F477722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 305 | 714 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300004799|Ga0058863_10049786|Ga0058863_100497861 |
| Length | 129 |
| Sequence | MADVNMDQIIDQLSNLTVMQIADLTKKLEEKWGVKAAPVAVAGVGGPAASGAPAEAAAEKTEFTVILSNAGGNKIQVIKAIREITNLGLKEAKDLVDGAPKEIKAGVSKDDAENIKKKIAEAGGTVEIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002863 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003159 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003284 | Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 211 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 235 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 296 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 297 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 298 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 304 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.41 |
| Metatranscriptomes | 10.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.34 |
| Nodule | 0 |
| Rhizoplane | 2.2 |
| Rhizosphere | 92.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006769J43182_102873 | 3300002863 | Bacteria | 598 |
| 2 | Ga0006767J43181_102926 | 3300002868 | Bacteria | 7905 |
| 3 | Ga0006763J43179_103249 | 3300002870 | Bacteria | 4479 |
| 4 | Ga0006762J43184_101278 | 3300002872 | Bacteria | 726 |
| 5 | Ga0006760J45825_102611 | 3300003158 | Bacteria | 1446 |
| 6 | Ga0006771J45828_104384 | 3300003159 | Bacteria | 555 |
| 7 | Ga0006765J45826_106834 | 3300003161 | Bacteria | 1405 |
| 8 | Ga0006778J45830_1038270 | 3300003162 | Bacteria | 1578 |
| 9 | Ga0006759J45824_1005533 | 3300003163 | Bacteria | 3794 |
| 10 | Ga0006759J45824_1187716 | 3300003163 | Bacteria | 634 |
| 11 | Ga0006773J48901_13004 | 3300003284 | Bacteria | 610 |
| 12 | Ga0006758J48902_1007634 | 3300003300 | Bacteria | 7937 |
| 13 | Ga0006770J48903_1018629 | 3300003305 | Bacteria | 2226 |
| 14 | Ga0007417J51691_1046473 | 3300003544 | Bacteria | 687 |
| 15 | Ga0007410J51695_1075587 | 3300003574 | Bacteria | 632 |
| 16 | Ga0007410J51695_1111274 | 3300003574 | Bacteria | 638 |
| 17 | Ga0032354_1006912 | 3300003693 | Bacteria | 8240 |
| 18 | Ga0006766_112346 | 3300003717 | Bacteria | 503 |
| 19 | Ga0058859_10064973 | 3300004798 | Bacteria | 1930 |
| 20 | Ga0058859_11763153 | 3300004798 | Bacteria | 513 |
| 21 | Ga0058859_11763832 | 3300004798 | Bacteria | 502 |
| 22 | Ga0058859_11787064 | 3300004798 | Bacteria | 868 |
| 23 | Ga0058863_10018461 | 3300004799 | Bacteria | 849 |
| 24 | Ga0058863_10049786 | 3300004799 | Bacteria | 1035 |
| 25 | Ga0058863_10078913 | 3300004799 | Bacteria | 2674 |
| 26 | Ga0058863_10129461 | 3300004799 | Bacteria | 784 |
| 27 | Ga0058863_10166919 | 3300004799 | Bacteria | 1085 |
| 28 | Ga0058863_11695332 | 3300004799 | Bacteria | 619 |
| 29 | Ga0058861_10048978 | 3300004800 | Bacteria | 1375 |
| 30 | Ga0058861_10116376 | 3300004800 | Bacteria | 1167 |
| 31 | Ga0058861_10179658 | 3300004800 | Bacteria | 681 |
| 32 | Ga0058861_10180125 | 3300004800 | Bacteria | 1113 |
| 33 | Ga0058861_11984899 | 3300004800 | Bacteria | 751 |
| 34 | Ga0058860_12066015 | 3300004801 | Bacteria | 582 |
| 35 | Ga0058860_12134580 | 3300004801 | Bacteria | 608 |
| 36 | Ga0058860_12162593 | 3300004801 | Bacteria | 769 |
| 37 | Ga0058862_10025574 | 3300004803 | Bacteria | 988 |
| 38 | Ga0058862_10108482 | 3300004803 | Bacteria | 1795 |
| 39 | Ga0058862_10209411 | 3300004803 | Bacteria | 1121 |
| 40 | Ga0058862_10288134 | 3300004803 | Bacteria | 2172 |
| 41 | Ga0058862_12833164 | 3300004803 | Bacteria | 664 |
| 42 | Ga0070658_10072868 | 3300005327 | Bacteria | 2815 |
| 43 | Ga0070658_10533132 | 3300005327 | Bacteria | 1015 |
| 44 | Ga0070658_11145262 | 3300005327 | Bacteria | 676 |
| 45 | Ga0070676_10002594 | 3300005328 | Bacteria | 9296 |
| 46 | Ga0070683_100025558 | 3300005329 | Bacteria | 5305 |
| 47 | Ga0070683_100098230 | 3300005329 | Bacteria | 2755 |
| 48 | Ga0070683_100458546 | 3300005329 | Bacteria | 1216 |
| 49 | Ga0070683_100543254 | 3300005329 | Bacteria | 1111 |
| 50 | Ga0070683_100729654 | 3300005329 | Bacteria | 949 |
| 51 | Ga0070683_101493666 | 3300005329 | Bacteria | 649 |
| 52 | Ga0070690_100035259 | 3300005330 | Bacteria | 3138 |
| 53 | Ga0070690_100117465 | 3300005330 | Bacteria | 1782 |
| 54 | Ga0068869_100015118 | 3300005334 | Bacteria | 5168 |
| 55 | Ga0068869_100053263 | 3300005334 | Bacteria | 2941 |
| 56 | Ga0068869_100578358 | 3300005334 | Bacteria | 947 |
| 57 | Ga0068869_101156998 | 3300005334 | Bacteria | 678 |
| 58 | Ga0070666_10105484 | 3300005335 | Bacteria | 1946 |
| 59 | Ga0070666_11110873 | 3300005335 | Bacteria | 588 |
| 60 | Ga0070680_100353017 | 3300005336 | Bacteria | 1250 |
| 61 | Ga0070680_100451887 | 3300005336 | Bacteria | 1097 |
| 62 | Ga0070680_100494220 | 3300005336 | Bacteria | 1046 |
| 63 | Ga0070680_100655247 | 3300005336 | Bacteria | 902 |
| 64 | Ga0070682_100167591 | 3300005337 | Bacteria | 1523 |
| 65 | Ga0068868_100018827 | 3300005338 | Bacteria | 5166 |
| 66 | Ga0068868_100065914 | 3300005338 | Bacteria | 2878 |
| 67 | Ga0068868_100717195 | 3300005338 | Bacteria | 896 |
| 68 | Ga0068868_100862151 | 3300005338 | Bacteria | 821 |
| 69 | Ga0070660_100007877 | 3300005339 | Bacteria | 7430 |
| 70 | Ga0070660_100072704 | 3300005339 | Bacteria | 2688 |
| 71 | Ga0070689_100039067 | 3300005340 | Bacteria | 3633 |
| 72 | Ga0070689_100134950 | 3300005340 | Bacteria | 1981 |
| 73 | Ga0070689_100366864 | 3300005340 | Bacteria | 1211 |
| 74 | Ga0070689_100652949 | 3300005340 | Bacteria | 915 |
| 75 | Ga0070689_100782984 | 3300005340 | Bacteria | 838 |
| 76 | Ga0070691_10000755 | 3300005341 | Bacteria | 12780 |
| 77 | Ga0070691_10097612 | 3300005341 | Bacteria | 1456 |
| 78 | Ga0070691_10166060 | 3300005341 | Bacteria | 1141 |
| 79 | Ga0070687_100037795 | 3300005343 | Bacteria | 2415 |
| 80 | Ga0070661_100042849 | 3300005344 | Bacteria | 3305 |
| 81 | Ga0070668_100289401 | 3300005347 | Bacteria | 1371 |
| 82 | Ga0070668_101029542 | 3300005347 | Bacteria | 741 |
| 83 | Ga0070668_101277357 | 3300005347 | Bacteria | 667 |
| 84 | Ga0070669_100103891 | 3300005353 | Bacteria | 2147 |
| 85 | Ga0070671_100180145 | 3300005355 | Bacteria | 1789 |
| 86 | Ga0070671_100595966 | 3300005355 | Bacteria | 955 |
| 87 | Ga0070674_100034146 | 3300005356 | Bacteria | 3394 |
| 88 | Ga0070674_100069495 | 3300005356 | Bacteria | 2485 |
| 89 | Ga0070674_100287914 | 3300005356 | Bacteria | 1305 |
| 90 | Ga0070673_101959658 | 3300005364 | Bacteria | 556 |
| 91 | Ga0070688_100359487 | 3300005365 | Bacteria | 1068 |
| 92 | Ga0070688_100589681 | 3300005365 | Bacteria | 849 |
| 93 | Ga0070688_100645216 | 3300005365 | Bacteria | 815 |
| 94 | Ga0070659_100260883 | 3300005366 | Bacteria | 1438 |
| 95 | Ga0070659_100403920 | 3300005366 | Bacteria | 1154 |
| 96 | Ga0070667_100571196 | 3300005367 | Bacteria | 1040 |
| 97 | Ga0070713_102030769 | 3300005436 | Bacteria | 557 |
| 98 | Ga0070701_10034508 | 3300005438 | Bacteria | 2534 |
| 99 | Ga0070701_10038918 | 3300005438 | Bacteria | 2409 |
| 100 | Ga0070705_100003038 | 3300005440 | Bacteria | 8279 |
| 101 | Ga0070705_100585101 | 3300005440 | Bacteria | 861 |
| 102 | Ga0070700_100087468 | 3300005441 | Bacteria | 2025 |
| 103 | Ga0070700_100520294 | 3300005441 | Bacteria | 919 |
| 104 | Ga0070694_100286968 | 3300005444 | Bacteria | 1257 |
| 105 | Ga0070663_100427185 | 3300005455 | Bacteria | 1088 |
| 106 | Ga0070678_100060561 | 3300005456 | Bacteria | 2787 |
| 107 | Ga0070678_100195566 | 3300005456 | Bacteria | 1665 |
| 108 | Ga0070662_100008090 | 3300005457 | Bacteria | 6845 |
| 109 | Ga0070681_10005341 | 3300005458 | Bacteria | 12402 |
| 110 | Ga0070681_10168536 | 3300005458 | Bacteria | 2112 |
| 111 | Ga0068867_100000709 | 3300005459 | Bacteria | 22216 |
| 112 | Ga0068867_100124906 | 3300005459 | Bacteria | 1993 |
| 113 | Ga0068867_100168337 | 3300005459 | Bacteria | 1733 |
| 114 | Ga0070685_10393371 | 3300005466 | Bacteria | 958 |
| 115 | Ga0070706_100993854 | 3300005467 | Bacteria | 774 |
| 116 | Ga0070698_100024917 | 3300005471 | Bacteria | 6236 |
| 117 | Ga0070699_100015032 | 3300005518 | Bacteria | 6652 |
| 118 | Ga0070679_100003781 | 3300005530 | Bacteria | 13889 |
| 119 | Ga0070679_100218948 | 3300005530 | Bacteria | 1865 |
| 120 | Ga0070679_100297498 | 3300005530 | Bacteria | 1565 |
| 121 | Ga0070679_100387283 | 3300005530 | Bacteria | 1344 |
| 122 | Ga0070679_100407351 | 3300005530 | Bacteria | 1305 |
| 123 | Ga0070679_100962179 | 3300005530 | Bacteria | 797 |
| 124 | Ga0070679_101277769 | 3300005530 | Bacteria | 679 |
| 125 | Ga0070684_100054146 | 3300005535 | Bacteria | 3495 |
| 126 | Ga0070684_100057972 | 3300005535 | Bacteria | 3382 |
| 127 | Ga0070684_100085526 | 3300005535 | Bacteria | 2797 |
| 128 | Ga0070684_100241732 | 3300005535 | Bacteria | 1649 |
| 129 | Ga0070684_100304971 | 3300005535 | Bacteria | 1461 |
| 130 | Ga0070684_100340394 | 3300005535 | Bacteria | 1379 |
| 131 | Ga0070684_100348102 | 3300005535 | Bacteria | 1363 |
| 132 | Ga0070684_100446964 | 3300005535 | Bacteria | 1194 |
| 133 | Ga0070684_101975018 | 3300005535 | Bacteria | 551 |
| 134 | Ga0068853_100010638 | 3300005539 | Bacteria | 7444 |
| 135 | Ga0068853_100060122 | 3300005539 | Bacteria | 3282 |
| 136 | Ga0068853_100102311 | 3300005539 | Bacteria | 2535 |
| 137 | Ga0068853_100235147 | 3300005539 | Bacteria | 1677 |
| 138 | Ga0068853_100462306 | 3300005539 | Bacteria | 1194 |
| 139 | Ga0068853_101090780 | 3300005539 | Bacteria | 770 |
| 140 | Ga0068853_101927933 | 3300005539 | Bacteria | 573 |
| 141 | Ga0070686_100012677 | 3300005544 | Bacteria | 4808 |
| 142 | Ga0070696_101140106 | 3300005546 | Bacteria | 657 |
| 143 | Ga0070696_101371579 | 3300005546 | Bacteria | 602 |
| 144 | Ga0070693_100168531 | 3300005547 | Bacteria | 1400 |
| 145 | Ga0070693_100620876 | 3300005547 | Bacteria | 783 |
| 146 | Ga0070665_100178042 | 3300005548 | Bacteria | 2127 |
| 147 | Ga0070665_100586592 | 3300005548 | Bacteria | 1127 |
| 148 | Ga0070665_101444134 | 3300005548 | Bacteria | 697 |
| 149 | Ga0068855_100033833 | 3300005563 | Bacteria | 6097 |
| 150 | Ga0068855_100146442 | 3300005563 | Bacteria | 2688 |
| 151 | Ga0068855_100373998 | 3300005563 | Bacteria | 1565 |
| 152 | Ga0068855_100735843 | 3300005563 | Bacteria | 1053 |
| 153 | Ga0068855_101868494 | 3300005563 | Bacteria | 609 |
| 154 | Ga0068857_100003025 | 3300005577 | Bacteria | 13896 |
| 155 | Ga0068857_100042568 | 3300005577 | Bacteria | 4030 |
| 156 | Ga0068857_100127402 | 3300005577 | Bacteria | 2294 |
| 157 | Ga0068857_100394141 | 3300005577 | Bacteria | 1288 |
| 158 | Ga0068854_100331442 | 3300005578 | Bacteria | 1240 |
| 159 | Ga0068856_100000278 | 3300005614 | Bacteria | 55608 |
| 160 | Ga0068856_100139794 | 3300005614 | Bacteria | 2428 |
| 161 | Ga0068856_100204627 | 3300005614 | Bacteria | 1988 |
| 162 | Ga0068856_100334387 | 3300005614 | Bacteria | 1532 |
| 163 | Ga0068856_100374426 | 3300005614 | Bacteria | 1443 |
| 164 | Ga0068856_100656433 | 3300005614 | Bacteria | 1069 |
| 165 | Ga0068856_101099063 | 3300005614 | Bacteria | 812 |
| 166 | Ga0068856_101404634 | 3300005614 | Bacteria | 712 |
| 167 | Ga0068856_101461059 | 3300005614 | Bacteria | 698 |
| 168 | Ga0070702_100288555 | 3300005615 | Bacteria | 1130 |
| 169 | Ga0068852_100116427 | 3300005616 | Bacteria | 2438 |
| 170 | Ga0068852_100140853 | 3300005616 | Bacteria | 2232 |
| 171 | Ga0068852_100242015 | 3300005616 | Bacteria | 1725 |
| 172 | Ga0068859_100089831 | 3300005617 | Bacteria | 3122 |
| 173 | Ga0068859_100122928 | 3300005617 | Bacteria | 2662 |
| 174 | Ga0068859_100419957 | 3300005617 | Bacteria | 1434 |
| 175 | Ga0068859_100942883 | 3300005617 | Bacteria | 947 |
| 176 | Ga0068859_101686387 | 3300005617 | Bacteria | 700 |
| 177 | Ga0068859_101861302 | 3300005617 | Bacteria | 665 |
| 178 | Ga0068864_100180649 | 3300005618 | Bacteria | 1929 |
| 179 | Ga0068864_100493733 | 3300005618 | Bacteria | 1177 |
| 180 | Ga0068864_101188960 | 3300005618 | Bacteria | 761 |
| 181 | Ga0068866_10000494 | 3300005718 | Bacteria | 18128 |
| 182 | Ga0068866_10078882 | 3300005718 | Bacteria | 1763 |
| 183 | Ga0068866_10205223 | 3300005718 | Bacteria | 1180 |
| 184 | Ga0068866_10277600 | 3300005718 | Bacteria | 1037 |
| 185 | Ga0068861_100041696 | 3300005719 | Bacteria | 3438 |
| 186 | Ga0068861_100428210 | 3300005719 | Bacteria | 1180 |
| 187 | Ga0068861_101137646 | 3300005719 | Bacteria | 752 |
| 188 | Ga0068851_10733654 | 3300005834 | Bacteria | 610 |
| 189 | Ga0068870_11109853 | 3300005840 | Bacteria | 569 |
| 190 | Ga0068863_100685303 | 3300005841 | Bacteria | 1018 |
| 191 | Ga0068863_101967295 | 3300005841 | Bacteria | 595 |
| 192 | Ga0068863_102051601 | 3300005841 | Bacteria | 582 |
| 193 | Ga0068858_100022470 | 3300005842 | Bacteria | 5886 |
| 194 | Ga0068858_100033144 | 3300005842 | Bacteria | 4796 |
| 195 | Ga0068858_100072533 | 3300005842 | Bacteria | 3194 |
| 196 | Ga0068858_100403025 | 3300005842 | Bacteria | 1314 |
| 197 | Ga0068860_100016230 | 3300005843 | Bacteria | 7261 |
| 198 | Ga0068860_100068561 | 3300005843 | Bacteria | 3370 |
| 199 | Ga0068860_100879434 | 3300005843 | Bacteria | 911 |
| 200 | Ga0068862_101190978 | 3300005844 | Bacteria | 760 |
| 201 | Ga0070717_10018330 | 3300006028 | Bacteria | 5462 |
| 202 | Ga0075362_10630114 | 3300006177 | Bacteria | 556 |
| 203 | Ga0075366_10430895 | 3300006195 | Bacteria | 813 |
| 204 | Ga0075366_11007148 | 3300006195 | Bacteria | 520 |
| 205 | Ga0097621_100100789 | 3300006237 | Bacteria | 2429 |
| 206 | Ga0097621_100183694 | 3300006237 | Bacteria | 1808 |
| 207 | Ga0097621_100682458 | 3300006237 | Bacteria | 944 |
| 208 | Ga0097621_100974194 | 3300006237 | Bacteria | 792 |
| 209 | Ga0097621_101214111 | 3300006237 | Bacteria | 710 |
| 210 | Ga0097621_101235175 | 3300006237 | Bacteria | 704 |
| 211 | Ga0068871_100028407 | 3300006358 | Bacteria | 4384 |
| 212 | Ga0068871_100181615 | 3300006358 | Bacteria | 1808 |
| 213 | Ga0068871_100998036 | 3300006358 | Bacteria | 779 |
| 214 | Ga0068871_101144825 | 3300006358 | Bacteria | 728 |
| 215 | Ga0075428_100049476 | 3300006844 | Bacteria | 4611 |
| 216 | Ga0075428_100204166 | 3300006844 | Bacteria | 2136 |
| 217 | Ga0075428_101413782 | 3300006844 | Bacteria | 730 |
| 218 | Ga0075433_10369358 | 3300006852 | Bacteria | 1267 |
| 219 | Ga0075429_100358132 | 3300006880 | Bacteria | 1277 |
| 220 | Ga0068865_100032704 | 3300006881 | Bacteria | 3477 |
| 221 | Ga0068865_100036010 | 3300006881 | Bacteria | 3333 |
| 222 | Ga0068865_100058801 | 3300006881 | Bacteria | 2687 |
| 223 | Ga0068865_101225941 | 3300006881 | Bacteria | 665 |
| 224 | Ga0097620_100089828 | 3300006931 | Bacteria | 3122 |
| 225 | Ga0097620_100122935 | 3300006931 | Bacteria | 2662 |
| 226 | Ga0097620_100419957 | 3300006931 | Bacteria | 1434 |
| 227 | Ga0097620_100942831 | 3300006931 | Bacteria | 947 |
| 228 | Ga0097620_101686139 | 3300006931 | Bacteria | 700 |
| 229 | Ga0097620_101861331 | 3300006931 | Bacteria | 665 |
| 230 | Ga0075435_100307300 | 3300007076 | Bacteria | 1357 |
| 231 | Ga0105251_10131686 | 3300009011 | Bacteria | 1133 |
| 232 | Ga0105240_10000795 | 3300009093 | Bacteria | 57129 |
| 233 | Ga0105240_10020993 | 3300009093 | Bacteria | 8692 |
| 234 | Ga0105240_10073563 | 3300009093 | Bacteria | 4219 |
| 235 | Ga0105240_10245062 | 3300009093 | Bacteria | 2076 |
| 236 | Ga0105240_10625743 | 3300009093 | Bacteria | 1182 |
| 237 | Ga0105240_10748662 | 3300009093 | Bacteria | 1062 |
| 238 | Ga0111539_10016296 | 3300009094 | Bacteria | 9217 |
| 239 | Ga0111539_10217903 | 3300009094 | Bacteria | 2223 |
| 240 | Ga0111539_10532203 | 3300009094 | Bacteria | 1369 |
| 241 | Ga0111539_10662820 | 3300009094 | Bacteria | 1215 |
| 242 | Ga0105245_10012171 | 3300009098 | Bacteria | 7483 |
| 243 | Ga0105245_10081277 | 3300009098 | Bacteria | 2962 |
| 244 | Ga0105245_10127838 | 3300009098 | Bacteria | 2380 |
| 245 | Ga0105245_10189740 | 3300009098 | Bacteria | 1968 |
| 246 | Ga0105245_11307417 | 3300009098 | Bacteria | 774 |
| 247 | Ga0105245_11563468 | 3300009098 | Bacteria | 711 |
| 248 | Ga0105245_11733529 | 3300009098 | Bacteria | 677 |
| 249 | Ga0105247_10003690 | 3300009101 | Bacteria | 9936 |
| 250 | Ga0105247_10327708 | 3300009101 | Bacteria | 1070 |
| 251 | Ga0114129_10144414 | 3300009147 | Bacteria | 3260 |
| 252 | Ga0114129_12390434 | 3300009147 | Bacteria | 633 |
| 253 | Ga0114129_12415411 | 3300009147 | Bacteria | 629 |
| 254 | Ga0105243_10029435 | 3300009148 | Bacteria | 4223 |
| 255 | Ga0105243_10047500 | 3300009148 | Bacteria | 3380 |
| 256 | Ga0105243_10056116 | 3300009148 | Bacteria | 3131 |
| 257 | Ga0105243_10138770 | 3300009148 | Bacteria | 2071 |
| 258 | Ga0105243_12302616 | 3300009148 | Bacteria | 576 |
| 259 | Ga0105241_10100942 | 3300009174 | Bacteria | 2294 |
| 260 | Ga0105241_10108396 | 3300009174 | Bacteria | 2220 |
| 261 | Ga0105241_10727105 | 3300009174 | Bacteria | 908 |
| 262 | Ga0105241_10739524 | 3300009174 | Bacteria | 901 |
| 263 | Ga0105241_12103105 | 3300009174 | Bacteria | 558 |
| 264 | Ga0105242_10024598 | 3300009176 | Bacteria | 4757 |
| 265 | Ga0105242_10097645 | 3300009176 | Bacteria | 2484 |
| 266 | Ga0105242_10102984 | 3300009176 | Bacteria | 2421 |
| 267 | Ga0105242_10232968 | 3300009176 | Bacteria | 1651 |
| 268 | Ga0105242_10411781 | 3300009176 | Bacteria | 1264 |
| 269 | Ga0105242_10752040 | 3300009176 | Bacteria | 960 |
| 270 | Ga0105242_11385631 | 3300009176 | Bacteria | 730 |
| 271 | Ga0105248_10014122 | 3300009177 | Bacteria | 8790 |
| 272 | Ga0105248_10091573 | 3300009177 | Bacteria | 3424 |
| 273 | Ga0105248_10168453 | 3300009177 | Bacteria | 2469 |
| 274 | Ga0105248_10319029 | 3300009177 | Bacteria | 1750 |
| 275 | Ga0105248_10956879 | 3300009177 | Bacteria | 967 |
| 276 | Ga0105248_11548992 | 3300009177 | Bacteria | 751 |
| 277 | Ga0105237_10016417 | 3300009545 | Bacteria | 7693 |
| 278 | Ga0105237_10098216 | 3300009545 | Bacteria | 2919 |
| 279 | Ga0105238_10003657 | 3300009551 | Bacteria | 15336 |
| 280 | Ga0105238_10018959 | 3300009551 | Bacteria | 7007 |
| 281 | Ga0105238_10049536 | 3300009551 | Bacteria | 4230 |
| 282 | Ga0105238_10249273 | 3300009551 | Bacteria | 1754 |
| 283 | Ga0105238_10843313 | 3300009551 | Bacteria | 933 |
| 284 | Ga0105238_11680374 | 3300009551 | Bacteria | 666 |
| 285 | Ga0105238_13076691 | 3300009551 | Unclassified | 500 |
| 286 | Ga0105249_10020097 | 3300009553 | Bacteria | 5966 |
| 287 | Ga0105249_11516322 | 3300009553 | Bacteria | 743 |
| 288 | Ga0105249_11711735 | 3300009553 | Bacteria | 701 |
| 289 | Ga0105239_10128219 | 3300010375 | Bacteria | 2821 |
| 290 | Ga0105239_10193386 | 3300010375 | Bacteria | 2278 |
| 291 | Ga0105239_10201646 | 3300010375 | Bacteria | 2229 |
| 292 | Ga0105239_10273406 | 3300010375 | Bacteria | 1901 |
| 293 | Ga0105239_11004595 | 3300010375 | Bacteria | 959 |
| 294 | Ga0105239_11881027 | 3300010375 | Bacteria | 694 |
| 295 | Ga0105246_10090485 | 3300011119 | Bacteria | 2204 |
| 296 | Ga0105246_10153246 | 3300011119 | Bacteria | 1747 |
| 297 | Ga0105246_10496800 | 3300011119 | Bacteria | 1035 |
| 298 | Ga0105246_11360627 | 3300011119 | Bacteria | 661 |
| 299 | Ga0157344_1002277 | 3300012476 | Bacteria | 1005 |
| 300 | Ga0157342_1012942 | 3300012507 | Bacteria | 885 |
| 301 | Ga0157371_10663046 | 3300013102 | Bacteria | 779 |
| 302 | Ga0157370_10011035 | 3300013104 | Bacteria | 9476 |
| 303 | Ga0157370_10012756 | 3300013104 | Bacteria | 8692 |
| 304 | Ga0157370_10183009 | 3300013104 | Bacteria | 1946 |
| 305 | Ga0157370_10938980 | 3300013104 | Bacteria | 784 |
| 306 | Ga0157370_12023375 | 3300013104 | Bacteria | 516 |
| 307 | Ga0157370_12087428 | 3300013104 | Bacteria | 508 |
| 308 | Ga0157369_10008752 | 3300013105 | Bacteria | 11593 |
| 309 | Ga0157369_10009031 | 3300013105 | Bacteria | 11414 |
| 310 | Ga0157369_10156692 | 3300013105 | Bacteria | 2405 |
| 311 | Ga0157369_10320642 | 3300013105 | Bacteria | 1611 |
| 312 | Ga0157369_10347380 | 3300013105 | Bacteria | 1541 |
| 313 | Ga0157374_10052787 | 3300013296 | Bacteria | 3788 |
| 314 | Ga0157374_10078673 | 3300013296 | Bacteria | 3124 |
| 315 | Ga0157374_10340056 | 3300013296 | Bacteria | 1490 |
| 316 | Ga0157374_10795219 | 3300013296 | Bacteria | 961 |
| 317 | Ga0157374_11172774 | 3300013296 | Bacteria | 789 |
| 318 | Ga0157378_10031351 | 3300013297 | Bacteria | 4697 |
| 319 | Ga0157378_10125705 | 3300013297 | Bacteria | 2368 |
| 320 | Ga0157378_10182814 | 3300013297 | Bacteria | 1973 |
| 321 | Ga0157378_10186958 | 3300013297 | Bacteria | 1952 |
| 322 | Ga0157378_10344488 | 3300013297 | Bacteria | 1454 |
| 323 | Ga0157378_10384805 | 3300013297 | Bacteria | 1378 |
| 324 | Ga0157378_10907978 | 3300013297 | Bacteria | 912 |
| 325 | Ga0163162_10822161 | 3300013306 | Bacteria | 1045 |
| 326 | Ga0163162_11429626 | 3300013306 | Bacteria | 787 |
| 327 | Ga0157372_10016975 | 3300013307 | Bacteria | 7815 |
| 328 | Ga0157372_10053170 | 3300013307 | Bacteria | 4512 |
| 329 | Ga0157372_10107716 | 3300013307 | Bacteria | 3189 |
| 330 | Ga0157372_10190087 | 3300013307 | Bacteria | 2378 |
| 331 | Ga0157372_10386314 | 3300013307 | Bacteria | 1631 |
| 332 | Ga0157372_11662655 | 3300013307 | Bacteria | 735 |
| 333 | Ga0157375_10031525 | 3300013308 | Bacteria | 5013 |
| 334 | Ga0157375_10329880 | 3300013308 | Bacteria | 1691 |
| 335 | Ga0157375_10355595 | 3300013308 | Bacteria | 1631 |
| 336 | Ga0157375_11110152 | 3300013308 | Bacteria | 926 |
| 337 | Ga0163163_10191391 | 3300014325 | Bacteria | 2094 |
| 338 | Ga0163163_10553785 | 3300014325 | Bacteria | 1212 |
| 339 | Ga0163163_11637112 | 3300014325 | Bacteria | 705 |
| 340 | Ga0157377_11248264 | 3300014745 | Bacteria | 578 |
| 341 | Ga0157379_10045606 | 3300014968 | Bacteria | 3912 |
| 342 | Ga0157379_10249062 | 3300014968 | Bacteria | 1612 |
| 343 | Ga0157379_10311422 | 3300014968 | Bacteria | 1436 |
| 344 | Ga0157379_11105580 | 3300014968 | Bacteria | 759 |
| 345 | Ga0157376_10041717 | 3300014969 | Bacteria | 3759 |
| 346 | Ga0157376_10195901 | 3300014969 | Bacteria | 1856 |
| 347 | Ga0157376_10253591 | 3300014969 | Bacteria | 1645 |
| 348 | Ga0157376_10402357 | 3300014969 | Bacteria | 1324 |
| 349 | Ga0163161_10014816 | 3300017792 | Bacteria | 5432 |
| 350 | Ga0206356_10155774 | 3300020070 | Bacteria | 1669 |
| 351 | Ga0206356_10445605 | 3300020070 | Bacteria | 1370 |
| 352 | Ga0206356_10751596 | 3300020070 | Bacteria | 903 |
| 353 | Ga0206352_10380723 | 3300020078 | Bacteria | 688 |
| 354 | Ga0206352_10440647 | 3300020078 | Bacteria | 667 |
| 355 | Ga0206352_10458663 | 3300020078 | Bacteria | 513 |
| 356 | Ga0206352_10984759 | 3300020078 | Bacteria | 650 |
| 357 | Ga0206352_11159890 | 3300020078 | Bacteria | 691 |
| 358 | Ga0206352_11360316 | 3300020078 | Bacteria | 1563 |
| 359 | Ga0213874_10447126 | 3300021377 | Unclassified | 509 |
| 360 | Ga0213876_10151394 | 3300021384 | Bacteria | 1234 |
| 361 | Ga0224712_10387618 | 3300022467 | Bacteria | 665 |
| 362 | Ga0207656_10463585 | 3300025321 | Bacteria | 641 |
| 363 | Ga0207642_10021290 | 3300025899 | Bacteria | 2550 |
| 364 | Ga0207642_10094851 | 3300025899 | Bacteria | 1483 |
| 365 | Ga0207642_10161883 | 3300025899 | Bacteria | 1202 |
| 366 | Ga0207642_10989180 | 3300025899 | Bacteria | 541 |
| 367 | Ga0207710_10000970 | 3300025900 | Bacteria | 15084 |
| 368 | Ga0207710_10421569 | 3300025900 | Bacteria | 687 |
| 369 | Ga0207680_10008975 | 3300025903 | Bacteria | 4935 |
| 370 | Ga0207680_10367559 | 3300025903 | Bacteria | 1012 |
| 371 | Ga0207685_10733685 | 3300025905 | Bacteria | 540 |
| 372 | Ga0207699_10995624 | 3300025906 | Bacteria | 620 |
| 373 | Ga0207645_10001488 | 3300025907 | Bacteria | 19134 |
| 374 | Ga0207684_10371386 | 3300025910 | Bacteria | 1230 |
| 375 | Ga0207654_10010792 | 3300025911 | Bacteria | 4650 |
| 376 | Ga0207654_10030109 | 3300025911 | Bacteria | 2977 |
| 377 | Ga0207654_10039497 | 3300025911 | Bacteria | 2655 |
| 378 | Ga0207654_10910602 | 3300025911 | Bacteria | 638 |
| 379 | Ga0207654_11322148 | 3300025911 | Bacteria | 525 |
| 380 | Ga0207707_10000208 | 3300025912 | Bacteria | 62369 |
| 381 | Ga0207707_10042874 | 3300025912 | Bacteria | 3948 |
| 382 | Ga0207707_10216497 | 3300025912 | Bacteria | 1667 |
| 383 | Ga0207707_10542140 | 3300025912 | Bacteria | 989 |
| 384 | Ga0207707_10980627 | 3300025912 | Bacteria | 694 |
| 385 | Ga0207707_11099382 | 3300025912 | Bacteria | 648 |
| 386 | Ga0207695_10001980 | 3300025913 | Bacteria | 31627 |
| 387 | Ga0207695_10011622 | 3300025913 | Bacteria | 10648 |
| 388 | Ga0207695_10075068 | 3300025913 | Bacteria | 3441 |
| 389 | Ga0207695_10108928 | 3300025913 | Bacteria | 2753 |
| 390 | Ga0207695_10293964 | 3300025913 | Bacteria | 1516 |
| 391 | Ga0207695_10575253 | 3300025913 | Bacteria | 1008 |
| 392 | Ga0207695_10815990 | 3300025913 | Bacteria | 813 |
| 393 | Ga0207671_10009643 | 3300025914 | Bacteria | 8049 |
| 394 | Ga0207671_10023485 | 3300025914 | Bacteria | 4651 |
| 395 | Ga0207671_10038271 | 3300025914 | Bacteria | 3555 |
| 396 | Ga0207671_10307218 | 3300025914 | Bacteria | 1253 |
| 397 | Ga0207693_11133319 | 3300025915 | Bacteria | 593 |
| 398 | Ga0207663_11200895 | 3300025916 | Bacteria | 611 |
| 399 | Ga0207660_10039644 | 3300025917 | Bacteria | 3294 |
| 400 | Ga0207660_10211310 | 3300025917 | Bacteria | 1519 |
| 401 | Ga0207660_10222965 | 3300025917 | Bacteria | 1480 |
| 402 | Ga0207660_10374121 | 3300025917 | Bacteria | 1144 |
| 403 | Ga0207660_11141456 | 3300025917 | Bacteria | 635 |
| 404 | Ga0207660_11337923 | 3300025917 | Bacteria | 581 |
| 405 | Ga0207662_10053691 | 3300025918 | Bacteria | 2401 |
| 406 | Ga0207662_10299640 | 3300025918 | Bacteria | 1068 |
| 407 | Ga0207657_10106313 | 3300025919 | Bacteria | 2322 |
| 408 | Ga0207657_10404054 | 3300025919 | Bacteria | 1074 |
| 409 | Ga0207649_10023134 | 3300025920 | Bacteria | 3596 |
| 410 | Ga0207652_10001483 | 3300025921 | Bacteria | 20760 |
| 411 | Ga0207652_10117930 | 3300025921 | Bacteria | 2358 |
| 412 | Ga0207652_10186689 | 3300025921 | Bacteria | 1864 |
| 413 | Ga0207652_10322615 | 3300025921 | Bacteria | 1394 |
| 414 | Ga0207652_10325658 | 3300025921 | Bacteria | 1387 |
| 415 | Ga0207652_10470139 | 3300025921 | Bacteria | 1133 |
| 416 | Ga0207681_10061447 | 3300025923 | Bacteria | 2582 |
| 417 | Ga0207694_10000800 | 3300025924 | Bacteria | 28252 |
| 418 | Ga0207694_10019493 | 3300025924 | Bacteria | 5127 |
| 419 | Ga0207694_10041556 | 3300025924 | Bacteria | 3544 |
| 420 | Ga0207694_10110424 | 3300025924 | Bacteria | 2187 |
| 421 | Ga0207694_10186966 | 3300025924 | Bacteria | 1681 |
| 422 | Ga0207694_10343034 | 3300025924 | Bacteria | 1235 |
| 423 | Ga0207687_10011839 | 3300025927 | Bacteria | 5707 |
| 424 | Ga0207687_10032291 | 3300025927 | Bacteria | 3545 |
| 425 | Ga0207687_10247839 | 3300025927 | Bacteria | 1414 |
| 426 | Ga0207687_11244070 | 3300025927 | Bacteria | 640 |
| 427 | Ga0207644_10302899 | 3300025931 | Bacteria | 1288 |
| 428 | Ga0207644_10533861 | 3300025931 | Bacteria | 970 |
| 429 | Ga0207690_10224806 | 3300025932 | Bacteria | 1438 |
| 430 | Ga0207706_10000025 | 3300025933 | Bacteria | 150958 |
| 431 | Ga0207686_10000932 | 3300025934 | Bacteria | 17499 |
| 432 | Ga0207686_10014805 | 3300025934 | Bacteria | 4351 |
| 433 | Ga0207686_10044279 | 3300025934 | Bacteria | 2732 |
| 434 | Ga0207686_10098042 | 3300025934 | Bacteria | 1951 |
| 435 | Ga0207686_10237389 | 3300025934 | Bacteria | 1325 |
| 436 | Ga0207686_10245841 | 3300025934 | Bacteria | 1304 |
| 437 | Ga0207709_10085508 | 3300025935 | Bacteria | 2045 |
| 438 | Ga0207709_10217793 | 3300025935 | Bacteria | 1375 |
| 439 | Ga0207709_10320751 | 3300025935 | Bacteria | 1159 |
| 440 | Ga0207709_10334371 | 3300025935 | Bacteria | 1138 |
| 441 | Ga0207709_10350411 | 3300025935 | Bacteria | 1114 |
| 442 | Ga0207709_11752647 | 3300025935 | Bacteria | 516 |
| 443 | Ga0207670_10005394 | 3300025936 | Bacteria | 7014 |
| 444 | Ga0207670_10183840 | 3300025936 | Bacteria | 1576 |
| 445 | Ga0207670_10680428 | 3300025936 | Bacteria | 850 |
| 446 | Ga0207670_10721505 | 3300025936 | Bacteria | 826 |
| 447 | Ga0207669_10039989 | 3300025937 | Bacteria | 2716 |
| 448 | Ga0207669_10118315 | 3300025937 | Bacteria | 1792 |
| 449 | Ga0207704_10046483 | 3300025938 | Bacteria | 2587 |
| 450 | Ga0207704_10084243 | 3300025938 | Bacteria | 2066 |
| 451 | Ga0207704_10380955 | 3300025938 | Bacteria | 1107 |
| 452 | Ga0207711_10001923 | 3300025941 | Bacteria | 18862 |
| 453 | Ga0207711_10036628 | 3300025941 | Bacteria | 4163 |
| 454 | Ga0207711_10115521 | 3300025941 | Bacteria | 2392 |
| 455 | Ga0207711_10132935 | 3300025941 | Bacteria | 2232 |
| 456 | Ga0207711_10670876 | 3300025941 | Bacteria | 967 |
| 457 | Ga0207689_10006953 | 3300025942 | Bacteria | 9947 |
| 458 | Ga0207689_10104975 | 3300025942 | Bacteria | 2321 |
| 459 | Ga0207689_10113109 | 3300025942 | Bacteria | 2231 |
| 460 | Ga0207661_10003943 | 3300025944 | Bacteria | 10365 |
| 461 | Ga0207661_10053133 | 3300025944 | Bacteria | 3240 |
| 462 | Ga0207661_11187380 | 3300025944 | Bacteria | 702 |
| 463 | Ga0207679_10062796 | 3300025945 | Bacteria | 2770 |
| 464 | Ga0207667_10003608 | 3300025949 | Bacteria | 19092 |
| 465 | Ga0207667_10015384 | 3300025949 | Bacteria | 8696 |
| 466 | Ga0207667_10123512 | 3300025949 | Bacteria | 2667 |
| 467 | Ga0207667_10320133 | 3300025949 | Bacteria | 1584 |
| 468 | Ga0207712_10908089 | 3300025961 | Bacteria | 778 |
| 469 | Ga0207668_10612124 | 3300025972 | Bacteria | 950 |
| 470 | Ga0207640_10004934 | 3300025981 | Bacteria | 7249 |
| 471 | Ga0207640_11105396 | 3300025981 | Bacteria | 701 |
| 472 | Ga0207677_10043856 | 3300026023 | Bacteria | 2976 |
| 473 | Ga0207677_10080730 | 3300026023 | Bacteria | 2331 |
| 474 | Ga0207703_10008858 | 3300026035 | Bacteria | 7931 |
| 475 | Ga0207703_10013093 | 3300026035 | Bacteria | 6466 |
| 476 | Ga0207703_10021117 | 3300026035 | Bacteria | 5096 |
| 477 | Ga0207703_10524715 | 3300026035 | Bacteria | 1114 |
| 478 | Ga0207639_10014533 | 3300026041 | Bacteria | 5541 |
| 479 | Ga0207639_10021804 | 3300026041 | Bacteria | 4604 |
| 480 | Ga0207639_10125052 | 3300026041 | Bacteria | 2119 |
| 481 | Ga0207639_10131680 | 3300026041 | Bacteria | 2071 |
| 482 | Ga0207639_11804462 | 3300026041 | Bacteria | 572 |
| 483 | Ga0207678_10527438 | 3300026067 | Bacteria | 1031 |
| 484 | Ga0207708_10130203 | 3300026075 | Bacteria | 1967 |
| 485 | Ga0207708_10496663 | 3300026075 | Bacteria | 1022 |
| 486 | Ga0207702_10001668 | 3300026078 | Bacteria | 21933 |
| 487 | Ga0207702_10070106 | 3300026078 | Bacteria | 3014 |
| 488 | Ga0207702_10111508 | 3300026078 | Bacteria | 2433 |
| 489 | Ga0207702_10152079 | 3300026078 | Bacteria | 2106 |
| 490 | Ga0207702_10152751 | 3300026078 | Bacteria | 2102 |
| 491 | Ga0207702_10406779 | 3300026078 | Bacteria | 1313 |
| 492 | Ga0207641_10054321 | 3300026088 | Bacteria | 3398 |
| 493 | Ga0207641_10257739 | 3300026088 | Bacteria | 1632 |
| 494 | Ga0207641_10451073 | 3300026088 | Bacteria | 1243 |
| 495 | Ga0207648_10003523 | 3300026089 | Bacteria | 16389 |
| 496 | Ga0207648_10088131 | 3300026089 | Bacteria | 2710 |
| 497 | Ga0207676_10138487 | 3300026095 | Bacteria | 2080 |
| 498 | Ga0207676_10224198 | 3300026095 | Bacteria | 1676 |
| 499 | Ga0207676_10237076 | 3300026095 | Bacteria | 1634 |
| 500 | Ga0207676_10561774 | 3300026095 | Bacteria | 1091 |
| 501 | Ga0207676_11124089 | 3300026095 | Bacteria | 777 |
| 502 | Ga0207674_10000310 | 3300026116 | Bacteria | 62057 |
| 503 | Ga0207674_10013667 | 3300026116 | Bacteria | 8992 |
| 504 | Ga0207674_10015138 | 3300026116 | Bacteria | 8487 |
| 505 | Ga0207674_10103448 | 3300026116 | Bacteria | 2827 |
| 506 | Ga0207674_11365689 | 3300026116 | Bacteria | 678 |
| 507 | Ga0207675_100119945 | 3300026118 | Bacteria | 2488 |
| 508 | Ga0207675_100198537 | 3300026118 | Bacteria | 1926 |
| 509 | Ga0207683_10025790 | 3300026121 | Bacteria | 5071 |
| 510 | Ga0207683_10025820 | 3300026121 | Bacteria | 5068 |
| 511 | Ga0207698_10052131 | 3300026142 | Bacteria | 3133 |
| 512 | Ga0207698_10121656 | 3300026142 | Bacteria | 2210 |
| 513 | Ga0207698_10206145 | 3300026142 | Bacteria | 1765 |
| 514 | Ga0207428_10016333 | 3300027907 | Bacteria | 6387 |
| 515 | Ga0268266_10025380 | 3300028379 | Bacteria | 5041 |
| 516 | Ga0268266_10739487 | 3300028379 | Bacteria | 949 |
| 517 | Ga0268266_10974787 | 3300028379 | Bacteria | 820 |
| 518 | Ga0268265_10256127 | 3300028380 | Bacteria | 1553 |
| 519 | Ga0268264_10022095 | 3300028381 | Bacteria | 5192 |
| 520 | Ga0268264_10054422 | 3300028381 | Bacteria | 3342 |
| 521 | Ga0268264_10219525 | 3300028381 | Bacteria | 1749 |
| 522 | Ga0268264_10803706 | 3300028381 | Bacteria | 940 |
| 523 | Ga0265337_1041617 | 3300028556 | Bacteria | 1321 |
| 524 | Ga0265334_10040083 | 3300028573 | Bacteria | 1836 |
| 525 | Ga0265323_10000813 | 3300028653 | Bacteria | 16740 |
| 526 | Ga0265323_10010096 | 3300028653 | Bacteria | 3833 |
| 527 | Ga0265323_10220226 | 3300028653 | Bacteria | 594 |
| 528 | Ga0265322_10001588 | 3300028654 | Bacteria | 7290 |
| 529 | Ga0265322_10056466 | 3300028654 | Bacteria | 1114 |
| 530 | Ga0307517_10044430 | 3300028786 | Bacteria | 4699 |
| 531 | Ga0307515_10019188 | 3300028794 | Bacteria | 12327 |
| 532 | Ga0265338_10180892 | 3300028800 | Bacteria | 1607 |
| 533 | Ga0265338_10197518 | 3300028800 | Bacteria | 1519 |
| 534 | Ga0265324_10001138 | 3300029957 | Bacteria | 15932 |
| 535 | Ga0265766_1003084 | 3300030863 | Bacteria | 956 |
| 536 | Ga0265764_106806 | 3300030882 | Bacteria | 665 |
| 537 | Ga0265769_114939 | 3300030888 | Bacteria | 574 |
| 538 | Ga0265768_104375 | 3300030963 | Bacteria | 794 |
| 539 | Ga0265330_10001538 | 3300031235 | Bacteria | 13278 |
| 540 | Ga0265330_10023175 | 3300031235 | Bacteria | 2821 |
| 541 | Ga0265330_10038180 | 3300031235 | Bacteria | 2135 |
| 542 | Ga0265332_10041964 | 3300031238 | Bacteria | 1979 |
| 543 | Ga0265320_10334821 | 3300031240 | Bacteria | 669 |
| 544 | Ga0265329_10000810 | 3300031242 | Bacteria | 15899 |
| 545 | Ga0265329_10003030 | 3300031242 | Bacteria | 7460 |
| 546 | Ga0265339_10000001 | 3300031249 | Bacteria | 613713 |
| 547 | Ga0265339_10039721 | 3300031249 | Bacteria | 2619 |
| 548 | Ga0265339_10182652 | 3300031249 | Bacteria | 1044 |
| 549 | Ga0265316_10003476 | 3300031344 | Bacteria | 15921 |
| 550 | Ga0265316_10003553 | 3300031344 | Bacteria | 15722 |
| 551 | Ga0265316_10008144 | 3300031344 | Bacteria | 9756 |
| 552 | Ga0265316_10407563 | 3300031344 | Bacteria | 978 |
| 553 | Ga0307513_10359505 | 3300031456 | Bacteria | 1201 |
| 554 | Ga0307509_10000112 | 3300031507 | Bacteria | 117028 |
| 555 | Ga0307509_10117324 | 3300031507 | Bacteria | 2649 |
| 556 | Ga0307509_10421613 | 3300031507 | Bacteria | 1035 |
| 557 | Ga0265313_10004179 | 3300031595 | Bacteria | 11210 |
| 558 | Ga0265313_10006342 | 3300031595 | Bacteria | 8414 |
| 559 | Ga0307514_10050235 | 3300031649 | Bacteria | 3239 |
| 560 | Ga0265314_10002144 | 3300031711 | Bacteria | 20676 |
| 561 | Ga0265314_10002901 | 3300031711 | Bacteria | 17019 |
| 562 | Ga0265314_10354818 | 3300031711 | Bacteria | 806 |
| 563 | Ga0265342_10002849 | 3300031712 | Bacteria | 14592 |
| 564 | Ga0265342_10003171 | 3300031712 | Bacteria | 13684 |
| 565 | Ga0265342_10095154 | 3300031712 | Bacteria | 1703 |
| 566 | Ga0265342_10117343 | 3300031712 | Bacteria | 1501 |
| 567 | Ga0265342_10305733 | 3300031712 | Bacteria | 836 |
| 568 | Ga0316576_10085280 | 3300031727 | Bacteria | 2348 |
| 569 | Ga0316576_10169449 | 3300031727 | Bacteria | 1648 |
| 570 | Ga0316576_11090246 | 3300031727 | Bacteria | 567 |
| 571 | Ga0307516_10068914 | 3300031730 | Bacteria | 3404 |
| 572 | Ga0307405_10023738 | 3300031731 | Bacteria | 3491 |
| 573 | Ga0307405_10653444 | 3300031731 | Bacteria | 865 |
| 574 | Ga0307415_100182310 | 3300032126 | Bacteria | 1648 |
| 575 | Ga0307415_100917700 | 3300032126 | Bacteria | 808 |
| 576 | Ga0307507_10155075 | 3300033179 | Bacteria | 1710 |
| 577 | Ga0316592_1015053 | 3300033524 | Bacteria | 1608 |
| 578 | Ga0316592_1034587 | 3300033524 | Bacteria | 1107 |
| 579 | Ga0316592_1077059 | 3300033524 | Bacteria | 757 |
| 580 | Ga0316592_1168513 | 3300033524 | Bacteria | 521 |
| 581 | Ga0316586_1042064 | 3300033527 | Bacteria | 805 |
| 582 | Ga0316586_1047656 | 3300033527 | Bacteria | 763 |
| 583 | Ga0316588_1000219 | 3300033528 | Bacteria | 6805 |
| 584 | Ga0316588_1010779 | 3300033528 | Bacteria | 1936 |
| 585 | Ga0316588_1039464 | 3300033528 | Bacteria | 1126 |
| 586 | Ga0316588_1167374 | 3300033528 | Bacteria | 568 |
| 587 | Ga0316587_1028265 | 3300033529 | Bacteria | 983 |
| 588 | Ga0373950_0000077 | 3300034818 | Bacteria | 39197 |
| 589 | Ga0373949_0000225 | 3300035090 | Bacteria | 21493 |
| 590 | Ga0373936_0000006 | 3300035113 | Bacteria | 318697 |
| 591 | Ga0373941_0034585 | 3300035115 | Bacteria | 1526 |
| 592 | Ga0373954_0508665 | 3300035118 | Bacteria | 597 |
| 593 | Ga0373956_0148674 | 3300035119 | Bacteria | 1102 |
| 594 | Ga0373943_0090766 | 3300035170 | Bacteria | 1582 |
| 595 | Ga0373955_0075526 | 3300035172 | Bacteria | 1894 |
| 596 | Ga0373961_0000367 | 3300035241 | Bacteria | 19355 |
| 597 | Ga0373961_0075828 | 3300035241 | Bacteria | 1049 |
| 598 | Ga0373935_0148891 | 3300035692 | Bacteria | 1587 |
| 599 | Ga0373935_0494292 | 3300035692 | Bacteria | 888 |
| 600 | Ga0373927_0234406 | 3300035695 | Bacteria | 1206 |
| 601 | Ga0373947_0170258 | 3300035725 | Bacteria | 1413 |
| 602 | Ga0373947_0567815 | 3300035725 | Bacteria | 773 |
| 603 | Ga0265778_001330 | 3300036457 | Bacteria | 2231 |
| 604 | Ga0373925_0010573 | 3300037068 | Bacteria | 6693 |
| 605 | Ga0373925_0859294 | 3300037068 | Bacteria | 748 |
| 606 | Ga0436365_0593949 | 3300039437 | Bacteria | 1901 |
| 607 | Ga0436365_0629347 | 3300039437 | Bacteria | 836 |
| 608 | Ga0436365_1790089 | 3300039437 | Unclassified | 1193 |
| 609 | Ga0436360_0147680 | 3300039438 | Bacteria | 3715 |
| 610 | Ga0436360_1132549 | 3300039438 | Bacteria | 579 |
| 611 | Ga0436361_0484302 | 3300039447 | Bacteria | 6682 |
| 612 | Ga0436363_0308745 | 3300039450 | Bacteria | 1962 |
| 613 | Ga0436363_1500563 | 3300039450 | Bacteria | 2666 |
| 614 | Ga0451797_0755971 | 3300041453 | Bacteria | 778 |
| 615 | Ga0451805_102149 | 3300041461 | Bacteria | 868 |
| 616 | Ga0451807_2653739 | 3300041486 | Bacteria | 1109 |
| 617 | Ga0451577_0035060 | 3300042876 | Bacteria | 4520 |
| 618 | Ga0451577_0043022 | 3300042876 | Bacteria | 4047 |
| 619 | Ga0453683_0072285 | 3300044673 | Bacteria | 2159 |
| 620 | Ga0466963_0142576 | 3300044694 | Bacteria | 1661 |
| 621 | Ga0466964_0229274 | 3300044706 | Bacteria | 906 |
| 622 | Ga0453684_0000116 | 3300044712 | Bacteria | 352304 |
| 623 | Ga0453684_0120898 | 3300044712 | Bacteria | 3162 |
| 624 | Ga0453684_0298379 | 3300044712 | Bacteria | 1832 |
| 625 | Ga0453684_0542260 | 3300044712 | Bacteria | 1282 |
| 626 | Ga0453684_0699489 | 3300044712 | Bacteria | 1101 |
| 627 | Ga0453684_0763571 | 3300044712 | Bacteria | 1045 |
| 628 | Ga0453684_1421883 | 3300044712 | Bacteria | 718 |
| 629 | Ga0453684_1466812 | 3300044712 | Bacteria | 705 |
| 630 | Ga0466957_0850078 | 3300044842 | Bacteria | 650 |
| 631 | Ga0466959_0031428 | 3300045049 | Bacteria | 3928 |
| 632 | Ga0451576_0037161 | 3300045051 | Bacteria | 5159 |
| 633 | Ga0451576_0118318 | 3300045051 | Bacteria | 2758 |
| 634 | Ga0451576_0321743 | 3300045051 | Bacteria | 1618 |
| 635 | Ga0451576_1255267 | 3300045051 | Bacteria | 773 |
| 636 | Ga0466967_1272037 | 3300045976 | Bacteria | 733 |
| 637 | Ga0495650_0287647 | 3300046471 | Bacteria | 552 |
| 638 | Ga0495580_0043038 | 3300046472 | Bacteria | 3215 |
| 639 | Ga0495580_0144978 | 3300046472 | Bacteria | 1646 |
| 640 | Ga0495596_0287436 | 3300046500 | Bacteria | 639 |
| 641 | Ga0495628_0961816 | 3300046516 | Bacteria | 589 |
| 642 | Ga0495630_0849855 | 3300046517 | Bacteria | 696 |
| 643 | Ga0495633_0500120 | 3300046558 | Bacteria | 548 |
| 644 | Ga0495667_0237139 | 3300046559 | Bacteria | 1162 |
| 645 | Ga0495657_0643662 | 3300046675 | Bacteria | 612 |
| 646 | Ga0495623_0163091 | 3300046679 | Bacteria | 1308 |
| 647 | Ga0495680_0863936 | 3300047322 | Bacteria | 587 |
| 648 | Ga0495675_0080546 | 3300047444 | Bacteria | 2051 |
| 649 | Ga0495686_0025181 | 3300047472 | Bacteria | 3902 |
| 650 | Ga0495686_0045414 | 3300047472 | Bacteria | 2779 |
| 651 | Ga0496100_1331223 | 3300048903 | Bacteria | 567 |
| 652 | Ga0496102_0119576 | 3300048905 | Bacteria | 2460 |
| 653 | Ga0496104_0226938 | 3300048907 | Bacteria | 1780 |
| 654 | Ga0496104_0650438 | 3300048907 | Bacteria | 963 |
| 655 | Ga0496106_0082706 | 3300048909 | Bacteria | 2468 |
| 656 | Ga0496106_1456320 | 3300048909 | Bacteria | 528 |
| 657 | Ga0496107_0919005 | 3300048910 | Bacteria | 637 |
| 658 | Ga0496108_0218168 | 3300048911 | Bacteria | 1657 |
| 659 | Ga0496109_1352099 | 3300048912 | Bacteria | 648 |
| 660 | Ga0496112_0007223 | 3300048915 | Bacteria | 9844 |
| 661 | Ga0496112_0375219 | 3300048915 | Bacteria | 1364 |
| 662 | Ga0496114_0024308 | 3300048917 | Bacteria | 4945 |
| 663 | Ga0496115_0220972 | 3300048918 | Bacteria | 1563 |
| 664 | Ga0501309_062099 | 3300049129 | Bacteria | 603 |
| 665 | Ga0501310_037734 | 3300049130 | Bacteria | 663 |
| 666 | Ga0501305_007281 | 3300049161 | Bacteria | 1400 |
| 667 | Ga0501307_005813 | 3300049162 | Bacteria | 1312 |
| 668 | Ga0501307_057851 | 3300049162 | Bacteria | 596 |
| 669 | Ga0501312_071219 | 3300049528 | Bacteria | 617 |
| 670 | Ga0501313_042794 | 3300049529 | Bacteria | 612 |
| 671 | Ga0501317_042186 | 3300049533 | Bacteria | 700 |
| 672 | Ga0501323_029790 | 3300049539 | Bacteria | 761 |
| 673 | Ga0501032_0358963 | 3300049569 | Bacteria | 938 |
| 674 | Ga0501034_0058539 | 3300049571 | Bacteria | 3873 |
| 675 | Ga0501034_0180779 | 3300049571 | Bacteria | 2074 |
| 676 | Ga0501036_0031623 | 3300049572 | Bacteria | 4473 |
| 677 | Ga0501036_0632006 | 3300049572 | Bacteria | 887 |
| 678 | Ga0501046_0193596 | 3300049580 | Bacteria | 1516 |
| 679 | Ga0501047_0054863 | 3300049581 | Bacteria | 3854 |
| 680 | Ga0501069_0028958 | 3300049585 | Bacteria | 3038 |
| 681 | Ga0501069_0053468 | 3300049585 | Bacteria | 2249 |
| 682 | Ga0501070_0038089 | 3300049586 | Bacteria | 4012 |
| 683 | Ga0501070_0072970 | 3300049586 | Bacteria | 2840 |
| 684 | Ga0501070_0548583 | 3300049586 | Bacteria | 925 |
| 685 | Ga0501071_0066878 | 3300049587 | Bacteria | 2613 |
| 686 | Ga0501072_1083997 | 3300049588 | Bacteria | 623 |
| 687 | Ga0501073_0030016 | 3300049589 | Bacteria | 3883 |
| 688 | Ga0501074_0022208 | 3300049590 | Bacteria | 4610 |
| 689 | Ga0501077_0309008 | 3300049593 | Bacteria | 1008 |
| 690 | Ga0501079_0159978 | 3300049741 | Bacteria | 1756 |
| 691 | Ga0501080_0063062 | 3300049742 | Bacteria | 3449 |
| 692 | Ga0501081_0386188 | 3300049743 | Bacteria | 1035 |
| 693 | Ga0501083_0027701 | 3300049744 | Bacteria | 3908 |
| 694 | nmdc:mga0k408_572499_c1 | 3300050493 | Bacteria | 667 |
| 695 | nmdc:mga0k408_839934_c1 | 3300050493 | Bacteria | 534 |
| 696 | nmdc:mga08y16_14232_c1 | 3300050511 | Bacteria | 8373 |
| 697 | nmdc:mga08y16_443260_c1 | 3300050511 | Bacteria | 1325 |
| 698 | nmdc:mga08y16_684200_c1 | 3300050511 | Bacteria | 1027 |
| 699 | nmdc:mga0rr50_171829_c1 | 3300050513 | Bacteria | 1766 |
| 700 | nmdc:mga0a205_215651_c1 | 3300050515 | Bacteria | 1806 |
| 701 | Ga0500646_0010523 | 3300053090 | Bacteria | 2373 |
| 702 | Ga0500583_0112280 | 3300053092 | Bacteria | 1343 |
| 703 | Ga0500583_0377595 | 3300053092 | Bacteria | 683 |
| 704 | Ga0500651_0494703 | 3300053093 | Bacteria | 675 |
| 705 | Ga0500566_0049878 | 3300053094 | Bacteria | 2398 |
| 706 | Ga0500654_071919 | 3300053099 | Bacteria | 1679 |
| 707 | Ga0500555_141066 | 3300053103 | Bacteria | 594 |
| 708 | Ga0500562_034374 | 3300053108 | Bacteria | 1341 |
| 709 | Ga0500597_157237 | 3300053120 | Bacteria | 973 |
| 710 | Ga0500614_006909 | 3300053123 | Bacteria | 2386 |
| 711 | Ga0500642_0007926 | 3300053130 | Bacteria | 3600 |
| 712 | Ga0500642_0031474 | 3300053130 | Bacteria | 2217 |
| 713 | Ga0501082_0057753 | 3300060353 | Bacteria | 3342 |
| 714 | Ga0501082_0406418 | 3300060353 | Bacteria | 1188 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_11133319 | Ga0207693_111333192 | 84 |
| 2 | 3300046559 | Ga0495667_0237139 | Ga0495667_0237139_455_841 | 88 |
| 3 | 3300010375 | Ga0105239_11004595 | Ga0105239_110045951 | 89 |
| 4 | 3300005455 | Ga0070663_100427185 | Ga0070663_1004271852 | 90 |
| 5 | 3300044712 | Ga0453684_1421883 | Ga0453684_1421883_340_681 | 91 |
| 6 | 3300046675 | Ga0495657_0643662 | Ga0495657_0643662_69_449 | 91 |
| 7 | 3300044712 | Ga0453684_0120898 | Ga0453684_0120898_26_373 | 92 |
| 8 | 3300005334 | Ga0068869_100578358 | Ga0068869_1005783581 | 95 |
| 9 | 3300005335 | Ga0070666_10105484 | Ga0070666_101054841 | 95 |
| 10 | 3300005336 | Ga0070680_100655247 | Ga0070680_1006552472 | 95 |
| 11 | 3300005338 | Ga0068868_100018827 | Ga0068868_1000188276 | 95 |
| 12 | 3300005355 | Ga0070671_100180145 | Ga0070671_1001801452 | 95 |
| 13 | 3300005366 | Ga0070659_100260883 | Ga0070659_1002608833 | 95 |
| 14 | 3300005367 | Ga0070667_100571196 | Ga0070667_1005711961 | 95 |
| 15 | 3300005436 | Ga0070713_102030769 | Ga0070713_1020307691 | 95 |
| 16 | 3300005459 | Ga0068867_100168337 | Ga0068867_1001683372 | 95 |
| 17 | 3300005518 | Ga0070699_100015032 | Ga0070699_1000150321 | 95 |
| 18 | 3300005530 | Ga0070679_100387283 | Ga0070679_1003872833 | 95 |
| 19 | 3300005535 | Ga0070684_100085526 | Ga0070684_1000855263 | 95 |
| 20 | 3300005535 | Ga0070684_100241732 | Ga0070684_1002417321 | 95 |
| 21 | 3300005539 | Ga0068853_100060122 | Ga0068853_1000601224 | 95 |
| 22 | 3300005539 | Ga0068853_100235147 | Ga0068853_1002351471 | 95 |
| 23 | 3300005539 | Ga0068853_100462306 | Ga0068853_1004623062 | 95 |
| 24 | 3300005547 | Ga0070693_100168531 | Ga0070693_1001685312 | 95 |
| 25 | 3300005548 | Ga0070665_100178042 | Ga0070665_1001780421 | 95 |
| 26 | 3300005548 | Ga0070665_100586592 | Ga0070665_1005865921 | 95 |
| 27 | 3300005563 | Ga0068855_100146442 | Ga0068855_1001464422 | 95 |
| 28 | 3300005563 | Ga0068855_100735843 | Ga0068855_1007358432 | 95 |
| 29 | 3300005577 | Ga0068857_100042568 | Ga0068857_1000425682 | 95 |
| 30 | 3300005577 | Ga0068857_100127402 | Ga0068857_1001274022 | 95 |
| 31 | 3300005578 | Ga0068854_100331442 | Ga0068854_1003314422 | 95 |
| 32 | 3300005614 | Ga0068856_100139794 | Ga0068856_1001397943 | 95 |
| 33 | 3300005617 | Ga0068859_100089831 | Ga0068859_1000898312 | 95 |
| 34 | 3300005718 | Ga0068866_10078882 | Ga0068866_100788821 | 95 |
| 35 | 3300005841 | Ga0068863_101967295 | Ga0068863_1019672951 | 95 |
| 36 | 3300005842 | Ga0068858_100033144 | Ga0068858_1000331448 | 95 |
| 37 | 3300005842 | Ga0068858_100403025 | Ga0068858_1004030252 | 95 |
| 38 | 3300005843 | Ga0068860_100016230 | Ga0068860_1000162303 | 95 |
| 39 | 3300006237 | Ga0097621_100974194 | Ga0097621_1009741942 | 95 |
| 40 | 3300006237 | Ga0097621_101214111 | Ga0097621_1012141111 | 95 |
| 41 | 3300006237 | Ga0097621_101235175 | Ga0097621_1012351751 | 95 |
| 42 | 3300006358 | Ga0068871_100181615 | Ga0068871_1001816152 | 95 |
| 43 | 3300006358 | Ga0068871_100998036 | Ga0068871_1009980361 | 95 |
| 44 | 3300006358 | Ga0068871_101144825 | Ga0068871_1011448252 | 95 |
| 45 | 3300006881 | Ga0068865_100036010 | Ga0068865_1000360104 | 95 |
| 46 | 3300006931 | Ga0097620_100089828 | Ga0097620_1000898282 | 95 |
| 47 | 3300009011 | Ga0105251_10131686 | Ga0105251_101316861 | 95 |
| 48 | 3300009093 | Ga0105240_10625743 | Ga0105240_106257431 | 95 |
| 49 | 3300009093 | Ga0105240_10748662 | Ga0105240_107486622 | 95 |
| 50 | 3300009098 | Ga0105245_10127838 | Ga0105245_101278382 | 95 |
| 51 | 3300009098 | Ga0105245_11733529 | Ga0105245_117335292 | 95 |
| 52 | 3300009101 | Ga0105247_10327708 | Ga0105247_103277081 | 95 |
| 53 | 3300009147 | Ga0114129_10144414 | Ga0114129_101444142 | 95 |
| 54 | 3300009148 | Ga0105243_10138770 | Ga0105243_101387702 | 95 |
| 55 | 3300009174 | Ga0105241_10727105 | Ga0105241_107271051 | 95 |
| 56 | 3300009174 | Ga0105241_10739524 | Ga0105241_107395242 | 95 |
| 57 | 3300009174 | Ga0105241_12103105 | Ga0105241_121031052 | 95 |
| 58 | 3300009176 | Ga0105242_10232968 | Ga0105242_102329681 | 95 |
| 59 | 3300009176 | Ga0105242_11385631 | Ga0105242_113856311 | 95 |
| 60 | 3300009177 | Ga0105248_10168453 | Ga0105248_101684533 | 95 |
| 61 | 3300009177 | Ga0105248_10319029 | Ga0105248_103190293 | 95 |
| 62 | 3300009551 | Ga0105238_10018959 | Ga0105238_100189591 | 95 |
| 63 | 3300009551 | Ga0105238_10049536 | Ga0105238_100495362 | 95 |
| 64 | 3300009551 | Ga0105238_13076691 | Ga0105238_130766911 | 95 |
| 65 | 3300009553 | Ga0105249_11711735 | Ga0105249_117117351 | 95 |
| 66 | 3300010375 | Ga0105239_10273406 | Ga0105239_102734061 | 95 |
| 67 | 3300010375 | Ga0105239_11881027 | Ga0105239_118810272 | 95 |
| 68 | 3300011119 | Ga0105246_10153246 | Ga0105246_101532462 | 95 |
| 69 | 3300013102 | Ga0157371_10663046 | Ga0157371_106630461 | 95 |
| 70 | 3300013104 | Ga0157370_10183009 | Ga0157370_101830092 | 95 |
| 71 | 3300013105 | Ga0157369_10320642 | Ga0157369_103206422 | 95 |
| 72 | 3300013296 | Ga0157374_10795219 | Ga0157374_107952192 | 95 |
| 73 | 3300013296 | Ga0157374_11172774 | Ga0157374_111727742 | 95 |
| 74 | 3300013297 | Ga0157378_10125705 | Ga0157378_101257052 | 95 |
| 75 | 3300013297 | Ga0157378_10182814 | Ga0157378_101828141 | 95 |
| 76 | 3300013306 | Ga0163162_10822161 | Ga0163162_108221611 | 95 |
| 77 | 3300013307 | Ga0157372_11662655 | Ga0157372_116626551 | 95 |
| 78 | 3300013308 | Ga0157375_10355595 | Ga0157375_103555952 | 95 |
| 79 | 3300014325 | Ga0163163_10191391 | Ga0163163_101913913 | 95 |
| 80 | 3300014325 | Ga0163163_11637112 | Ga0163163_116371122 | 95 |
| 81 | 3300014968 | Ga0157379_10249062 | Ga0157379_102490621 | 95 |
| 82 | 3300014968 | Ga0157379_10311422 | Ga0157379_103114223 | 95 |
| 83 | 3300014969 | Ga0157376_10195901 | Ga0157376_101959012 | 95 |
| 84 | 3300021377 | Ga0213874_10447126 | Ga0213874_104471261 | 95 |
| 85 | 3300025900 | Ga0207710_10421569 | Ga0207710_104215692 | 95 |
| 86 | 3300025903 | Ga0207680_10367559 | Ga0207680_103675591 | 95 |
| 87 | 3300025911 | Ga0207654_10030109 | Ga0207654_100301091 | 95 |
| 88 | 3300025911 | Ga0207654_10910602 | Ga0207654_109106021 | 95 |
| 89 | 3300025912 | Ga0207707_10042874 | Ga0207707_100428748 | 95 |
| 90 | 3300025912 | Ga0207707_11099382 | Ga0207707_110993821 | 95 |
| 91 | 3300025913 | Ga0207695_10075068 | Ga0207695_100750682 | 95 |
| 92 | 3300025913 | Ga0207695_10575253 | Ga0207695_105752532 | 95 |
| 93 | 3300025913 | Ga0207695_10815990 | Ga0207695_108159901 | 95 |
| 94 | 3300025914 | Ga0207671_10038271 | Ga0207671_100382714 | 95 |
| 95 | 3300025917 | Ga0207660_10211310 | Ga0207660_102113102 | 95 |
| 96 | 3300025921 | Ga0207652_10325658 | Ga0207652_103256583 | 95 |
| 97 | 3300025924 | Ga0207694_10019493 | Ga0207694_100194932 | 95 |
| 98 | 3300025924 | Ga0207694_10041556 | Ga0207694_100415562 | 95 |
| 99 | 3300025931 | Ga0207644_10302899 | Ga0207644_103028991 | 95 |
| 100 | 3300025932 | Ga0207690_10224806 | Ga0207690_102248062 | 95 |
| 101 | 3300025934 | Ga0207686_10014805 | Ga0207686_100148055 | 95 |
| 102 | 3300025935 | Ga0207709_10334371 | Ga0207709_103343712 | 95 |
| 103 | 3300025938 | Ga0207704_10380955 | Ga0207704_103809552 | 95 |
| 104 | 3300025941 | Ga0207711_10115521 | Ga0207711_101155214 | 95 |
| 105 | 3300025941 | Ga0207711_10132935 | Ga0207711_101329352 | 95 |
| 106 | 3300025942 | Ga0207689_10113109 | Ga0207689_101131093 | 95 |
| 107 | 3300025945 | Ga0207679_10062796 | Ga0207679_100627963 | 95 |
| 108 | 3300025949 | Ga0207667_10123512 | Ga0207667_101235122 | 95 |
| 109 | 3300025949 | Ga0207667_10320133 | Ga0207667_103201333 | 95 |
| 110 | 3300026023 | Ga0207677_10080730 | Ga0207677_100807302 | 95 |
| 111 | 3300026035 | Ga0207703_10008858 | Ga0207703_100088582 | 95 |
| 112 | 3300026035 | Ga0207703_10013093 | Ga0207703_100130933 | 95 |
| 113 | 3300026041 | Ga0207639_10021804 | Ga0207639_100218048 | 95 |
| 114 | 3300026041 | Ga0207639_10131680 | Ga0207639_101316801 | 95 |
| 115 | 3300026078 | Ga0207702_10070106 | Ga0207702_100701063 | 95 |
| 116 | 3300026078 | Ga0207702_10406779 | Ga0207702_104067791 | 95 |
| 117 | 3300026088 | Ga0207641_10451073 | Ga0207641_104510732 | 95 |
| 118 | 3300026095 | Ga0207676_10561774 | Ga0207676_105617743 | 95 |
| 119 | 3300026116 | Ga0207674_10013667 | Ga0207674_100136673 | 95 |
| 120 | 3300026116 | Ga0207674_10015138 | Ga0207674_100151383 | 95 |
| 121 | 3300028379 | Ga0268266_10025380 | Ga0268266_100253802 | 95 |
| 122 | 3300028379 | Ga0268266_10974787 | Ga0268266_109747872 | 95 |
| 123 | 3300028381 | Ga0268264_10022095 | Ga0268264_100220952 | 95 |
| 124 | 3300031711 | Ga0265314_10002144 | Ga0265314_1000214413 | 95 |
| 125 | 3300031712 | Ga0265342_10117343 | Ga0265342_101173432 | 95 |
| 126 | 3300035115 | Ga0373941_0034585 | Ga0373941_0034585_288_671 | 95 |
| 127 | 3300035241 | Ga0373961_0075828 | Ga0373961_0075828_652_1035 | 95 |
| 128 | 3300037068 | Ga0373925_0859294 | Ga0373925_0859294_212_592 | 95 |
| 129 | 3300039438 | Ga0436360_0147680 | Ga0436360_0147680_3226_3609 | 95 |
| 130 | 3300039450 | Ga0436363_1500563 | Ga0436363_1500563_816_1199 | 95 |
| 131 | 3300046517 | Ga0495630_0849855 | Ga0495630_0849855_104_484 | 95 |
| 132 | 3300046558 | Ga0495633_0500120 | Ga0495633_0500120_38_418 | 95 |
| 133 | 3300048915 | Ga0496112_0375219 | Ga0496112_0375219_71_451 | 95 |
| 134 | 3300005327 | Ga0070658_10072868 | Ga0070658_100728683 | 97 |
| 135 | 3300005329 | Ga0070683_100458546 | Ga0070683_1004585462 | 97 |
| 136 | 3300005329 | Ga0070683_101493666 | Ga0070683_1014936662 | 97 |
| 137 | 3300005340 | Ga0070689_100366864 | Ga0070689_1003668641 | 97 |
| 138 | 3300005347 | Ga0070668_101029542 | Ga0070668_1010295422 | 97 |
| 139 | 3300005365 | Ga0070688_100645216 | Ga0070688_1006452162 | 97 |
| 140 | 3300005466 | Ga0070685_10393371 | Ga0070685_103933712 | 97 |
| 141 | 3300005535 | Ga0070684_100446964 | Ga0070684_1004469642 | 97 |
| 142 | 3300005539 | Ga0068853_101090780 | Ga0068853_1010907802 | 97 |
| 143 | 3300005563 | Ga0068855_100033833 | Ga0068855_1000338333 | 97 |
| 144 | 3300005614 | Ga0068856_101404634 | Ga0068856_1014046342 | 97 |
| 145 | 3300005617 | Ga0068859_100942883 | Ga0068859_1009428833 | 97 |
| 146 | 3300005719 | Ga0068861_100428210 | Ga0068861_1004282103 | 97 |
| 147 | 3300005834 | Ga0068851_10733654 | Ga0068851_107336541 | 97 |
| 148 | 3300005842 | Ga0068858_100022470 | Ga0068858_1000224702 | 97 |
| 149 | 3300006237 | Ga0097621_100682458 | Ga0097621_1006824582 | 97 |
| 150 | 3300006931 | Ga0097620_100942831 | Ga0097620_1009428313 | 97 |
| 151 | 3300009093 | Ga0105240_10245062 | Ga0105240_102450623 | 97 |
| 152 | 3300009148 | Ga0105243_10047500 | Ga0105243_100475001 | 97 |
| 153 | 3300009176 | Ga0105242_10411781 | Ga0105242_104117813 | 97 |
| 154 | 3300009176 | Ga0105242_10752040 | Ga0105242_107520401 | 97 |
| 155 | 3300009177 | Ga0105248_10014122 | Ga0105248_100141222 | 97 |
| 156 | 3300009545 | Ga0105237_10016417 | Ga0105237_100164174 | 97 |
| 157 | 3300009553 | Ga0105249_10020097 | Ga0105249_100200972 | 97 |
| 158 | 3300010375 | Ga0105239_10193386 | Ga0105239_101933861 | 97 |
| 159 | 3300011119 | Ga0105246_10090485 | Ga0105246_100904852 | 97 |
| 160 | 3300013104 | Ga0157370_10011035 | Ga0157370_100110352 | 97 |
| 161 | 3300013105 | Ga0157369_10008752 | Ga0157369_1000875213 | 97 |
| 162 | 3300013105 | Ga0157369_10156692 | Ga0157369_101566923 | 97 |
| 163 | 3300013296 | Ga0157374_10078673 | Ga0157374_100786732 | 97 |
| 164 | 3300013297 | Ga0157378_10344488 | Ga0157378_103444882 | 97 |
| 165 | 3300013297 | Ga0157378_10907978 | Ga0157378_109079782 | 97 |
| 166 | 3300013307 | Ga0157372_10053170 | Ga0157372_100531701 | 97 |
| 167 | 3300013307 | Ga0157372_10386314 | Ga0157372_103863143 | 97 |
| 168 | 3300013308 | Ga0157375_10031525 | Ga0157375_100315253 | 97 |
| 169 | 3300014969 | Ga0157376_10402357 | Ga0157376_104023573 | 97 |
| 170 | 3300020078 | Ga0206352_10984759 | Ga0206352_109847591 | 97 |
| 171 | 3300025899 | Ga0207642_10161883 | Ga0207642_101618832 | 97 |
| 172 | 3300025911 | Ga0207654_11322148 | Ga0207654_113221481 | 97 |
| 173 | 3300025913 | Ga0207695_10108928 | Ga0207695_101089283 | 97 |
| 174 | 3300025914 | Ga0207671_10009643 | Ga0207671_100096433 | 97 |
| 175 | 3300025916 | Ga0207663_11200895 | Ga0207663_112008951 | 97 |
| 176 | 3300025924 | Ga0207694_10110424 | Ga0207694_101104242 | 97 |
| 177 | 3300025927 | Ga0207687_10032291 | Ga0207687_100322912 | 97 |
| 178 | 3300025927 | Ga0207687_11244070 | Ga0207687_112440701 | 97 |
| 179 | 3300025934 | Ga0207686_10044279 | Ga0207686_100442792 | 97 |
| 180 | 3300025934 | Ga0207686_10245841 | Ga0207686_102458411 | 97 |
| 181 | 3300025935 | Ga0207709_10217793 | Ga0207709_102177932 | 97 |
| 182 | 3300025935 | Ga0207709_10350411 | Ga0207709_103504111 | 97 |
| 183 | 3300025936 | Ga0207670_10680428 | Ga0207670_106804281 | 97 |
| 184 | 3300025941 | Ga0207711_10001923 | Ga0207711_100019232 | 97 |
| 185 | 3300025949 | Ga0207667_10003608 | Ga0207667_100036089 | 97 |
| 186 | 3300025972 | Ga0207668_10612124 | Ga0207668_106121241 | 97 |
| 187 | 3300026035 | Ga0207703_10021117 | Ga0207703_100211177 | 97 |
| 188 | 3300026035 | Ga0207703_10524715 | Ga0207703_105247152 | 97 |
| 189 | 3300026041 | Ga0207639_11804462 | Ga0207639_118044621 | 97 |
| 190 | 3300026078 | Ga0207702_10152079 | Ga0207702_101520791 | 97 |
| 191 | 3300026078 | Ga0207702_10152751 | Ga0207702_101527511 | 97 |
| 192 | 3300026095 | Ga0207676_10237076 | Ga0207676_102370763 | 97 |
| 193 | 3300028381 | Ga0268264_10219525 | Ga0268264_102195253 | 97 |
| 194 | 3300035170 | Ga0373943_0090766 | Ga0373943_0090766_323_703 | 97 |
| 195 | 3300035695 | Ga0373927_0234406 | Ga0373927_0234406_293_673 | 97 |
| 196 | 3300035725 | Ga0373947_0170258 | Ga0373947_0170258_914_1294 | 97 |
| 197 | 3300037068 | Ga0373925_0010573 | Ga0373925_0010573_4118_4498 | 97 |
| 198 | 3300004803 | Ga0058862_12833164 | Ga0058862_128331641 | 98 |
| 199 | 3300005329 | Ga0070683_100025558 | Ga0070683_1000255582 | 98 |
| 200 | 3300005334 | Ga0068869_101156998 | Ga0068869_1011569982 | 98 |
| 201 | 3300005336 | Ga0070680_100353017 | Ga0070680_1003530172 | 98 |
| 202 | 3300005339 | Ga0070660_100007877 | Ga0070660_1000078779 | 98 |
| 203 | 3300005341 | Ga0070691_10000755 | Ga0070691_100007552 | 98 |
| 204 | 3300005344 | Ga0070661_100042849 | Ga0070661_1000428493 | 98 |
| 205 | 3300005458 | Ga0070681_10005341 | Ga0070681_100053414 | 98 |
| 206 | 3300005530 | Ga0070679_100003781 | Ga0070679_1000037814 | 98 |
| 207 | 3300005535 | Ga0070684_100057972 | Ga0070684_1000579722 | 98 |
| 208 | 3300005539 | Ga0068853_100010638 | Ga0068853_1000106382 | 98 |
| 209 | 3300005577 | Ga0068857_100003025 | Ga0068857_1000030253 | 98 |
| 210 | 3300005614 | Ga0068856_100000278 | Ga0068856_10000027844 | 98 |
| 211 | 3300005615 | Ga0070702_100288555 | Ga0070702_1002885552 | 98 |
| 212 | 3300005616 | Ga0068852_100116427 | Ga0068852_1001164273 | 98 |
| 213 | 3300005618 | Ga0068864_101188960 | Ga0068864_1011889602 | 98 |
| 214 | 3300009093 | Ga0105240_10020993 | Ga0105240_100209934 | 98 |
| 215 | 3300009098 | Ga0105245_11563468 | Ga0105245_115634682 | 98 |
| 216 | 3300009174 | Ga0105241_10108396 | Ga0105241_101083962 | 98 |
| 217 | 3300009177 | Ga0105248_10956879 | Ga0105248_109568792 | 98 |
| 218 | 3300009545 | Ga0105237_10098216 | Ga0105237_100982164 | 98 |
| 219 | 3300009551 | Ga0105238_10003657 | Ga0105238_1000365711 | 98 |
| 220 | 3300009551 | Ga0105238_11680374 | Ga0105238_116803741 | 98 |
| 221 | 3300010375 | Ga0105239_10201646 | Ga0105239_102016462 | 98 |
| 222 | 3300011119 | Ga0105246_10496800 | Ga0105246_104968002 | 98 |
| 223 | 3300013104 | Ga0157370_10012756 | Ga0157370_100127564 | 98 |
| 224 | 3300013104 | Ga0157370_12023375 | Ga0157370_120233751 | 98 |
| 225 | 3300013105 | Ga0157369_10009031 | Ga0157369_100090313 | 98 |
| 226 | 3300013307 | Ga0157372_10016975 | Ga0157372_100169753 | 98 |
| 227 | 3300013308 | Ga0157375_10329880 | Ga0157375_103298803 | 98 |
| 228 | 3300020070 | Ga0206356_10751596 | Ga0206356_107515961 | 98 |
| 229 | 3300020078 | Ga0206352_10380723 | Ga0206352_103807232 | 98 |
| 230 | 3300021384 | Ga0213876_10151394 | Ga0213876_101513942 | 98 |
| 231 | 3300025905 | Ga0207685_10733685 | Ga0207685_107336852 | 98 |
| 232 | 3300025911 | Ga0207654_10010792 | Ga0207654_100107925 | 98 |
| 233 | 3300025912 | Ga0207707_10000208 | Ga0207707_1000020821 | 98 |
| 234 | 3300025913 | Ga0207695_10001980 | Ga0207695_1000198013 | 98 |
| 235 | 3300025914 | Ga0207671_10023485 | Ga0207671_100234852 | 98 |
| 236 | 3300025917 | Ga0207660_10039644 | Ga0207660_100396445 | 98 |
| 237 | 3300025919 | Ga0207657_10106313 | Ga0207657_101063134 | 98 |
| 238 | 3300025920 | Ga0207649_10023134 | Ga0207649_100231343 | 98 |
| 239 | 3300025921 | Ga0207652_10001483 | Ga0207652_100014832 | 98 |
| 240 | 3300025924 | Ga0207694_10000800 | Ga0207694_1000080010 | 98 |
| 241 | 3300025935 | Ga0207709_11752647 | Ga0207709_117526471 | 98 |
| 242 | 3300025941 | Ga0207711_10670876 | Ga0207711_106708762 | 98 |
| 243 | 3300025944 | Ga0207661_10003943 | Ga0207661_100039432 | 98 |
| 244 | 3300025949 | Ga0207667_10015384 | Ga0207667_100153844 | 98 |
| 245 | 3300026041 | Ga0207639_10014533 | Ga0207639_100145332 | 98 |
| 246 | 3300026078 | Ga0207702_10001668 | Ga0207702_1000166814 | 98 |
| 247 | 3300026095 | Ga0207676_11124089 | Ga0207676_111240891 | 98 |
| 248 | 3300026116 | Ga0207674_10000310 | Ga0207674_1000031041 | 98 |
| 249 | 3300026142 | Ga0207698_10052131 | Ga0207698_100521312 | 98 |
| 250 | 3300031595 | Ga0265313_10004179 | Ga0265313_100041793 | 98 |
| 251 | 3300031712 | Ga0265342_10003171 | Ga0265342_100031713 | 98 |
| 252 | 3300035118 | Ga0373954_0508665 | Ga0373954_0508665_182_553 | 98 |
| 253 | 3300035692 | Ga0373935_0494292 | Ga0373935_0494292_477_857 | 98 |
| 254 | 3300039437 | Ga0436365_1790089 | Ga0436365_1790089_264_647 | 98 |
| 255 | 3300046472 | Ga0495580_0043038 | Ga0495580_0043038_2475_2852 | 98 |
| 256 | 3300046472 | Ga0495580_0144978 | Ga0495580_0144978_700_1080 | 98 |
| 257 | 3300048903 | Ga0496100_1331223 | Ga0496100_1331223_170_550 | 98 |
| 258 | 3300048907 | Ga0496104_0226938 | Ga0496104_0226938_504_884 | 98 |
| 259 | 3300006844 | Ga0075428_100049476 | Ga0075428_1000494764 | 101 |
| 260 | 3300009147 | Ga0114129_12415411 | Ga0114129_124154111 | 101 |
| 261 | 3300031344 | Ga0265316_10407563 | Ga0265316_104075632 | 101 |
| 262 | 3300044712 | Ga0453684_0542260 | Ga0453684_0542260_429_803 | 101 |
| 263 | 3300044712 | Ga0453684_0699489 | Ga0453684_0699489_321_698 | 101 |
| 264 | 3300044712 | Ga0453684_0763571 | Ga0453684_0763571_379_756 | 101 |
| 265 | 3300045051 | Ga0451576_1255267 | Ga0451576_1255267_351_728 | 101 |
| 266 | 3300049161 | Ga0501305_007281 | Ga0501305_007281_968_1354 | 101 |
| 267 | 3300005338 | Ga0068868_100717195 | Ga0068868_1007171951 | 102 |
| 268 | 3300005535 | Ga0070684_101975018 | Ga0070684_1019750181 | 102 |
| 269 | 3300005546 | Ga0070696_101140106 | Ga0070696_1011401061 | 102 |
| 270 | 3300005617 | Ga0068859_101861302 | Ga0068859_1018613022 | 102 |
| 271 | 3300006931 | Ga0097620_101861331 | Ga0097620_1018613312 | 102 |
| 272 | 3300009551 | Ga0105238_10843313 | Ga0105238_108433132 | 102 |
| 273 | 3300031649 | Ga0307514_10050235 | Ga0307514_100502354 | 102 |
| 274 | 3300045976 | Ga0466967_1272037 | Ga0466967_1272037_288_662 | 102 |
| 275 | 3300049130 | Ga0501310_037734 | Ga0501310_037734_39_425 | 102 |
| 276 | 3300005334 | Ga0068869_100053263 | Ga0068869_1000532632 | 103 |
| 277 | 3300005340 | Ga0070689_100134950 | Ga0070689_1001349502 | 103 |
| 278 | 3300005356 | Ga0070674_100069495 | Ga0070674_1000694952 | 103 |
| 279 | 3300005365 | Ga0070688_100359487 | Ga0070688_1003594871 | 103 |
| 280 | 3300005365 | Ga0070688_100589681 | Ga0070688_1005896812 | 103 |
| 281 | 3300005471 | Ga0070698_100024917 | Ga0070698_1000249178 | 103 |
| 282 | 3300005617 | Ga0068859_100419957 | Ga0068859_1004199571 | 103 |
| 283 | 3300005841 | Ga0068863_100685303 | Ga0068863_1006853032 | 103 |
| 284 | 3300006931 | Ga0097620_100419957 | Ga0097620_1004199571 | 103 |
| 285 | 3300009098 | Ga0105245_10189740 | Ga0105245_101897402 | 103 |
| 286 | 3300009148 | Ga0105243_10056116 | Ga0105243_100561164 | 103 |
| 287 | 3300013297 | Ga0157378_10384805 | Ga0157378_103848052 | 103 |
| 288 | 3300025927 | Ga0207687_10247839 | Ga0207687_102478393 | 103 |
| 289 | 3300025936 | Ga0207670_10183840 | Ga0207670_101838402 | 103 |
| 290 | 3300025937 | Ga0207669_10039989 | Ga0207669_100399892 | 103 |
| 291 | 3300025942 | Ga0207689_10104975 | Ga0207689_101049752 | 103 |
| 292 | 3300026088 | Ga0207641_10054321 | Ga0207641_100543213 | 103 |
| 293 | 3300026095 | Ga0207676_10224198 | Ga0207676_102241981 | 103 |
| 294 | 3300028380 | Ga0268265_10256127 | Ga0268265_102561272 | 103 |
| 295 | 3300028381 | Ga0268264_10803706 | Ga0268264_108037061 | 103 |
| 296 | 3300031507 | Ga0307509_10000112 | Ga0307509_1000011275 | 103 |
| 297 | 3300031507 | Ga0307509_10117324 | Ga0307509_101173242 | 103 |
| 298 | 3300031730 | Ga0307516_10068914 | Ga0307516_100689142 | 103 |
| 299 | 3300048909 | Ga0496106_1456320 | Ga0496106_1456320_11_385 | 103 |
| 300 | 3300053092 | Ga0500583_0377595 | Ga0500583_0377595_275_658 | 103 |
| 301 | 3300053103 | Ga0500555_141066 | Ga0500555_141066_85_474 | 103 |
| 302 | 3300004801 | Ga0058860_12134580 | Ga0058860_121345801 | 104 |
| 303 | 3300005530 | Ga0070679_100962179 | Ga0070679_1009621791 | 104 |
| 304 | 3300005539 | Ga0068853_101927933 | Ga0068853_1019279331 | 104 |
| 305 | 3300005548 | Ga0070665_101444134 | Ga0070665_1014441342 | 104 |
| 306 | 3300005617 | Ga0068859_100419957 | Ga0068859_1004199572 | 104 |
| 307 | 3300005618 | Ga0068864_100493733 | Ga0068864_1004937332 | 104 |
| 308 | 3300006028 | Ga0070717_10018330 | Ga0070717_100183302 | 104 |
| 309 | 3300006931 | Ga0097620_100419957 | Ga0097620_1004199572 | 104 |
| 310 | 3300009094 | Ga0111539_10016296 | Ga0111539_100162962 | 104 |
| 311 | 3300025321 | Ga0207656_10463585 | Ga0207656_104635852 | 104 |
| 312 | 3300025906 | Ga0207699_10995624 | Ga0207699_109956241 | 104 |
| 313 | 3300025918 | Ga0207662_10299640 | Ga0207662_102996402 | 104 |
| 314 | 3300026088 | Ga0207641_10054321 | Ga0207641_100543212 | 104 |
| 315 | 3300026095 | Ga0207676_10224198 | Ga0207676_102241982 | 104 |
| 316 | 3300027907 | Ga0207428_10016333 | Ga0207428_100163339 | 104 |
| 317 | 3300028379 | Ga0268266_10739487 | Ga0268266_107394872 | 104 |
| 318 | 3300028653 | Ga0265323_10220226 | Ga0265323_102202261 | 104 |
| 319 | 3300028800 | Ga0265338_10180892 | Ga0265338_101808923 | 104 |
| 320 | 3300031235 | Ga0265330_10001538 | Ga0265330_100015383 | 104 |
| 321 | 3300031344 | Ga0265316_10008144 | Ga0265316_100081443 | 104 |
| 322 | 3300031456 | Ga0307513_10359505 | Ga0307513_103595051 | 104 |
| 323 | 3300031712 | Ga0265342_10305733 | Ga0265342_103057332 | 104 |
| 324 | 3300035113 | Ga0373936_0000006 | Ga0373936_0000006_103121_103507 | 104 |
| 325 | 3300035119 | Ga0373956_0148674 | Ga0373956_0148674_421_804 | 104 |
| 326 | 3300035172 | Ga0373955_0075526 | Ga0373955_0075526_920_1303 | 104 |
| 327 | 3300035725 | Ga0373947_0567815 | Ga0373947_0567815_53_436 | 104 |
| 328 | 3300041461 | Ga0451805_102149 | Ga0451805_102149_66_437 | 104 |
| 329 | 3300047472 | Ga0495686_0025181 | Ga0495686_0025181_2867_3253 | 104 |
| 330 | 3300048911 | Ga0496108_0218168 | Ga0496108_0218168_380_763 | 104 |
| 331 | 3300049533 | Ga0501317_042186 | Ga0501317_042186_195_572 | 104 |
| 332 | 3300050511 | nmdc:mga08y16_14232_c1 | nmdc:mga08y16_14232_c1_1153_1533 | 104 |
| 333 | 3300005328 | Ga0070676_10002594 | Ga0070676_100025948 | 105 |
| 334 | 3300005330 | Ga0070690_100117465 | Ga0070690_1001174653 | 105 |
| 335 | 3300005334 | Ga0068869_100015118 | Ga0068869_1000151184 | 105 |
| 336 | 3300005339 | Ga0070660_100072704 | Ga0070660_1000727041 | 105 |
| 337 | 3300005340 | Ga0070689_100652949 | Ga0070689_1006529491 | 105 |
| 338 | 3300005341 | Ga0070691_10097612 | Ga0070691_100976122 | 105 |
| 339 | 3300005347 | Ga0070668_100289401 | Ga0070668_1002894013 | 105 |
| 340 | 3300005353 | Ga0070669_100103891 | Ga0070669_1001038912 | 105 |
| 341 | 3300005355 | Ga0070671_100595966 | Ga0070671_1005959662 | 105 |
| 342 | 3300005356 | Ga0070674_100034146 | Ga0070674_1000341462 | 105 |
| 343 | 3300005366 | Ga0070659_100403920 | Ga0070659_1004039202 | 105 |
| 344 | 3300005438 | Ga0070701_10038918 | Ga0070701_100389183 | 105 |
| 345 | 3300005440 | Ga0070705_100003038 | Ga0070705_1000030382 | 105 |
| 346 | 3300005444 | Ga0070694_100286968 | Ga0070694_1002869681 | 105 |
| 347 | 3300005456 | Ga0070678_100060561 | Ga0070678_1000605614 | 105 |
| 348 | 3300005457 | Ga0070662_100008090 | Ga0070662_1000080902 | 105 |
| 349 | 3300005459 | Ga0068867_100000709 | Ga0068867_1000007093 | 105 |
| 350 | 3300005467 | Ga0070706_100993854 | Ga0070706_1009938542 | 105 |
| 351 | 3300005530 | Ga0070679_100297498 | Ga0070679_1002974982 | 105 |
| 352 | 3300005535 | Ga0070684_100348102 | Ga0070684_1003481022 | 105 |
| 353 | 3300005539 | Ga0068853_100102311 | Ga0068853_1001023112 | 105 |
| 354 | 3300005544 | Ga0070686_100012677 | Ga0070686_1000126772 | 105 |
| 355 | 3300005616 | Ga0068852_100242015 | Ga0068852_1002420153 | 105 |
| 356 | 3300005617 | Ga0068859_100122928 | Ga0068859_1001229282 | 105 |
| 357 | 3300005718 | Ga0068866_10000494 | Ga0068866_1000049410 | 105 |
| 358 | 3300005719 | Ga0068861_100041696 | Ga0068861_1000416965 | 105 |
| 359 | 3300005841 | Ga0068863_102051601 | Ga0068863_1020516012 | 105 |
| 360 | 3300005842 | Ga0068858_100072533 | Ga0068858_1000725332 | 105 |
| 361 | 3300005843 | Ga0068860_100068561 | Ga0068860_1000685617 | 105 |
| 362 | 3300006177 | Ga0075362_10630114 | Ga0075362_106301141 | 105 |
| 363 | 3300006237 | Ga0097621_100183694 | Ga0097621_1001836943 | 105 |
| 364 | 3300006844 | Ga0075428_100204166 | Ga0075428_1002041663 | 105 |
| 365 | 3300006880 | Ga0075429_100358132 | Ga0075429_1003581322 | 105 |
| 366 | 3300006881 | Ga0068865_100032704 | Ga0068865_1000327044 | 105 |
| 367 | 3300006931 | Ga0097620_100122935 | Ga0097620_1001229352 | 105 |
| 368 | 3300009093 | Ga0105240_10073563 | Ga0105240_100735632 | 105 |
| 369 | 3300009098 | Ga0105245_10081277 | Ga0105245_100812772 | 105 |
| 370 | 3300009148 | Ga0105243_10029435 | Ga0105243_100294352 | 105 |
| 371 | 3300009174 | Ga0105241_10100942 | Ga0105241_101009423 | 105 |
| 372 | 3300009176 | Ga0105242_10024598 | Ga0105242_100245982 | 105 |
| 373 | 3300009177 | Ga0105248_10091573 | Ga0105248_100915732 | 105 |
| 374 | 3300009551 | Ga0105238_10249273 | Ga0105238_102492732 | 105 |
| 375 | 3300009553 | Ga0105249_11516322 | Ga0105249_115163221 | 105 |
| 376 | 3300010375 | Ga0105239_10128219 | Ga0105239_101282192 | 105 |
| 377 | 3300013306 | Ga0163162_11429626 | Ga0163162_114296262 | 105 |
| 378 | 3300013307 | Ga0157372_10107716 | Ga0157372_101077162 | 105 |
| 379 | 3300014745 | Ga0157377_11248264 | Ga0157377_112482641 | 105 |
| 380 | 3300014968 | Ga0157379_10045606 | Ga0157379_100456063 | 105 |
| 381 | 3300017792 | Ga0163161_10014816 | Ga0163161_100148162 | 105 |
| 382 | 3300025899 | Ga0207642_10021290 | Ga0207642_100212904 | 105 |
| 383 | 3300025903 | Ga0207680_10008975 | Ga0207680_100089752 | 105 |
| 384 | 3300025907 | Ga0207645_10001488 | Ga0207645_1000148818 | 105 |
| 385 | 3300025910 | Ga0207684_10371386 | Ga0207684_103713861 | 105 |
| 386 | 3300025911 | Ga0207654_10039497 | Ga0207654_100394972 | 105 |
| 387 | 3300025913 | Ga0207695_10293964 | Ga0207695_102939642 | 105 |
| 388 | 3300025919 | Ga0207657_10404054 | Ga0207657_104040542 | 105 |
| 389 | 3300025923 | Ga0207681_10061447 | Ga0207681_100614472 | 105 |
| 390 | 3300025924 | Ga0207694_10343034 | Ga0207694_103430342 | 105 |
| 391 | 3300025931 | Ga0207644_10533861 | Ga0207644_105338612 | 105 |
| 392 | 3300025933 | Ga0207706_10000025 | Ga0207706_1000002587 | 105 |
| 393 | 3300025934 | Ga0207686_10000932 | Ga0207686_1000093215 | 105 |
| 394 | 3300025935 | Ga0207709_10085508 | Ga0207709_100855082 | 105 |
| 395 | 3300025936 | Ga0207670_10721505 | Ga0207670_107215052 | 105 |
| 396 | 3300025937 | Ga0207669_10118315 | Ga0207669_101183152 | 105 |
| 397 | 3300025938 | Ga0207704_10046483 | Ga0207704_100464833 | 105 |
| 398 | 3300025941 | Ga0207711_10036628 | Ga0207711_100366282 | 105 |
| 399 | 3300025942 | Ga0207689_10006953 | Ga0207689_100069533 | 105 |
| 400 | 3300025961 | Ga0207712_10908089 | Ga0207712_109080892 | 105 |
| 401 | 3300025981 | Ga0207640_10004934 | Ga0207640_100049342 | 105 |
| 402 | 3300026041 | Ga0207639_10125052 | Ga0207639_101250521 | 105 |
| 403 | 3300026067 | Ga0207678_10527438 | Ga0207678_105274382 | 105 |
| 404 | 3300026089 | Ga0207648_10003523 | Ga0207648_100035235 | 105 |
| 405 | 3300026118 | Ga0207675_100119945 | Ga0207675_1001199452 | 105 |
| 406 | 3300026121 | Ga0207683_10025790 | Ga0207683_1002579013 | 105 |
| 407 | 3300026142 | Ga0207698_10206145 | Ga0207698_102061453 | 105 |
| 408 | 3300028381 | Ga0268264_10054422 | Ga0268264_100544222 | 105 |
| 409 | 3300028653 | Ga0265323_10010096 | Ga0265323_100100962 | 105 |
| 410 | 3300028654 | Ga0265322_10001588 | Ga0265322_100015882 | 105 |
| 411 | 3300031235 | Ga0265330_10038180 | Ga0265330_100381802 | 105 |
| 412 | 3300031238 | Ga0265332_10041964 | Ga0265332_100419642 | 105 |
| 413 | 3300031242 | Ga0265329_10000810 | Ga0265329_100008109 | 105 |
| 414 | 3300031249 | Ga0265339_10039721 | Ga0265339_100397213 | 105 |
| 415 | 3300031344 | Ga0265316_10003476 | Ga0265316_100034767 | 105 |
| 416 | 3300031507 | Ga0307509_10421613 | Ga0307509_104216132 | 105 |
| 417 | 3300031711 | Ga0265314_10354818 | Ga0265314_103548181 | 105 |
| 418 | 3300031712 | Ga0265342_10002849 | Ga0265342_100028495 | 105 |
| 419 | 3300033179 | Ga0307507_10155075 | Ga0307507_101550751 | 105 |
| 420 | 3300035692 | Ga0373935_0148891 | Ga0373935_0148891_1076_1462 | 105 |
| 421 | 3300041486 | Ga0451807_2653739 | Ga0451807_2653739_701_1078 | 105 |
| 422 | 3300042876 | Ga0451577_0043022 | Ga0451577_0043022_1589_1978 | 105 |
| 423 | 3300045051 | Ga0451576_0321743 | Ga0451576_0321743_690_1079 | 105 |
| 424 | 3300048905 | Ga0496102_0119576 | Ga0496102_0119576_1627_2016 | 105 |
| 425 | 3300048909 | Ga0496106_0082706 | Ga0496106_0082706_601_990 | 105 |
| 426 | 3300048917 | Ga0496114_0024308 | Ga0496114_0024308_2490_2879 | 105 |
| 427 | 3300049528 | Ga0501312_071219 | Ga0501312_071219_211_597 | 105 |
| 428 | 3300049571 | Ga0501034_0180779 | Ga0501034_0180779_176_562 | 105 |
| 429 | 3300049580 | Ga0501046_0193596 | Ga0501046_0193596_26_412 | 105 |
| 430 | 3300049581 | Ga0501047_0054863 | Ga0501047_0054863_1675_2061 | 105 |
| 431 | 3300049593 | Ga0501077_0309008 | Ga0501077_0309008_48_431 | 105 |
| 432 | 3300053130 | Ga0500642_0031474 | Ga0500642_0031474_992_1372 | 105 |
| 433 | 3300004799 | Ga0058863_11695332 | Ga0058863_116953321 | 106 |
| 434 | 3300005330 | Ga0070690_100035259 | Ga0070690_1000352592 | 106 |
| 435 | 3300005347 | Ga0070668_101277357 | Ga0070668_1012773571 | 106 |
| 436 | 3300005364 | Ga0070673_101959658 | Ga0070673_1019596582 | 106 |
| 437 | 3300005440 | Ga0070705_100585101 | Ga0070705_1005851012 | 106 |
| 438 | 3300005614 | Ga0068856_101461059 | Ga0068856_1014610592 | 106 |
| 439 | 3300005616 | Ga0068852_100140853 | Ga0068852_1001408533 | 106 |
| 440 | 3300007076 | Ga0075435_100307300 | Ga0075435_1003073002 | 106 |
| 441 | 3300009098 | Ga0105245_10012171 | Ga0105245_100121718 | 106 |
| 442 | 3300009098 | Ga0105245_11307417 | Ga0105245_113074172 | 106 |
| 443 | 3300009177 | Ga0105248_11548992 | Ga0105248_115489921 | 106 |
| 444 | 3300012476 | Ga0157344_1002277 | Ga0157344_10022771 | 106 |
| 445 | 3300012507 | Ga0157342_1012942 | Ga0157342_10129422 | 106 |
| 446 | 3300013104 | Ga0157370_10938980 | Ga0157370_109389801 | 106 |
| 447 | 3300013296 | Ga0157374_10052787 | Ga0157374_100527875 | 106 |
| 448 | 3300013297 | Ga0157378_10186958 | Ga0157378_101869582 | 106 |
| 449 | 3300014969 | Ga0157376_10041717 | Ga0157376_100417172 | 106 |
| 450 | 3300022467 | Ga0224712_10387618 | Ga0224712_103876182 | 106 |
| 451 | 3300025927 | Ga0207687_10011839 | Ga0207687_100118392 | 106 |
| 452 | 3300026142 | Ga0207698_10121656 | Ga0207698_101216562 | 106 |
| 453 | 3300028786 | Ga0307517_10044430 | Ga0307517_100444302 | 106 |
| 454 | 3300031731 | Ga0307405_10023738 | Ga0307405_100237382 | 106 |
| 455 | 3300032126 | Ga0307415_100182310 | Ga0307415_1001823102 | 106 |
| 456 | 3300032126 | Ga0307415_100917700 | Ga0307415_1009177001 | 106 |
| 457 | 3300035241 | Ga0373961_0000367 | Ga0373961_0000367_15256_15642 | 106 |
| 458 | 3300039437 | Ga0436365_0593949 | Ga0436365_0593949_18_407 | 106 |
| 459 | 3300048907 | Ga0496104_0650438 | Ga0496104_0650438_289_675 | 106 |
| 460 | 3300049162 | Ga0501307_057851 | Ga0501307_057851_191_568 | 106 |
| 461 | 3300050513 | nmdc:mga0rr50_171829_c1 | nmdc:mga0rr50_171829_c1_495_875 | 106 |
| 462 | 3300053090 | Ga0500646_0010523 | Ga0500646_0010523_1219_1605 | 106 |
| 463 | 3300053094 | Ga0500566_0049878 | Ga0500566_0049878_1261_1641 | 106 |
| 464 | 3300053099 | Ga0500654_071919 | Ga0500654_071919_621_1007 | 106 |
| 465 | 3300053108 | Ga0500562_034374 | Ga0500562_034374_30_416 | 106 |
| 466 | 3300004798 | Ga0058859_11763832 | Ga0058859_117638321 | 107 |
| 467 | 3300004800 | Ga0058861_10179658 | Ga0058861_101796581 | 107 |
| 468 | 3300005327 | Ga0070658_10533132 | Ga0070658_105331322 | 107 |
| 469 | 3300005340 | Ga0070689_100039067 | Ga0070689_1000390672 | 107 |
| 470 | 3300005441 | Ga0070700_100087468 | Ga0070700_1000874682 | 107 |
| 471 | 3300005530 | Ga0070679_101277769 | Ga0070679_1012777691 | 107 |
| 472 | 3300005563 | Ga0068855_100373998 | Ga0068855_1003739982 | 107 |
| 473 | 3300005614 | Ga0068856_101099063 | Ga0068856_1010990632 | 107 |
| 474 | 3300006195 | Ga0075366_10430895 | Ga0075366_104308952 | 107 |
| 475 | 3300006195 | Ga0075366_11007148 | Ga0075366_110071481 | 107 |
| 476 | 3300006844 | Ga0075428_101413782 | Ga0075428_1014137821 | 107 |
| 477 | 3300009094 | Ga0111539_10532203 | Ga0111539_105322031 | 107 |
| 478 | 3300009101 | Ga0105247_10003690 | Ga0105247_100036908 | 107 |
| 479 | 3300014968 | Ga0157379_11105580 | Ga0157379_111055801 | 107 |
| 480 | 3300025900 | Ga0207710_10000970 | Ga0207710_100009702 | 107 |
| 481 | 3300025917 | Ga0207660_11337923 | Ga0207660_113379231 | 107 |
| 482 | 3300025936 | Ga0207670_10005394 | Ga0207670_100053943 | 107 |
| 483 | 3300026075 | Ga0207708_10130203 | Ga0207708_101302032 | 107 |
| 484 | 3300026116 | Ga0207674_11365689 | Ga0207674_113656891 | 107 |
| 485 | 3300028556 | Ga0265337_1041617 | Ga0265337_10416171 | 107 |
| 486 | 3300028573 | Ga0265334_10040083 | Ga0265334_100400833 | 107 |
| 487 | 3300028653 | Ga0265323_10000813 | Ga0265323_1000081312 | 107 |
| 488 | 3300028654 | Ga0265322_10056466 | Ga0265322_100564661 | 107 |
| 489 | 3300028800 | Ga0265338_10197518 | Ga0265338_101975182 | 107 |
| 490 | 3300029957 | Ga0265324_10001138 | Ga0265324_100011387 | 107 |
| 491 | 3300031235 | Ga0265330_10023175 | Ga0265330_100231752 | 107 |
| 492 | 3300031242 | Ga0265329_10003030 | Ga0265329_100030303 | 107 |
| 493 | 3300031249 | Ga0265339_10000001 | Ga0265339_10000001279 | 107 |
| 494 | 3300031249 | Ga0265339_10182652 | Ga0265339_101826521 | 107 |
| 495 | 3300031344 | Ga0265316_10003553 | Ga0265316_100035537 | 107 |
| 496 | 3300031595 | Ga0265313_10006342 | Ga0265313_100063428 | 107 |
| 497 | 3300031711 | Ga0265314_10002901 | Ga0265314_1000290115 | 107 |
| 498 | 3300031712 | Ga0265342_10095154 | Ga0265342_100951542 | 107 |
| 499 | 3300031731 | Ga0307405_10653444 | Ga0307405_106534442 | 107 |
| 500 | 3300033524 | Ga0316592_1168513 | Ga0316592_11685131 | 107 |
| 501 | 3300039438 | Ga0436360_1132549 | Ga0436360_1132549_162_548 | 107 |
| 502 | 3300044694 | Ga0466963_0142576 | Ga0466963_0142576_34_426 | 107 |
| 503 | 3300044706 | Ga0466964_0229274 | Ga0466964_0229274_487_879 | 107 |
| 504 | 3300044712 | Ga0453684_1466812 | Ga0453684_1466812_71_460 | 107 |
| 505 | 3300045049 | Ga0466959_0031428 | Ga0466959_0031428_2802_3194 | 107 |
| 506 | 3300047472 | Ga0495686_0025181 | Ga0495686_0025181_3386_3766 | 107 |
| 507 | 3300047472 | Ga0495686_0045414 | Ga0495686_0045414_2108_2488 | 107 |
| 508 | 3300049162 | Ga0501307_005813 | Ga0501307_005813_246_629 | 107 |
| 509 | 3300049539 | Ga0501323_029790 | Ga0501323_029790_68_454 | 107 |
| 510 | 3300049569 | Ga0501032_0358963 | Ga0501032_0358963_379_768 | 107 |
| 511 | 3300049572 | Ga0501036_0031623 | Ga0501036_0031623_3138_3530 | 107 |
| 512 | 3300049585 | Ga0501069_0028958 | Ga0501069_0028958_72_452 | 107 |
| 513 | 3300049585 | Ga0501069_0053468 | Ga0501069_0053468_1641_2021 | 107 |
| 514 | 3300049586 | Ga0501070_0038089 | Ga0501070_0038089_172_552 | 107 |
| 515 | 3300049586 | Ga0501070_0072970 | Ga0501070_0072970_637_1029 | 107 |
| 516 | 3300049586 | Ga0501070_0548583 | Ga0501070_0548583_173_553 | 107 |
| 517 | 3300049587 | Ga0501071_0066878 | Ga0501071_0066878_1602_1982 | 107 |
| 518 | 3300049588 | Ga0501072_1083997 | Ga0501072_1083997_150_530 | 107 |
| 519 | 3300049590 | Ga0501074_0022208 | Ga0501074_0022208_2858_3250 | 107 |
| 520 | 3300049741 | Ga0501079_0159978 | Ga0501079_0159978_1054_1446 | 107 |
| 521 | 3300049742 | Ga0501080_0063062 | Ga0501080_0063062_417_809 | 107 |
| 522 | 3300049743 | Ga0501081_0386188 | Ga0501081_0386188_220_612 | 107 |
| 523 | 3300049744 | Ga0501083_0027701 | Ga0501083_0027701_639_1019 | 107 |
| 524 | 3300050493 | nmdc:mga0k408_572499_c1 | nmdc:mga0k408_572499_c1_191_568 | 107 |
| 525 | 3300050493 | nmdc:mga0k408_839934_c1 | nmdc:mga0k408_839934_c1_124_507 | 107 |
| 526 | 3300050511 | nmdc:mga08y16_684200_c1 | nmdc:mga08y16_684200_c1_285_665 | 107 |
| 527 | 3300053093 | Ga0500651_0494703 | Ga0500651_0494703_33_416 | 107 |
| 528 | 3300053120 | Ga0500597_157237 | Ga0500597_157237_153_536 | 107 |
| 529 | 3300053123 | Ga0500614_006909 | Ga0500614_006909_1093_1476 | 107 |
| 530 | 3300060353 | Ga0501082_0057753 | Ga0501082_0057753_729_1121 | 107 |
| 531 | 3300060353 | Ga0501082_0406418 | Ga0501082_0406418_789_1169 | 107 |
| 532 | 3300004798 | Ga0058859_10064973 | Ga0058859_100649732 | 108 |
| 533 | 3300004799 | Ga0058863_10166919 | Ga0058863_101669191 | 108 |
| 534 | 3300004800 | Ga0058861_10180125 | Ga0058861_101801252 | 108 |
| 535 | 3300004801 | Ga0058860_12162593 | Ga0058860_121625932 | 108 |
| 536 | 3300004803 | Ga0058862_10209411 | Ga0058862_102094112 | 108 |
| 537 | 3300005329 | Ga0070683_100098230 | Ga0070683_1000982305 | 108 |
| 538 | 3300005334 | Ga0068869_100053263 | Ga0068869_1000532633 | 108 |
| 539 | 3300005336 | Ga0070680_100451887 | Ga0070680_1004518872 | 108 |
| 540 | 3300005337 | Ga0070682_100167591 | Ga0070682_1001675912 | 108 |
| 541 | 3300005338 | Ga0068868_100862151 | Ga0068868_1008621511 | 108 |
| 542 | 3300005343 | Ga0070687_100037795 | Ga0070687_1000377953 | 108 |
| 543 | 3300005365 | Ga0070688_100359487 | Ga0070688_1003594872 | 108 |
| 544 | 3300005438 | Ga0070701_10034508 | Ga0070701_100345084 | 108 |
| 545 | 3300005441 | Ga0070700_100520294 | Ga0070700_1005202942 | 108 |
| 546 | 3300005535 | Ga0070684_100054146 | Ga0070684_1000541464 | 108 |
| 547 | 3300005547 | Ga0070693_100620876 | Ga0070693_1006208761 | 108 |
| 548 | 3300005577 | Ga0068857_100394141 | Ga0068857_1003941412 | 108 |
| 549 | 3300005614 | Ga0068856_100656433 | Ga0068856_1006564332 | 108 |
| 550 | 3300005617 | Ga0068859_101686387 | Ga0068859_1016863872 | 108 |
| 551 | 3300005718 | Ga0068866_10277600 | Ga0068866_102776002 | 108 |
| 552 | 3300005719 | Ga0068861_101137646 | Ga0068861_1011376462 | 108 |
| 553 | 3300005843 | Ga0068860_100879434 | Ga0068860_1008794342 | 108 |
| 554 | 3300005844 | Ga0068862_101190978 | Ga0068862_1011909782 | 108 |
| 555 | 3300006931 | Ga0097620_101686139 | Ga0097620_1016861391 | 108 |
| 556 | 3300009093 | Ga0105240_10000795 | Ga0105240_1000079540 | 108 |
| 557 | 3300009094 | Ga0111539_10217903 | Ga0111539_102179034 | 108 |
| 558 | 3300009098 | Ga0105245_10189740 | Ga0105245_101897403 | 108 |
| 559 | 3300009148 | Ga0105243_10056116 | Ga0105243_100561163 | 108 |
| 560 | 3300011119 | Ga0105246_11360627 | Ga0105246_113606271 | 108 |
| 561 | 3300013105 | Ga0157369_10347380 | Ga0157369_103473802 | 108 |
| 562 | 3300013297 | Ga0157378_10031351 | Ga0157378_100313516 | 108 |
| 563 | 3300013307 | Ga0157372_10190087 | Ga0157372_101900872 | 108 |
| 564 | 3300014325 | Ga0163163_10553785 | Ga0163163_105537851 | 108 |
| 565 | 3300014969 | Ga0157376_10253591 | Ga0157376_102535912 | 108 |
| 566 | 3300020070 | Ga0206356_10155774 | Ga0206356_101557741 | 108 |
| 567 | 3300020070 | Ga0206356_10445605 | Ga0206356_104456052 | 108 |
| 568 | 3300020078 | Ga0206352_11159890 | Ga0206352_111598902 | 108 |
| 569 | 3300020078 | Ga0206352_11360316 | Ga0206352_113603163 | 108 |
| 570 | 3300025899 | Ga0207642_10989180 | Ga0207642_109891801 | 108 |
| 571 | 3300025912 | Ga0207707_10980627 | Ga0207707_109806271 | 108 |
| 572 | 3300025913 | Ga0207695_10011622 | Ga0207695_100116223 | 108 |
| 573 | 3300025917 | Ga0207660_11141456 | Ga0207660_111414562 | 108 |
| 574 | 3300025918 | Ga0207662_10053691 | Ga0207662_100536912 | 108 |
| 575 | 3300025921 | Ga0207652_10186689 | Ga0207652_101866892 | 108 |
| 576 | 3300025924 | Ga0207694_10186966 | Ga0207694_101869662 | 108 |
| 577 | 3300025927 | Ga0207687_10247839 | Ga0207687_102478392 | 108 |
| 578 | 3300025935 | Ga0207709_10320751 | Ga0207709_103207512 | 108 |
| 579 | 3300025942 | Ga0207689_10104975 | Ga0207689_101049753 | 108 |
| 580 | 3300025944 | Ga0207661_10053133 | Ga0207661_100531333 | 108 |
| 581 | 3300026075 | Ga0207708_10496663 | Ga0207708_104966632 | 108 |
| 582 | 3300026078 | Ga0207702_10111508 | Ga0207702_101115082 | 108 |
| 583 | 3300026088 | Ga0207641_10257739 | Ga0207641_102577393 | 108 |
| 584 | 3300026116 | Ga0207674_10103448 | Ga0207674_101034484 | 108 |
| 585 | 3300026118 | Ga0207675_100198537 | Ga0207675_1001985373 | 108 |
| 586 | 3300028380 | Ga0268265_10256127 | Ga0268265_102561273 | 108 |
| 587 | 3300028381 | Ga0268264_10803706 | Ga0268264_108037062 | 108 |
| 588 | 3300028794 | Ga0307515_10019188 | Ga0307515_100191884 | 108 |
| 589 | 3300031240 | Ga0265320_10334821 | Ga0265320_103348211 | 108 |
| 590 | 3300031727 | Ga0316576_10085280 | Ga0316576_100852803 | 108 |
| 591 | 3300033524 | Ga0316592_1034587 | Ga0316592_10345872 | 108 |
| 592 | 3300033524 | Ga0316592_1077059 | Ga0316592_10770591 | 108 |
| 593 | 3300033527 | Ga0316586_1042064 | Ga0316586_10420641 | 108 |
| 594 | 3300033527 | Ga0316586_1047656 | Ga0316586_10476561 | 108 |
| 595 | 3300033528 | Ga0316588_1000219 | Ga0316588_10002199 | 108 |
| 596 | 3300033528 | Ga0316588_1010779 | Ga0316588_10107792 | 108 |
| 597 | 3300033529 | Ga0316587_1028265 | Ga0316587_10282651 | 108 |
| 598 | 3300034818 | Ga0373950_0000077 | Ga0373950_0000077_4675_5061 | 108 |
| 599 | 3300035090 | Ga0373949_0000225 | Ga0373949_0000225_2936_3316 | 108 |
| 600 | 3300039450 | Ga0436363_0308745 | Ga0436363_0308745_471_860 | 108 |
| 601 | 3300045051 | Ga0451576_0037161 | Ga0451576_0037161_2968_3351 | 108 |
| 602 | 3300046471 | Ga0495650_0287647 | Ga0495650_0287647_72_452 | 108 |
| 603 | 3300046500 | Ga0495596_0287436 | Ga0495596_0287436_22_402 | 108 |
| 604 | 3300046516 | Ga0495628_0961816 | Ga0495628_0961816_34_420 | 108 |
| 605 | 3300048910 | Ga0496107_0919005 | Ga0496107_0919005_139_528 | 108 |
| 606 | 3300048912 | Ga0496109_1352099 | Ga0496109_1352099_14_403 | 108 |
| 607 | 3300048915 | Ga0496112_0007223 | Ga0496112_0007223_1430_1819 | 108 |
| 608 | 3300049572 | Ga0501036_0632006 | Ga0501036_0632006_483_869 | 108 |
| 609 | 3300049589 | Ga0501073_0030016 | Ga0501073_0030016_341_730 | 108 |
| 610 | 3300050511 | nmdc:mga08y16_443260_c1 | nmdc:mga08y16_443260_c1_476_862 | 108 |
| 611 | 3300053092 | Ga0500583_0112280 | Ga0500583_0112280_741_1121 | 108 |
| 612 | 3300053130 | Ga0500642_0007926 | Ga0500642_0007926_347_727 | 108 |
| 613 | 3300002863 | Ga0006769J43182_102873 | Ga0006769J43182_1028731 | 109 |
| 614 | 3300002868 | Ga0006767J43181_102926 | Ga0006767J43181_1029267 | 109 |
| 615 | 3300002870 | Ga0006763J43179_103249 | Ga0006763J43179_1032496 | 109 |
| 616 | 3300002872 | Ga0006762J43184_101278 | Ga0006762J43184_1012781 | 109 |
| 617 | 3300003158 | Ga0006760J45825_102611 | Ga0006760J45825_1026113 | 109 |
| 618 | 3300003159 | Ga0006771J45828_104384 | Ga0006771J45828_1043841 | 109 |
| 619 | 3300003161 | Ga0006765J45826_106834 | Ga0006765J45826_1068341 | 109 |
| 620 | 3300003162 | Ga0006778J45830_1038270 | Ga0006778J45830_10382702 | 109 |
| 621 | 3300003163 | Ga0006759J45824_1005533 | Ga0006759J45824_10055338 | 109 |
| 622 | 3300003163 | Ga0006759J45824_1187716 | Ga0006759J45824_11877162 | 109 |
| 623 | 3300003284 | Ga0006773J48901_13004 | Ga0006773J48901_130041 | 109 |
| 624 | 3300003300 | Ga0006758J48902_1007634 | Ga0006758J48902_10076347 | 109 |
| 625 | 3300003305 | Ga0006770J48903_1018629 | Ga0006770J48903_10186292 | 109 |
| 626 | 3300003544 | Ga0007417J51691_1046473 | Ga0007417J51691_10464731 | 109 |
| 627 | 3300003574 | Ga0007410J51695_1075587 | Ga0007410J51695_10755871 | 109 |
| 628 | 3300003574 | Ga0007410J51695_1111274 | Ga0007410J51695_11112742 | 109 |
| 629 | 3300003693 | Ga0032354_1006912 | Ga0032354_10069127 | 109 |
| 630 | 3300003717 | Ga0006766_112346 | Ga0006766_1123461 | 109 |
| 631 | 3300004798 | Ga0058859_11763153 | Ga0058859_117631531 | 109 |
| 632 | 3300004798 | Ga0058859_11787064 | Ga0058859_117870641 | 109 |
| 633 | 3300004799 | Ga0058863_10018461 | Ga0058863_100184612 | 109 |
| 634 | 3300004799 | Ga0058863_10049786 | Ga0058863_100497861 | 109 |
| 635 | 3300004799 | Ga0058863_10078913 | Ga0058863_100789132 | 109 |
| 636 | 3300004799 | Ga0058863_10129461 | Ga0058863_101294611 | 109 |
| 637 | 3300004800 | Ga0058861_10048978 | Ga0058861_100489783 | 109 |
| 638 | 3300004800 | Ga0058861_10116376 | Ga0058861_101163761 | 109 |
| 639 | 3300004800 | Ga0058861_11984899 | Ga0058861_119848991 | 109 |
| 640 | 3300004801 | Ga0058860_12066015 | Ga0058860_120660151 | 109 |
| 641 | 3300004803 | Ga0058862_10025574 | Ga0058862_100255741 | 109 |
| 642 | 3300004803 | Ga0058862_10108482 | Ga0058862_101084822 | 109 |
| 643 | 3300004803 | Ga0058862_10288134 | Ga0058862_102881342 | 109 |
| 644 | 3300005327 | Ga0070658_11145262 | Ga0070658_111452621 | 109 |
| 645 | 3300005329 | Ga0070683_100543254 | Ga0070683_1005432542 | 109 |
| 646 | 3300005329 | Ga0070683_100729654 | Ga0070683_1007296542 | 109 |
| 647 | 3300005335 | Ga0070666_11110873 | Ga0070666_111108732 | 109 |
| 648 | 3300005336 | Ga0070680_100494220 | Ga0070680_1004942202 | 109 |
| 649 | 3300005338 | Ga0068868_100065914 | Ga0068868_1000659142 | 109 |
| 650 | 3300005340 | Ga0070689_100782984 | Ga0070689_1007829841 | 109 |
| 651 | 3300005341 | Ga0070691_10166060 | Ga0070691_101660602 | 109 |
| 652 | 3300005356 | Ga0070674_100287914 | Ga0070674_1002879142 | 109 |
| 653 | 3300005456 | Ga0070678_100195566 | Ga0070678_1001955662 | 109 |
| 654 | 3300005458 | Ga0070681_10168536 | Ga0070681_101685363 | 109 |
| 655 | 3300005459 | Ga0068867_100124906 | Ga0068867_1001249062 | 109 |
| 656 | 3300005530 | Ga0070679_100218948 | Ga0070679_1002189483 | 109 |
| 657 | 3300005530 | Ga0070679_100407351 | Ga0070679_1004073511 | 109 |
| 658 | 3300005535 | Ga0070684_100304971 | Ga0070684_1003049712 | 109 |
| 659 | 3300005535 | Ga0070684_100340394 | Ga0070684_1003403941 | 109 |
| 660 | 3300005546 | Ga0070696_101371579 | Ga0070696_1013715791 | 109 |
| 661 | 3300005563 | Ga0068855_101868494 | Ga0068855_1018684941 | 109 |
| 662 | 3300005614 | Ga0068856_100204627 | Ga0068856_1002046272 | 109 |
| 663 | 3300005614 | Ga0068856_100334387 | Ga0068856_1003343872 | 109 |
| 664 | 3300005614 | Ga0068856_100374426 | Ga0068856_1003744262 | 109 |
| 665 | 3300005618 | Ga0068864_100180649 | Ga0068864_1001806492 | 109 |
| 666 | 3300005718 | Ga0068866_10205223 | Ga0068866_102052232 | 109 |
| 667 | 3300005840 | Ga0068870_11109853 | Ga0068870_111098531 | 109 |
| 668 | 3300006237 | Ga0097621_100100789 | Ga0097621_1001007892 | 109 |
| 669 | 3300006358 | Ga0068871_100028407 | Ga0068871_1000284079 | 109 |
| 670 | 3300006852 | Ga0075433_10369358 | Ga0075433_103693581 | 109 |
| 671 | 3300006881 | Ga0068865_100058801 | Ga0068865_1000588011 | 109 |
| 672 | 3300006881 | Ga0068865_101225941 | Ga0068865_1012259412 | 109 |
| 673 | 3300009094 | Ga0111539_10662820 | Ga0111539_106628202 | 109 |
| 674 | 3300009147 | Ga0114129_12390434 | Ga0114129_123904341 | 109 |
| 675 | 3300009148 | Ga0105243_12302616 | Ga0105243_123026161 | 109 |
| 676 | 3300009176 | Ga0105242_10097645 | Ga0105242_100976453 | 109 |
| 677 | 3300009176 | Ga0105242_10102984 | Ga0105242_101029844 | 109 |
| 678 | 3300013104 | Ga0157370_12087428 | Ga0157370_120874281 | 109 |
| 679 | 3300013296 | Ga0157374_10340056 | Ga0157374_103400562 | 109 |
| 680 | 3300013308 | Ga0157375_11110152 | Ga0157375_111101522 | 109 |
| 681 | 3300020078 | Ga0206352_10440647 | Ga0206352_104406472 | 109 |
| 682 | 3300020078 | Ga0206352_10458663 | Ga0206352_104586631 | 109 |
| 683 | 3300025899 | Ga0207642_10094851 | Ga0207642_100948512 | 109 |
| 684 | 3300025912 | Ga0207707_10216497 | Ga0207707_102164972 | 109 |
| 685 | 3300025912 | Ga0207707_10542140 | Ga0207707_105421402 | 109 |
| 686 | 3300025914 | Ga0207671_10307218 | Ga0207671_103072182 | 109 |
| 687 | 3300025917 | Ga0207660_10222965 | Ga0207660_102229653 | 109 |
| 688 | 3300025917 | Ga0207660_10374121 | Ga0207660_103741212 | 109 |
| 689 | 3300025921 | Ga0207652_10117930 | Ga0207652_101179303 | 109 |
| 690 | 3300025921 | Ga0207652_10322615 | Ga0207652_103226151 | 109 |
| 691 | 3300025921 | Ga0207652_10470139 | Ga0207652_104701391 | 109 |
| 692 | 3300025934 | Ga0207686_10098042 | Ga0207686_100980423 | 109 |
| 693 | 3300025934 | Ga0207686_10237389 | Ga0207686_102373892 | 109 |
| 694 | 3300025938 | Ga0207704_10084243 | Ga0207704_100842431 | 109 |
| 695 | 3300025944 | Ga0207661_11187380 | Ga0207661_111873801 | 109 |
| 696 | 3300025981 | Ga0207640_11105396 | Ga0207640_111053962 | 109 |
| 697 | 3300026023 | Ga0207677_10043856 | Ga0207677_100438564 | 109 |
| 698 | 3300026089 | Ga0207648_10088131 | Ga0207648_100881313 | 109 |
| 699 | 3300026095 | Ga0207676_10138487 | Ga0207676_101384872 | 109 |
| 700 | 3300026121 | Ga0207683_10025820 | Ga0207683_100258202 | 109 |
| 701 | 3300030863 | Ga0265766_1003084 | Ga0265766_10030841 | 109 |
| 702 | 3300030882 | Ga0265764_106806 | Ga0265764_1068061 | 109 |
| 703 | 3300030888 | Ga0265769_114939 | Ga0265769_1149391 | 109 |
| 704 | 3300030963 | Ga0265768_104375 | Ga0265768_1043752 | 109 |
| 705 | 3300031727 | Ga0316576_10169449 | Ga0316576_101694492 | 109 |
| 706 | 3300031727 | Ga0316576_11090246 | Ga0316576_110902461 | 109 |
| 707 | 3300033524 | Ga0316592_1015053 | Ga0316592_10150533 | 109 |
| 708 | 3300033528 | Ga0316588_1039464 | Ga0316588_10394642 | 109 |
| 709 | 3300033528 | Ga0316588_1167374 | Ga0316588_11673741 | 109 |
| 710 | 3300036457 | Ga0265778_001330 | Ga0265778_001330_781_1167 | 109 |
| 711 | 3300039437 | Ga0436365_0629347 | Ga0436365_0629347_393_779 | 109 |
| 712 | 3300039447 | Ga0436361_0484302 | Ga0436361_0484302_3318_3713 | 109 |
| 713 | 3300041453 | Ga0451797_0755971 | Ga0451797_0755971_120_503 | 109 |
| 714 | 3300042876 | Ga0451577_0035060 | Ga0451577_0035060_2166_2555 | 109 |
| 715 | 3300044673 | Ga0453683_0072285 | Ga0453683_0072285_812_1198 | 109 |
| 716 | 3300044712 | Ga0453684_0000116 | Ga0453684_0000116_232739_233128 | 109 |
| 717 | 3300044712 | Ga0453684_0298379 | Ga0453684_0298379_998_1387 | 109 |
| 718 | 3300044842 | Ga0466957_0850078 | Ga0466957_0850078_125_514 | 109 |
| 719 | 3300045051 | Ga0451576_0118318 | Ga0451576_0118318_2109_2498 | 109 |
| 720 | 3300046679 | Ga0495623_0163091 | Ga0495623_0163091_895_1281 | 109 |
| 721 | 3300047322 | Ga0495680_0863936 | Ga0495680_0863936_177_563 | 109 |
| 722 | 3300047444 | Ga0495675_0080546 | Ga0495675_0080546_670_1056 | 109 |
| 723 | 3300048918 | Ga0496115_0220972 | Ga0496115_0220972_966_1355 | 109 |
| 724 | 3300049129 | Ga0501309_062099 | Ga0501309_062099_124_513 | 109 |
| 725 | 3300049529 | Ga0501313_042794 | Ga0501313_042794_191_580 | 109 |
| 726 | 3300049571 | Ga0501034_0058539 | Ga0501034_0058539_877_1263 | 109 |
| 727 | 3300050515 | nmdc:mga0a205_215651_c1 | nmdc:mga0a205_215651_c1_1321_1707 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ctf-assembly1.cif.gz_A-2 | structure of the c-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms | 0.9772 | 42 | 109 |
| 1ctf-assembly1.cif.gz_A-2 | structure of the c-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms | 0.9634 | 42 | 109 |
| 4v5n-assembly1.cif.gz_BL | trna translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post) | 0.938 | 44 | 109 |
| 8phj-assembly1.cif.gz_W | ca4-bound cami1 in complex with 70s ribosome | 0.9352 | 44 | 107 |
| 1rqs-assembly1.cif.gz_A | nmr structure of c-terminal domain of ribosomal protein l7 from e.coli | 0.9336 | 42 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHE3_59_130_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.988 | 42 | 109 | 3.30.1390.10 |
| 1ctfA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9772 | 42 | 109 | 3.30.1390.10 |
| 1ctfA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9634 | 42 | 109 | 3.30.1390.10 |
| af_P36211_122_192_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9581 | 40 | 108 | 3.30.1390.10 |
| af_Q86KA1_110_181_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9456 | 42 | 107 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V7WYQ4-F1-model_v4 | 50S ribosomal protein L7/L12 | 1.005 | 42 | 109 |
GO:0003729
GO:0003735 GO:0006412 GO:0022625 |
| AF-F3CFJ1-F1-model_v4 | 50S ribosomal protein L7/L12 | 1.003 | 42 | 109 |
GO:0003729
GO:0003735 GO:0006412 GO:0022625 |
| AF-A0A1G1ZFH1-F1-model_v4 | 50S ribosomal protein L7/L12 | 1.001 | 42 | 109 |
GO:0003729
GO:0003735 GO:0006412 GO:0022625 |
| AF-A0A7X9CZI0-F1-model_v4 | 50S ribosomal protein L7/L12 | 1.001 | 42 | 109 |
GO:0003729
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A4S8PCP5-F1-model_v4 | Ribosomal protein L7/L12 | 0.9997 | 42 | 109 |
GO:0003729
GO:0003735 GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar