Ga0265338_10197518 Ga0265338_101975182 107
490 3300029957 Ga0265324_10001138 Ga0265324_100011387 107
491 3300031235 Ga0265330_10023175 Ga0265330_100231752 107
492 3300031242 Ga0265329_10003030 Ga0265329_100030303 107
493 3300031249 Ga0265339_10000001 Ga0265339_10000001279 107
494 3300031249 Ga0265339_10182652 Ga0265339_101826521 107
495 3300031344 Ga0265316_10003553 Ga0265316_100035537 107
496 3300031595 Ga0265313_10006342 Ga0265313_100063428 107
497 3300031711 Ga0265314_10002901 Ga0265314_1000290115 107
498 3300031712 Ga0265342_10095154 Ga0265342_100951542 107
499 3300031731 Ga0307405_10653444 Ga0307405_106534442 107
500 3300033524 Ga0316592_1168513 Ga0316592_11685131 107
501 3300039438 Ga0436360_1132549 Ga0436360_1132549_162_548 107
502 3300044694 Ga0466963_0142576 Ga0466963_0142576_34_426 107
503 3300044706 Ga0466964_0229274 Ga0466964_0229274_487_879 107
504 3300044712 Ga0453684_1466812 Ga0453684_1466812_71_460 107
505 3300045049 Ga0466959_0031428 Ga0466959_0031428_2802_3194 107
506 3300047472 Ga0495686_0025181 Ga0495686_0025181_3386_3766 107
507 3300047472 Ga0495686_0045414 Ga0495686_0045414_2108_2488 107
508 3300049162 Ga0501307_005813 Ga0501307_005813_246_629 107
509 3300049539 Ga0501323_029790 Ga0501323_029790_68_454 107
510 3300049569 Ga0501032_0358963 Ga0501032_0358963_379_768 107
511 3300049572 Ga0501036_0031623 Ga0501036_0031623_3138_3530 107
512 3300049585 Ga0501069_0028958 Ga0501069_0028958_72_452 107
513 3300049585 Ga0501069_0053468 Ga0501069_0053468_1641_2021 107
514 3300049586 Ga0501070_0038089 Ga0501070_0038089_172_552 107
515 3300049586 Ga0501070_0072970 Ga0501070_0072970_637_1029 107
516 3300049586 Ga0501070_0548583 Ga0501070_0548583_173_553 107
517 3300049587 Ga0501071_0066878 Ga0501071_0066878_1602_1982 107
518 3300049588 Ga0501072_1083997 Ga0501072_1083997_150_530 107
519 3300049590 Ga0501074_0022208 Ga0501074_0022208_2858_3250 107
520 3300049741 Ga0501079_0159978 Ga0501079_0159978_1054_1446 107
521 3300049742 Ga0501080_0063062 Ga0501080_0063062_417_809 107
522 3300049743 Ga0501081_0386188 Ga0501081_0386188_220_612 107
523 3300049744 Ga0501083_0027701 Ga0501083_0027701_639_1019 107
524 3300050493 nmdc:mga0k408_572499_c1 nmdc:mga0k408_572499_c1_191_568 107
525 3300050493 nmdc:mga0k408_839934_c1 nmdc:mga0k408_839934_c1_124_507 107
526 3300050511 nmdc:mga08y16_684200_c1 nmdc:mga08y16_684200_c1_285_665 107
527 3300053093 Ga0500651_0494703 Ga0500651_0494703_33_416 107
528 3300053120 Ga0500597_157237 Ga0500597_157237_153_536 107
529 3300053123 Ga0500614_006909 Ga0500614_006909_1093_1476 107
530 3300060353 Ga0501082_0057753 Ga0501082_0057753_729_1121 107
531 3300060353 Ga0501082_0406418 Ga0501082_0406418_789_1169 107
532 3300004798 Ga0058859_10064973 Ga0058859_100649732 108
533 3300004799 Ga0058863_10166919 Ga0058863_101669191 108
534 3300004800 Ga0058861_10180125 Ga0058861_101801252 108
535 3300004801 Ga0058860_12162593 Ga0058860_121625932 108
536 3300004803 Ga0058862_10209411 Ga0058862_102094112 108
537 3300005329 Ga0070683_100098230 Ga0070683_1000982305 108
538 3300005334 Ga0068869_100053263 Ga0068869_1000532633 108
539 3300005336 Ga0070680_100451887 Ga0070680_1004518872 108
540 3300005337 Ga0070682_100167591 Ga0070682_1001675912 108
541 3300005338 Ga0068868_100862151 Ga0068868_1008621511 108
542 3300005343 Ga0070687_100037795 Ga0070687_1000377953 108
543 3300005365 Ga0070688_100359487 Ga0070688_1003594872 108
544 3300005438 Ga0070701_10034508 Ga0070701_100345084 108
545 3300005441 Ga0070700_100520294 Ga0070700_1005202942 108
546 3300005535 Ga0070684_100054146 Ga0070684_1000541464 108
547 3300005547 Ga0070693_100620876 Ga0070693_1006208761 108
548 3300005577 Ga0068857_100394141 Ga0068857_1003941412 108
549 3300005614 Ga0068856_100656433 Ga0068856_1006564332 108
550 3300005617 Ga0068859_101686387 Ga0068859_1016863872 108
551 3300005718 Ga0068866_10277600 Ga0068866_102776002 108
552 3300005719 Ga0068861_101137646 Ga0068861_1011376462 108
553 3300005843 Ga0068860_100879434 Ga0068860_1008794342 108
554 3300005844 Ga0068862_101190978 Ga0068862_1011909782 108
555 3300006931 Ga0097620_101686139 Ga0097620_1016861391 108
556 3300009093 Ga0105240_10000795 Ga0105240_1000079540 108
557 3300009094 Ga0111539_10217903 Ga0111539_102179034 108
558 3300009098 Ga0105245_10189740 Ga0105245_101897403 108
559 3300009148 Ga0105243_10056116 Ga0105243_100561163 108
560 3300011119 Ga0105246_11360627 Ga0105246_113606271 108
561 3300013105 Ga0157369_10347380 Ga0157369_103473802 108
562 3300013297 Ga0157378_10031351 Ga0157378_100313516 108
563 3300013307 Ga0157372_10190087 Ga0157372_101900872 108
564 3300014325 Ga0163163_10553785 Ga0163163_105537851 108
565 3300014969 Ga0157376_10253591 Ga0157376_102535912 108
566 3300020070 Ga0206356_10155774 Ga0206356_101557741 108
567 3300020070 Ga0206356_10445605 Ga0206356_104456052 108
568 3300020078 Ga0206352_11159890 Ga0206352_111598902 108
569 3300020078 Ga0206352_11360316 Ga0206352_113603163 108
570 3300025899 Ga0207642_10989180 Ga0207642_109891801 108
571 3300025912 Ga0207707_10980627 Ga0207707_109806271 108
572 3300025913 Ga0207695_10011622 Ga0207695_100116223 108
573 3300025917 Ga0207660_11141456 Ga0207660_111414562 108
574 3300025918 Ga0207662_10053691 Ga0207662_100536912 108
575 3300025921 Ga0207652_10186689 Ga0207652_101866892 108
576 3300025924 Ga0207694_10186966 Ga0207694_101869662 108
577 3300025927 Ga0207687_10247839 Ga0207687_102478392 108
578 3300025935 Ga0207709_10320751 Ga0207709_103207512 108
579 3300025942 Ga0207689_10104975 Ga0207689_101049753 108
580 3300025944 Ga0207661_10053133 Ga0207661_100531333 108
581 3300026075 Ga0207708_10496663 Ga0207708_104966632 108
582 3300026078 Ga0207702_10111508 Ga0207702_101115082 108
583 3300026088 Ga0207641_10257739 Ga0207641_102577393 108
584 3300026116 Ga0207674_10103448 Ga0207674_101034484 108
585 3300026118 Ga0207675_100198537 Ga0207675_1001985373 108
586 3300028380 Ga0268265_10256127 Ga0268265_102561273 108
587 3300028381 Ga0268264_10803706 Ga0268264_108037062 108
588 3300028794 Ga0307515_10019188 Ga0307515_100191884 108
589 3300031240 Ga0265320_10334821 Ga0265320_103348211 108
590 3300031727 Ga0316576_10085280 Ga0316576_100852803 108
591 3300033524 Ga0316592_1034587 Ga0316592_10345872 108
592 3300033524 Ga0316592_1077059 Ga0316592_10770591 108
593 3300033527 Ga0316586_1042064 Ga0316586_10420641 108
594 3300033527 Ga0316586_1047656 Ga0316586_10476561 108
595 3300033528 Ga0316588_1000219 Ga0316588_10002199 108
596 3300033528 Ga0316588_1010779 Ga0316588_10107792 108
597 3300033529 Ga0316587_1028265 Ga0316587_10282651 108
598 3300034818 Ga0373950_0000077 Ga0373950_0000077_4675_5061 108
599 3300035090 Ga0373949_0000225 Ga0373949_0000225_2936_3316 108
600 3300039450 Ga0436363_0308745 Ga0436363_0308745_471_860 108
601 3300045051 Ga0451576_0037161 Ga0451576_0037161_2968_3351 108
602 3300046471 Ga0495650_0287647 Ga0495650_0287647_72_452 108
603 3300046500 Ga0495596_0287436 Ga0495596_0287436_22_402 108
604 3300046516 Ga0495628_0961816 Ga0495628_0961816_34_420 108
605 3300048910 Ga0496107_0919005 Ga0496107_0919005_139_528 108
606 3300048912 Ga0496109_1352099 Ga0496109_1352099_14_403 108
607 3300048915 Ga0496112_0007223 Ga0496112_0007223_1430_1819 108
608 3300049572 Ga0501036_0632006 Ga0501036_0632006_483_869 108
609 3300049589 Ga0501073_0030016 Ga0501073_0030016_341_730 108
610 3300050511 nmdc:mga08y16_443260_c1 nmdc:mga08y16_443260_c1_476_862 108
611 3300053092 Ga0500583_0112280 Ga0500583_0112280_741_1121 108
612 3300053130 Ga0500642_0007926 Ga0500642_0007926_347_727 108
613 3300002863 Ga0006769J43182_102873 Ga0006769J43182_1028731 109
614 3300002868 Ga0006767J43181_102926 Ga0006767J43181_1029267 109
615 3300002870 Ga0006763J43179_103249 Ga0006763J43179_1032496 109
616 3300002872 Ga0006762J43184_101278 Ga0006762J43184_1012781 109
617 3300003158 Ga0006760J45825_102611 Ga0006760J45825_1026113 109
618 3300003159 Ga0006771J45828_104384 Ga0006771J45828_1043841 109
619 3300003161 Ga0006765J45826_106834 Ga0006765J45826_1068341 109
620 3300003162 Ga0006778J45830_1038270 Ga0006778J45830_10382702 109
621 3300003163 Ga0006759J45824_1005533 Ga0006759J45824_10055338 109
622 3300003163 Ga0006759J45824_1187716 Ga0006759J45824_11877162 109
623 3300003284 Ga0006773J48901_13004 Ga0006773J48901_130041 109
624 3300003300 Ga0006758J48902_1007634 Ga0006758J48902_10076347 109
625 3300003305 Ga0006770J48903_1018629 Ga0006770J48903_10186292 109
626 3300003544 Ga0007417J51691_1046473 Ga0007417J51691_10464731 109
627 3300003574 Ga0007410J51695_1075587 Ga0007410J51695_10755871 109
628 3300003574 Ga0007410J51695_1111274 Ga0007410J51695_11112742 109
629 3300003693 Ga0032354_1006912 Ga0032354_10069127 109
630 3300003717 Ga0006766_112346 Ga0006766_1123461 109
631 3300004798 Ga0058859_11763153 Ga0058859_117631531 109
632 3300004798 Ga0058859_11787064 Ga0058859_117870641 109
633 3300004799 Ga0058863_10018461 Ga0058863_100184612 109
634 3300004799 Ga0058863_10049786 Ga0058863_100497861 109
635 3300004799 Ga0058863_10078913 Ga0058863_100789132 109
636 3300004799 Ga0058863_10129461 Ga0058863_101294611 109
637 3300004800 Ga0058861_10048978 Ga0058861_100489783 109
638 3300004800 Ga0058861_10116376 Ga0058861_101163761 109
639 3300004800 Ga0058861_11984899 Ga0058861_119848991 109
640 3300004801 Ga0058860_12066015 Ga0058860_120660151 109
641 3300004803 Ga0058862_10025574 Ga0058862_100255741 109
642 3300004803 Ga0058862_10108482 Ga0058862_101084822 109
643 3300004803 Ga0058862_10288134 Ga0058862_102881342 109
644 3300005327 Ga0070658_11145262 Ga0070658_111452621 109
645 3300005329 Ga0070683_100543254 Ga0070683_1005432542 109
646 3300005329 Ga0070683_100729654 Ga0070683_1007296542 109
647 3300005335 Ga0070666_11110873 Ga0070666_111108732 109
648 3300005336 Ga0070680_100494220 Ga0070680_1004942202 109
649 3300005338 Ga0068868_100065914 Ga0068868_1000659142 109
650 3300005340 Ga0070689_100782984 Ga0070689_1007829841 109
651 3300005341 Ga0070691_10166060 Ga0070691_101660602 109
652 3300005356 Ga0070674_100287914 Ga0070674_1002879142 109
653 3300005456 Ga0070678_100195566 Ga0070678_1001955662 109
654 3300005458 Ga0070681_10168536 Ga0070681_101685363 109
655 3300005459 Ga0068867_100124906 Ga0068867_1001249062 109
656 3300005530 Ga0070679_100218948 Ga0070679_1002189483 109
657 3300005530 Ga0070679_100407351 Ga0070679_1004073511 109
658 3300005535 Ga0070684_100304971 Ga0070684_1003049712 109
659 3300005535 Ga0070684_100340394 Ga0070684_1003403941 109
660 3300005546 Ga0070696_101371579 Ga0070696_1013715791 109
661 3300005563 Ga0068855_101868494 Ga0068855_1018684941 109
662 3300005614 Ga0068856_100204627 Ga0068856_1002046272 109
663 3300005614 Ga0068856_100334387 Ga0068856_1003343872 109
664 3300005614 Ga0068856_100374426 Ga0068856_1003744262 109
665 3300005618 Ga0068864_100180649 Ga0068864_1001806492 109
666 3300005718 Ga0068866_10205223 Ga0068866_102052232 109
667 3300005840 Ga0068870_11109853 Ga0068870_111098531 109
668 3300006237 Ga0097621_100100789 Ga0097621_1001007892 109
669 3300006358 Ga0068871_100028407 Ga0068871_1000284079 109
670 3300006852 Ga0075433_10369358 Ga0075433_103693581 109
671 3300006881 Ga0068865_100058801 Ga0068865_1000588011 109
672 3300006881 Ga0068865_101225941 Ga0068865_1012259412 109
673 3300009094 Ga0111539_10662820 Ga0111539_106628202 109
674 3300009147 Ga0114129_12390434 Ga0114129_123904341 109
675 3300009148 Ga0105243_12302616 Ga0105243_123026161 109
676 3300009176 Ga0105242_10097645 Ga0105242_100976453 109
677 3300009176 Ga0105242_10102984 Ga0105242_101029844 109
678 3300013104 Ga0157370_12087428 Ga0157370_120874281 109
679 3300013296 Ga0157374_10340056 Ga0157374_103400562 109
680 3300013308 Ga0157375_11110152 Ga0157375_111101522 109
681 3300020078 Ga0206352_10440647 Ga0206352_104406472 109
682 3300020078 Ga0206352_10458663 Ga0206352_104586631 109
683 3300025899 Ga0207642_10094851 Ga0207642_100948512 109
684 3300025912 Ga0207707_10216497 Ga0207707_102164972 109
685 3300025912 Ga0207707_10542140 Ga0207707_105421402 109
686 3300025914 Ga0207671_10307218 Ga0207671_103072182 109
687 3300025917 Ga0207660_10222965 Ga0207660_102229653 109
688 3300025917 Ga0207660_10374121 Ga0207660_103741212 109
689 3300025921 Ga0207652_10117930 Ga0207652_101179303 109
690 3300025921 Ga0207652_10322615 Ga0207652_103226151 109
691 3300025921 Ga0207652_10470139 Ga0207652_104701391 109
692 3300025934 Ga0207686_10098042 Ga0207686_100980423 109
693 3300025934 Ga0207686_10237389 Ga0207686_102373892 109
694 3300025938 Ga0207704_10084243 Ga0207704_100842431 109
695 3300025944 Ga0207661_11187380 Ga0207661_111873801 109
696 3300025981 Ga0207640_11105396 Ga0207640_111053962 109
697 3300026023 Ga0207677_10043856 Ga0207677_100438564 109
698 3300026089 Ga0207648_10088131 Ga0207648_100881313 109
699 3300026095 Ga0207676_10138487 Ga0207676_101384872 109
700 3300026121 Ga0207683_10025820 Ga0207683_100258202 109
701 3300030863 Ga0265766_1003084 Ga0265766_10030841 109
702 3300030882 Ga0265764_106806 Ga0265764_1068061 109
703 3300030888 Ga0265769_114939 Ga0265769_1149391 109
704 3300030963 Ga0265768_104375 Ga0265768_1043752 109
705 3300031727 Ga0316576_10169449 Ga0316576_101694492 109
706 3300031727 Ga0316576_11090246 Ga0316576_110902461 109
707 3300033524 Ga0316592_1015053 Ga0316592_10150533 109
708 3300033528 Ga0316588_1039464 Ga0316588_10394642 109
709 3300033528 Ga0316588_1167374 Ga0316588_11673741 109
710 3300036457 Ga0265778_001330 Ga0265778_001330_781_1167 109
711 3300039437 Ga0436365_0629347 Ga0436365_0629347_393_779 109
712 3300039447 Ga0436361_0484302 Ga0436361_0484302_3318_3713 109
713 3300041453 Ga0451797_0755971 Ga0451797_0755971_120_503 109
714 3300042876 Ga0451577_0035060 Ga0451577_0035060_2166_2555 109
715 3300044673 Ga0453683_0072285 Ga0453683_0072285_812_1198 109
716 3300044712 Ga0453684_0000116 Ga0453684_0000116_232739_233128 109
717 3300044712 Ga0453684_0298379 Ga0453684_0298379_998_1387 109
718 3300044842 Ga0466957_0850078 Ga0466957_0850078_125_514 109
719 3300045051 Ga0451576_0118318 Ga0451576_0118318_2109_2498 109
720 3300046679 Ga0495623_0163091 Ga0495623_0163091_895_1281 109
721 3300047322 Ga0495680_0863936 Ga0495680_0863936_177_563 109
722 3300047444 Ga0495675_0080546 Ga0495675_0080546_670_1056 109
723 3300048918 Ga0496115_0220972 Ga0496115_0220972_966_1355 109
724 3300049129 Ga0501309_062099 Ga0501309_062099_124_513 109
725 3300049529 Ga0501313_042794 Ga0501313_042794_191_580 109
726 3300049571 Ga0501034_0058539 Ga0501034_0058539_877_1263 109
727 3300050515 nmdc:mga0a205_215651_c1 nmdc:mga0a205_215651_c1_1321_1707 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00542

Ribosomal_L12

Ribosomal protein L7/L12 C-terminal domain

63

129

0.99

PF16320

Ribosomal_L12_N

Ribosomal protein L7/L12 dimerisation domain

5

59

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ctf-assembly1.cif.gz_A-2 structure of the c-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms 0.9772 42 109
1ctf-assembly1.cif.gz_A-2 structure of the c-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms 0.9634 42 109
4v5n-assembly1.cif.gz_BL trna translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post) 0.938 44 109
8phj-assembly1.cif.gz_W ca4-bound cami1 in complex with 70s ribosome 0.9352 44 107
1rqs-assembly1.cif.gz_A nmr structure of c-terminal domain of ribosomal protein l7 from e.coli 0.9336 42 109
ID Description Score Start End Superfamily
af_P9WHE3_59_130_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.988 42 109 3.30.1390.10
1ctfA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9772 42 109 3.30.1390.10
1ctfA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9634 42 109 3.30.1390.10
af_P36211_122_192_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9581 40 108 3.30.1390.10
af_Q86KA1_110_181_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9456 42 107 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A7V7WYQ4-F1-model_v4 50S ribosomal protein L7/L12 1.005 42 109 GO:0003729
GO:0003735
GO:0006412
GO:0022625
AF-F3CFJ1-F1-model_v4 50S ribosomal protein L7/L12 1.003 42 109 GO:0003729
GO:0003735
GO:0006412
GO:0022625
AF-A0A1G1ZFH1-F1-model_v4 50S ribosomal protein L7/L12 1.001 42 109 GO:0003729
GO:0003735
GO:0006412
GO:0022625
AF-A0A7X9CZI0-F1-model_v4 50S ribosomal protein L7/L12 1.001 42 109 GO:0003729
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4S8PCP5-F1-model_v4 Ribosomal protein L7/L12 0.9997 42 109 GO:0003729
GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
78.95 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map