F477441

General Info

Members Datasets Scaffolds Average Seq Length
722 243 717 155

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0149211|Ga0495629_0149211_305_811
Length 168
Sequence MHSKIRIREDKEKAMDYVFVKWLHILSSTFLFGTGLGSAWYMLFANVSRDVRAIAVVSKYVVIADWLFTATTAIAQPATGFYMMHLAGYPITSHWIKWSLVLYVLAGACWLPVVWLQMRLRDLAAQAARDGSELPPLYWTYFKTWVALGIPAFIAFVFIFWFMVSKPV

Samples

Sample ID Description Type Environment
1 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
2 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
3 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
4 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.14
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 2.91
Rhizosphere 93.07
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1011038 3300003762 Bacteria 1621
2 Ga0065165_1000488 3300005262 Bacteria 61235
3 Ga0070658_10607424 3300005327 Bacteria 948
4 Ga0070676_10532683 3300005328 Bacteria 838
5 Ga0070670_100056427 3300005331 Bacteria 3370
6 Ga0070670_101387567 3300005331 Bacteria 644
7 Ga0068869_100600397 3300005334 Bacteria 930
8 Ga0070682_100017388 3300005337 Bacteria 4192
9 Ga0068868_100190194 3300005338 Bacteria 1707
10 Ga0070660_100120090 3300005339 Bacteria 2097
11 Ga0070660_100207178 3300005339 Bacteria 1591
12 Ga0070660_100336855 3300005339 Bacteria 1241
13 Ga0070660_100431034 3300005339 Bacteria 1092
14 Ga0070660_100560847 3300005339 Bacteria 953
15 Ga0070661_100007934 3300005344 Bacteria 7330
16 Ga0070661_100047321 3300005344 Bacteria 3147
17 Ga0070661_100080308 3300005344 Bacteria 2407
18 Ga0070661_100093381 3300005344 Bacteria 2229
19 Ga0070675_100709641 3300005354 Bacteria 916
20 Ga0070659_100260942 3300005366 Bacteria 1437
21 Ga0070659_100332645 3300005366 Bacteria 1272
22 Ga0070667_100010185 3300005367 Bacteria 7768
23 Ga0070667_100507166 3300005367 Bacteria 1106
24 Ga0070709_10378838 3300005434 Unclassified 1051
25 Ga0070711_100189855 3300005439 Unclassified 1578
26 Ga0070663_100034757 3300005455 Bacteria 3492
27 Ga0070662_100150904 3300005457 Bacteria 1809
28 Ga0070662_100386636 3300005457 Bacteria 1152
29 Ga0070662_100817814 3300005457 Bacteria 792
30 Ga0070679_100221109 3300005530 Bacteria 1855
31 Ga0070679_100412662 3300005530 Bacteria 1296
32 Ga0068853_100041983 3300005539 Bacteria 3908
33 Ga0068853_100089593 3300005539 Bacteria 2702
34 Ga0068853_100187702 3300005539 Bacteria 1877
35 Ga0068853_100410458 3300005539 Bacteria 1269
36 Ga0070672_101261335 3300005543 Bacteria 659
37 Ga0068855_100016605 3300005563 Bacteria 8853
38 Ga0068855_100032498 3300005563 Bacteria 6230
39 Ga0068855_100052555 3300005563 Bacteria 4796
40 Ga0068855_101936247 3300005563 Bacteria 596
41 Ga0070664_100097469 3300005564 Bacteria 2553
42 Ga0070664_100134211 3300005564 Bacteria 2175
43 Ga0070664_100438485 3300005564 Bacteria 1198
44 Ga0070664_100598286 3300005564 Bacteria 1022
45 Ga0068857_100105491 3300005577 Bacteria 2530
46 Ga0068857_101246916 3300005577 Bacteria 721
47 Ga0068854_100177813 3300005578 Unclassified 1660
48 Ga0068854_100382810 3300005578 Bacteria 1160
49 Ga0068854_101333687 3300005578 Bacteria 647
50 Ga0068856_100008612 3300005614 Bacteria 9919
51 Ga0068856_100094998 3300005614 Bacteria 2968
52 Ga0068856_100111401 3300005614 Bacteria 2734
53 Ga0068852_100116683 3300005616 Bacteria 2436
54 Ga0068852_100364781 3300005616 Bacteria 1414
55 Ga0068852_100424623 3300005616 Bacteria 1312
56 Ga0068852_100567585 3300005616 Bacteria 1136
57 Ga0068866_10054927 3300005718 Unclassified 2043
58 Ga0068858_100012357 3300005842 Bacteria 8051
59 Ga0068860_100008414 3300005843 Bacteria 10275
60 Ga0081455_10031343 3300005937 Bacteria 4812
61 Ga0105244_10097686 3300009036 Bacteria 1439
62 Ga0105240_10061599 3300009093 Bacteria 4676
63 Ga0105240_10859327 3300009093 Bacteria 979
64 Ga0105240_11603767 3300009093 Bacteria 681
65 Ga0105245_11272568 3300009098 Bacteria 784
66 Ga0105243_10057916 3300009148 Bacteria 3087
67 Ga0105241_10005862 3300009174 Bacteria 9073
68 Ga0105241_10024681 3300009174 Bacteria 4465
69 Ga0105241_10055742 3300009174 Bacteria 3029
70 Ga0105241_10354610 3300009174 Bacteria 1275
71 Ga0105241_10817478 3300009174 Bacteria 860
72 Ga0105241_11329714 3300009174 Bacteria 685
73 Ga0105242_10046623 3300009176 Bacteria 3516
74 Ga0105242_10152570 3300009176 Bacteria 2016
75 Ga0105242_10303209 3300009176 Bacteria 1459
76 Ga0105248_12461459 3300009177 Bacteria 593
77 Ga0105237_10020762 3300009545 Bacteria 6765
78 Ga0105237_10093020 3300009545 Bacteria 3005
79 Ga0105237_10107683 3300009545 Bacteria 2779
80 Ga0105237_10407862 3300009545 Bacteria 1364
81 Ga0105238_10002078 3300009551 Bacteria 20242
82 Ga0105238_10013885 3300009551 Bacteria 8145
83 Ga0105238_10100351 3300009551 Bacteria 2878
84 Ga0105249_10262067 3300009553 Unclassified 1718
85 Ga0105239_10006515 3300010375 Bacteria 13535
86 Ga0105239_10008100 3300010375 Bacteria 11995
87 Ga0105239_11136019 3300010375 Bacteria 900
88 Ga0105246_10027333 3300011119 Bacteria 3737
89 Ga0157373_10481371 3300013100 Bacteria 895
90 Ga0157371_10634925 3300013102 Bacteria 796
91 Ga0157370_10044733 3300013104 Bacteria 4252
92 Ga0157370_10082113 3300013104 Bacteria 3032
93 Ga0157369_10000537 3300013105 Bacteria 50143
94 Ga0157369_10018793 3300013105 Bacteria 7746
95 Ga0157369_10123354 3300013105 Bacteria 2748
96 Ga0157378_11614290 3300013297 Bacteria 694
97 Ga0163162_11082024 3300013306 Bacteria 908
98 Ga0157372_10000822 3300013307 Bacteria 33604
99 Ga0157372_10121189 3300013307 Bacteria 3004
100 Ga0157372_10191597 3300013307 Bacteria 2368
101 Ga0157372_10219001 3300013307 Bacteria 2206
102 Ga0157372_10252853 3300013307 Bacteria 2046
103 Ga0157372_10263465 3300013307 Bacteria 2002
104 Ga0157372_10858474 3300013307 Bacteria 1054
105 Ga0157372_10949977 3300013307 Bacteria 996
106 Ga0157372_12090398 3300013307 Bacteria 651
107 Ga0163163_10000166 3300014325 Bacteria 69030
108 Ga0163163_10286755 3300014325 Bacteria 1698
109 Ga0163163_12021383 3300014325 Bacteria 636
110 Ga0182008_10112871 3300014497 Bacteria 1347
111 Ga0182008_10149716 3300014497 Bacteria 1170
112 Ga0157377_10407272 3300014745 Bacteria 928
113 Ga0157379_10136307 3300014968 Bacteria 2212
114 Ga0182006_1048586 3300015261 Bacteria 1640
115 Ga0182007_10183198 3300015262 Bacteria 725
116 Ga0206353_10012008 3300020082 Bacteria 1547
117 Ga0209148_1000228 3300025254 Bacteria 92271
118 Ga0207682_10418126 3300025893 Bacteria 634
119 Ga0207680_10001568 3300025903 Bacteria 10784
120 Ga0207647_10004955 3300025904 Bacteria 9814
121 Ga0207699_10365376 3300025906 Unclassified 1021
122 Ga0207705_10043771 3300025909 Bacteria 3216
123 Ga0207705_10341278 3300025909 Bacteria 1153
124 Ga0207705_10345475 3300025909 Unclassified 1146
125 Ga0207705_11362993 3300025909 Bacteria 540
126 Ga0207654_10000768 3300025911 Bacteria 17657
127 Ga0207654_10001681 3300025911 Bacteria 11564
128 Ga0207654_10130136 3300025911 Unclassified 1592
129 Ga0207654_10352441 3300025911 Unclassified 1014
130 Ga0207654_10398278 3300025911 Bacteria 957
131 Ga0207654_11245468 3300025911 Bacteria 542
132 Ga0207695_10000271 3300025913 Bacteria 129900
133 Ga0207695_10004927 3300025913 Bacteria 17992
134 Ga0207671_10003371 3300025914 Bacteria 16001
135 Ga0207671_10005095 3300025914 Bacteria 12259
136 Ga0207671_10018216 3300025914 Bacteria 5395
137 Ga0207671_10388169 3300025914 Bacteria 1110
138 Ga0207663_10464804 3300025916 Unclassified 978
139 Ga0207657_10006154 3300025919 Bacteria 12472
140 Ga0207657_10030064 3300025919 Bacteria 4935
141 Ga0207657_10735099 3300025919 Bacteria 765
142 Ga0207649_10005114 3300025920 Bacteria 7087
143 Ga0207649_10134027 3300025920 Bacteria 1687
144 Ga0207649_10382373 3300025920 Bacteria 1049
145 Ga0207652_10164880 3300025921 Bacteria 1987
146 Ga0207694_10002811 3300025924 Bacteria 14054
147 Ga0207694_10062182 3300025924 Bacteria 2907
148 Ga0207694_10235615 3300025924 Bacteria 1495
149 Ga0207694_10763832 3300025924 Bacteria 816
150 Ga0207650_10044375 3300025925 Bacteria 3267
151 Ga0207687_10349424 3300025927 Bacteria 1204
152 Ga0207690_10039586 3300025932 Bacteria 3076
153 Ga0207690_10157995 3300025932 Bacteria 1687
154 Ga0207706_10050478 3300025933 Bacteria 3676
155 Ga0207706_10372202 3300025933 Bacteria 1240
156 Ga0207686_10021392 3300025934 Bacteria 3712
157 Ga0207686_10125203 3300025934 Bacteria 1755
158 Ga0207709_10010303 3300025935 Bacteria 5151
159 Ga0207691_10935531 3300025940 Bacteria 725
160 Ga0207691_10973910 3300025940 Bacteria 708
161 Ga0207689_10224860 3300025942 Bacteria 1551
162 Ga0207679_10100827 3300025945 Bacteria 2257
163 Ga0207667_10012508 3300025949 Bacteria 9771
164 Ga0207667_10092366 3300025949 Bacteria 3126
165 Ga0207667_10458525 3300025949 Bacteria 1295
166 Ga0207667_10698075 3300025949 Bacteria 1017
167 Ga0207712_10173949 3300025961 Unclassified 1685
168 Ga0207640_10056312 3300025981 Bacteria 2580
169 Ga0207640_10099726 3300025981 Unclassified 2033
170 Ga0207640_10771158 3300025981 Unclassified 831
171 Ga0207640_11110479 3300025981 Bacteria 700
172 Ga0207658_10158024 3300025986 Bacteria 1855
173 Ga0207677_10066019 3300026023 Bacteria 2528
174 Ga0207703_10033276 3300026035 Bacteria 4085
175 Ga0207639_10003555 3300026041 Bacteria 10469
176 Ga0207639_10006491 3300026041 Bacteria 7953
177 Ga0207639_10010946 3300026041 Bacteria 6291
178 Ga0207639_10061478 3300026041 Bacteria 2901
179 Ga0207639_10198899 3300026041 Bacteria 1717
180 Ga0207639_10271686 3300026041 Bacteria 1487
181 Ga0207639_10440179 3300026041 Bacteria 1182
182 Ga0207678_10007414 3300026067 Bacteria 9716
183 Ga0207678_10827221 3300026067 Bacteria 818
184 Ga0207702_10016709 3300026078 Bacteria 6074
185 Ga0207702_10275579 3300026078 Bacteria 1588
186 Ga0207648_10815686 3300026089 Bacteria 869
187 Ga0207674_10007508 3300026116 Bacteria 12715
188 Ga0207674_10013156 3300026116 Bacteria 9209
189 Ga0207674_10035024 3300026116 Bacteria 5241
190 Ga0207683_10646689 3300026121 Bacteria 979
191 Ga0207698_10063699 3300026142 Bacteria 2887
192 Ga0207698_10953859 3300026142 Bacteria 867
193 Ga0207698_11920552 3300026142 Bacteria 607
194 Ga0268264_10019569 3300028381 Bacteria 5530
195 Ga0307508_10381090 3300031616 Bacteria 1001
196 Ga0307514_10356528 3300031649 Bacteria 776
197 Ga0307516_10051539 3300031730 Bacteria 4033
198 Ga0307413_10253858 3300031824 Unclassified 1306
199 Ga0307413_11692851 3300031824 Unclassified 564
200 Ga0307410_10228109 3300031852 Bacteria 1436
201 Ga0307410_10302514 3300031852 Bacteria 1262
202 Ga0307412_10600662 3300031911 Bacteria 932
203 Ga0307412_10724601 3300031911 Bacteria 856
204 Ga0307409_100410848 3300031995 Bacteria 1296
205 Ga0307409_100972407 3300031995 Bacteria 866
206 Ga0307409_101211898 3300031995 Bacteria 778
207 Ga0307414_10000550 3300032004 Bacteria 19583
208 Ga0307411_10013817 3300032005 Bacteria 4472
209 Ga0307411_10016761 3300032005 Bacteria 4154
210 Ga0373925_1272450 3300037068 Bacteria 604
211 Ga0395899_0003921 3300037312 Bacteria 11732
212 Ga0395899_0006509 3300037312 Bacteria 9050
213 Ga0395899_0037027 3300037312 Bacteria 3658
214 Ga0395899_0074422 3300037312 Bacteria 2481
215 Ga0395899_0074909 3300037312 Bacteria 2472
216 Ga0395899_0131495 3300037312 Bacteria 1786
217 Ga0395899_0524113 3300037312 Bacteria 765
218 Ga0395900_0000281 3300037418 Bacteria 76565
219 Ga0395900_0005345 3300037418 Bacteria 13457
220 Ga0395900_0017032 3300037418 Bacteria 7418
221 Ga0395900_0020631 3300037418 Bacteria 6732
222 Ga0395900_0065301 3300037418 Bacteria 3738
223 Ga0395900_0144886 3300037418 Bacteria 2429
224 Ga0395900_0215561 3300037418 Bacteria 1937
225 Ga0395900_0388865 3300037418 Bacteria 1361
226 Ga0395900_0477285 3300037418 Bacteria 1200
227 Ga0395900_0938020 3300037418 Bacteria 787
228 Ga0395900_0943402 3300037418 Bacteria 784
229 Ga0395898_0015043 3300037466 Bacteria 7942
230 Ga0395898_0046046 3300037466 Bacteria 4285
231 Ga0395898_0152522 3300037466 Bacteria 2210
232 Ga0395898_1120150 3300037466 Bacteria 720
233 Ga0395905_0009481 3300037471 Bacteria 9512
234 Ga0395905_0039579 3300037471 Bacteria 4423
235 Ga0395905_0076650 3300037471 Bacteria 3133
236 Ga0395905_0090619 3300037471 Bacteria 2867
237 Ga0395905_0143648 3300037471 Bacteria 2245
238 Ga0395905_0284142 3300037471 Bacteria 1541
239 Ga0395905_0979715 3300037471 Bacteria 748
240 Ga0395901_0000066 3300038443 Bacteria 146266
241 Ga0395901_0036959 3300038443 Bacteria 5049
242 Ga0395901_0046365 3300038443 Bacteria 4514
243 Ga0395901_0066817 3300038443 Bacteria 3744
244 Ga0395901_0085892 3300038443 Bacteria 3290
245 Ga0395901_0170104 3300038443 Bacteria 2286
246 Ga0395901_0690011 3300038443 Bacteria 1020
247 Ga0395901_1149725 3300038443 Bacteria 744
248 Ga0436365_0314322 3300039437 Unclassified 897
249 Ga0451807_2255487 3300041486 Bacteria 1541
250 Ga0451837_0366839 3300041494 Bacteria 2738
251 Ga0451845_0927954 3300041501 Unclassified 973
252 Ga0451843_0717656 3300041509 Bacteria 1772
253 Ga0439448_0000035 3300042005 Bacteria 22070
254 Ga0439448_0001585 3300042005 Bacteria 5962
255 Ga0439448_0014282 3300042005 Bacteria 2394
256 Ga0439449_0026201 3300042007 Bacteria 2176
257 Ga0439449_0145343 3300042007 Bacteria 884
258 Ga0439450_044216 3300042008 Bacteria 1042
259 Ga0439454_027621 3300042011 Bacteria 873
260 Ga0439455_0020312 3300042012 Bacteria 1574
261 Ga0450897_012670 3300042128 Bacteria 834
262 Ga0450906_089110 3300042145 Bacteria 559
263 Ga0450893_0010053 3300042532 Bacteria 1551
264 Ga0466969_0013623 3300044656 Bacteria 4281
265 Ga0466969_0452250 3300044656 Bacteria 584
266 Ga0466972_0000857 3300044658 Bacteria 14598
267 Ga0466972_0267794 3300044658 Bacteria 798
268 Ga0466965_0003457 3300044683 Bacteria 6926
269 Ga0466965_0016153 3300044683 Bacteria 3548
270 Ga0466965_0057938 3300044683 Bacteria 1931
271 Ga0466965_0385142 3300044683 Bacteria 773
272 Ga0466966_0004567 3300044684 Bacteria 9119
273 Ga0466966_0010721 3300044684 Bacteria 6093
274 Ga0466966_0042794 3300044684 Bacteria 2905
275 Ga0466966_0065023 3300044684 Bacteria 2294
276 Ga0466966_0168759 3300044684 Bacteria 1330
277 Ga0466966_0539916 3300044684 Bacteria 701
278 Ga0466961_0130654 3300044693 Bacteria 1574
279 Ga0466961_0289584 3300044693 Bacteria 1001
280 Ga0466963_0639376 3300044694 Bacteria 751
281 Ga0466963_0941784 3300044694 Bacteria 608
282 Ga0466964_0000136 3300044706 Bacteria 19320
283 Ga0466964_0005241 3300044706 Bacteria 4807
284 Ga0466964_0006411 3300044706 Bacteria 4384
285 Ga0466964_0402583 3300044706 Bacteria 715
286 Ga0466968_0000240 3300044735 Bacteria 17166
287 Ga0466968_0182074 3300044735 Bacteria 977
288 Ga0466970_0038961 3300044765 Bacteria 2522
289 Ga0466970_0045096 3300044765 Bacteria 2347
290 Ga0466970_0085796 3300044765 Bacteria 1706
291 Ga0466970_0348550 3300044765 Bacteria 840
292 Ga0466957_0000601 3300044842 Bacteria 18289
293 Ga0466957_0010985 3300044842 Bacteria 5208
294 Ga0466957_0027041 3300044842 Bacteria 3407
295 Ga0466957_0103396 3300044842 Bacteria 1798
296 Ga0466957_0346870 3300044842 Bacteria 1006
297 Ga0466960_0028223 3300044901 Bacteria 2567
298 Ga0466960_0853530 3300044901 Bacteria 553
299 Ga0466959_0028061 3300045049 Bacteria 4174
300 Ga0466959_0071893 3300045049 Bacteria 2504
301 Ga0466959_0090437 3300045049 Bacteria 2198
302 Ga0466959_0101674 3300045049 Bacteria 2057
303 Ga0466959_0287357 3300045049 Bacteria 1128
304 Ga0451576_0185585 3300045051 Bacteria 2172
305 Ga0466958_0077662 3300045836 Bacteria 2039
306 Ga0466958_0125013 3300045836 Bacteria 1612
307 Ga0466958_0358359 3300045836 Bacteria 939
308 Ga0466967_0002277 3300045976 Bacteria 11844
309 Ga0466967_0062002 3300045976 Bacteria 3318
310 Ga0466967_0136715 3300045976 Bacteria 2279
311 Ga0466967_0905931 3300045976 Bacteria 877
312 Ga0495617_052458 3300046452 Bacteria 1355
313 Ga0495627_007110 3300046453 Bacteria 4330
314 Ga0495627_020880 3300046453 Bacteria 2176
315 Ga0495603_0100601 3300046455 Bacteria 1687
316 Ga0495590_0000009 3300046457 Bacteria 320425
317 Ga0495590_0012975 3300046457 Bacteria 3074
318 Ga0495590_0099445 3300046457 Bacteria 1033
319 Ga0495591_000408 3300046458 Bacteria 35919
320 Ga0495591_017014 3300046458 Bacteria 2510
321 Ga0495629_0020934 3300046459 Bacteria 4667
322 Ga0495629_0149211 3300046459 Bacteria 1625
323 Ga0495638_0060691 3300046460 Bacteria 2338
324 Ga0495638_0281049 3300046460 Bacteria 904
325 Ga0495638_0427046 3300046460 Bacteria 682
326 Ga0495653_0263010 3300046463 Bacteria 1139
327 Ga0495650_0000383 3300046471 Bacteria 75998
328 Ga0495580_0444061 3300046472 Bacteria 871
329 Ga0495582_0012904 3300046473 Bacteria 4603
330 Ga0495605_0000099 3300046474 Bacteria 109668
331 Ga0495605_0001634 3300046474 Bacteria 14486
332 Ga0495605_0016563 3300046474 Bacteria 3988
333 Ga0495605_0020319 3300046474 Bacteria 3530
334 Ga0495605_0025802 3300046474 Bacteria 3059
335 Ga0495605_0105255 3300046474 Bacteria 1292
336 Ga0495584_0000200 3300046491 Bacteria 42723
337 Ga0495584_0000685 3300046491 Bacteria 22508
338 Ga0495584_0004558 3300046491 Bacteria 7431
339 Ga0495584_0006320 3300046491 Bacteria 6209
340 Ga0495584_0012796 3300046491 Bacteria 4282
341 Ga0495584_0048029 3300046491 Bacteria 2152
342 Ga0495584_0127429 3300046491 Bacteria 1290
343 Ga0495585_0000053 3300046492 Bacteria 115559
344 Ga0495585_0000401 3300046492 Bacteria 41899
345 Ga0495585_0006473 3300046492 Bacteria 7260
346 Ga0495585_0015748 3300046492 Bacteria 4391
347 Ga0495585_0023981 3300046492 Bacteria 3499
348 Ga0495585_0055501 3300046492 Bacteria 2188
349 Ga0495585_0059278 3300046492 Bacteria 2109
350 Ga0495585_0069651 3300046492 Bacteria 1919
351 Ga0495585_0106338 3300046492 Bacteria 1496
352 Ga0495585_0123561 3300046492 Bacteria 1367
353 Ga0495585_0166645 3300046492 Bacteria 1140
354 Ga0495585_0185168 3300046492 Bacteria 1068
355 Ga0495594_0016643 3300046499 Bacteria 3876
356 Ga0495596_0000097 3300046500 Bacteria 62327
357 Ga0495596_0001644 3300046500 Bacteria 12705
358 Ga0495596_0007668 3300046500 Bacteria 4853
359 Ga0495596_0010763 3300046500 Bacteria 3970
360 Ga0495596_0012689 3300046500 Bacteria 3597
361 Ga0495596_0022163 3300046500 Bacteria 2587
362 Ga0495596_0022881 3300046500 Bacteria 2540
363 Ga0495596_0054860 3300046500 Bacteria 1558
364 Ga0495596_0059890 3300046500 Bacteria 1483
365 Ga0495596_0078187 3300046500 Bacteria 1284
366 Ga0495596_0120981 3300046500 Bacteria 1016
367 Ga0495596_0125168 3300046500 Bacteria 997
368 Ga0495607_0000412 3300046501 Bacteria 43365
369 Ga0495607_0000440 3300046501 Bacteria 41872
370 Ga0495607_0000798 3300046501 Bacteria 29855
371 Ga0495607_0001423 3300046501 Bacteria 21330
372 Ga0495607_0001730 3300046501 Bacteria 18704
373 Ga0495607_0006708 3300046501 Bacteria 8060
374 Ga0495607_0034399 3300046501 Bacteria 3074
375 Ga0495607_0082021 3300046501 Bacteria 1770
376 Ga0495607_0097003 3300046501 Bacteria 1586
377 Ga0495607_0117976 3300046501 Bacteria 1397
378 Ga0495583_0000713 3300046506 Bacteria 42667
379 Ga0495583_0000723 3300046506 Bacteria 42219
380 Ga0495583_0000836 3300046506 Bacteria 37615
381 Ga0495583_0002049 3300046506 Bacteria 18286
382 Ga0495583_0004776 3300046506 Bacteria 9510
383 Ga0495583_0006461 3300046506 Bacteria 7663
384 Ga0495583_0051366 3300046506 Bacteria 1880
385 Ga0495583_0114885 3300046506 Bacteria 1138
386 Ga0495583_0228060 3300046506 Bacteria 751
387 Ga0495606_0010360 3300046507 Bacteria 7746
388 Ga0495606_0010533 3300046507 Bacteria 7658
389 Ga0495606_0027945 3300046507 Bacteria 3988
390 Ga0495606_0037124 3300046507 Bacteria 3310
391 Ga0495606_0056783 3300046507 Bacteria 2525
392 Ga0495606_0246343 3300046507 Bacteria 994
393 Ga0495606_0366003 3300046507 Bacteria 761
394 Ga0495610_0000685 3300046512 Bacteria 32698
395 Ga0495610_0205980 3300046512 Bacteria 802
396 Ga0495616_0000033 3300046513 Bacteria 130486
397 Ga0495616_0003653 3300046513 Bacteria 9828
398 Ga0495616_0008169 3300046513 Bacteria 6219
399 Ga0495616_0010678 3300046513 Bacteria 5304
400 Ga0495616_0014419 3300046513 Bacteria 4423
401 Ga0495616_0016468 3300046513 Bacteria 4091
402 Ga0495616_0022346 3300046513 Bacteria 3416
403 Ga0495616_0024676 3300046513 Bacteria 3222
404 Ga0495616_0032989 3300046513 Bacteria 2701
405 Ga0495616_0048354 3300046513 Bacteria 2138
406 Ga0495616_0051836 3300046513 Bacteria 2044
407 Ga0495616_0201150 3300046513 Bacteria 875
408 Ga0495616_0260920 3300046513 Bacteria 741
409 Ga0495631_0000823 3300046518 Bacteria 19829
410 Ga0495631_0002023 3300046518 Bacteria 11802
411 Ga0495631_0002536 3300046518 Bacteria 10260
412 Ga0495631_0010021 3300046518 Bacteria 4707
413 Ga0495631_0013485 3300046518 Bacteria 3966
414 Ga0495631_0017998 3300046518 Bacteria 3333
415 Ga0495631_0027268 3300046518 Bacteria 2615
416 Ga0495631_0047151 3300046518 Bacteria 1892
417 Ga0495631_0134161 3300046518 Bacteria 1063
418 Ga0495631_0217666 3300046518 Bacteria 815
419 Ga0495632_0000017 3300046519 Bacteria 228941
420 Ga0495632_0001065 3300046519 Bacteria 23521
421 Ga0495632_0001389 3300046519 Bacteria 20297
422 Ga0495632_0006033 3300046519 Bacteria 7870
423 Ga0495632_0025614 3300046519 Bacteria 3117
424 Ga0495632_0038249 3300046519 Bacteria 2430
425 Ga0495632_0092693 3300046519 Bacteria 1430
426 Ga0495637_0000003 3300046520 Bacteria 623293
427 Ga0495637_0124910 3300046520 Bacteria 987
428 Ga0495643_0000426 3300046522 Bacteria 54838
429 Ga0495643_0002094 3300046522 Bacteria 16515
430 Ga0495643_0006209 3300046522 Bacteria 7927
431 Ga0495643_0041795 3300046522 Bacteria 2499
432 Ga0495643_0119813 3300046522 Bacteria 1330
433 Ga0495644_0000913 3300046523 Bacteria 12240
434 Ga0495644_0012848 3300046523 Bacteria 3220
435 Ga0495644_0019663 3300046523 Bacteria 2578
436 Ga0495644_0032923 3300046523 Bacteria 1959
437 Ga0495644_0033515 3300046523 Bacteria 1940
438 Ga0495644_0036714 3300046523 Bacteria 1848
439 Ga0495648_0000829 3300046524 Bacteria 32659
440 Ga0495648_0001630 3300046524 Bacteria 21773
441 Ga0495648_0009222 3300046524 Bacteria 7679
442 Ga0495648_0030282 3300046524 Bacteria 3580
443 Ga0495648_0170840 3300046524 Bacteria 1114
444 Ga0495648_0361606 3300046524 Bacteria 660
445 Ga0495663_0055858 3300046525 Bacteria 1232
446 Ga0495666_0001317 3300046526 Bacteria 12002
447 Ga0495642_0000608 3300046528 Bacteria 18024
448 Ga0495642_0002207 3300046528 Bacteria 7979
449 Ga0495642_0003761 3300046528 Bacteria 5938
450 Ga0495642_0005474 3300046528 Bacteria 4876
451 Ga0495642_0019961 3300046528 Bacteria 2628
452 Ga0495642_0029655 3300046528 Bacteria 2185
453 Ga0495642_0038582 3300046528 Bacteria 1935
454 Ga0495642_0040895 3300046528 Bacteria 1884
455 Ga0495642_0054291 3300046528 Bacteria 1652
456 Ga0495642_0060921 3300046528 Bacteria 1566
457 Ga0495642_0115852 3300046528 Bacteria 1148
458 Ga0495642_0125411 3300046528 Bacteria 1103
459 Ga0495642_0180182 3300046528 Bacteria 919
460 Ga0495642_0373697 3300046528 Bacteria 627
461 Ga0495654_0002973 3300046530 Bacteria 10609
462 Ga0495654_0073099 3300046530 Bacteria 1622
463 Ga0495665_0014830 3300046531 Bacteria 4198
464 Ga0495640_0072968 3300046533 Bacteria 2298
465 Ga0495586_0004569 3300046535 Bacteria 7399
466 Ga0495586_0269081 3300046535 Bacteria 974
467 Ga0495609_0000086 3300046538 Bacteria 110840
468 Ga0495609_0000423 3300046538 Bacteria 35296
469 Ga0495609_0004268 3300046538 Bacteria 7887
470 Ga0495609_0010278 3300046538 Bacteria 4495
471 Ga0495609_0016472 3300046538 Bacteria 3444
472 Ga0495609_0043513 3300046538 Bacteria 2016
473 Ga0495609_0056867 3300046538 Bacteria 1732
474 Ga0495609_0075141 3300046538 Bacteria 1481
475 Ga0495597_0000483 3300046542 Bacteria 33315
476 Ga0495597_0000709 3300046542 Bacteria 26719
477 Ga0495597_0002261 3300046542 Bacteria 12534
478 Ga0495597_0002669 3300046542 Bacteria 11036
479 Ga0495597_0023126 3300046542 Bacteria 2877
480 Ga0495597_0035877 3300046542 Bacteria 2235
481 Ga0495597_0045624 3300046542 Bacteria 1944
482 Ga0495597_0094504 3300046542 Bacteria 1266
483 Ga0495597_0158786 3300046542 Bacteria 924
484 Ga0495633_0001443 3300046558 Bacteria 18479
485 Ga0495633_0003300 3300046558 Bacteria 10843
486 Ga0495633_0028578 3300046558 Bacteria 2716
487 Ga0495633_0075677 3300046558 Bacteria 1567
488 Ga0495656_0110166 3300046615 Bacteria 1286
489 Ga0495656_0180525 3300046615 Bacteria 1037
490 Ga0495668_0001132 3300046616 Bacteria 27353
491 Ga0495668_0006814 3300046616 Bacteria 7417
492 Ga0495668_0012433 3300046616 Bacteria 5047
493 Ga0495668_0019025 3300046616 Bacteria 3964
494 Ga0495668_0037566 3300046616 Bacteria 2709
495 Ga0495668_0050247 3300046616 Bacteria 2311
496 Ga0495668_0057701 3300046616 Bacteria 2142
497 Ga0495668_0096748 3300046616 Bacteria 1615
498 Ga0495668_0115448 3300046616 Bacteria 1468
499 Ga0495668_0203263 3300046616 Bacteria 1084
500 Ga0495668_0258459 3300046616 Bacteria 953
501 Ga0495634_0577173 3300046642 Bacteria 654
502 Ga0495611_0000492 3300046648 Bacteria 23599
503 Ga0495611_0003110 3300046648 Bacteria 7366
504 Ga0495611_0007491 3300046648 Bacteria 4631
505 Ga0495611_0052517 3300046648 Bacteria 1839
506 Ga0495611_0137980 3300046648 Bacteria 1138
507 Ga0495611_0254537 3300046648 Bacteria 813
508 Ga0495625_0017173 3300046660 Bacteria 5668
509 Ga0495625_0037001 3300046660 Bacteria 3583
510 Ga0495625_0171216 3300046660 Bacteria 1450
511 Ga0495625_0174317 3300046660 Bacteria 1434
512 Ga0495625_0843475 3300046660 Bacteria 529
513 Ga0495635_0009755 3300046663 Bacteria 6710
514 Ga0495661_0000457 3300046665 Bacteria 43317
515 Ga0495661_0000724 3300046665 Bacteria 32411
516 Ga0495661_0001752 3300046665 Bacteria 17450
517 Ga0495661_0002435 3300046665 Bacteria 14332
518 Ga0495661_0009820 3300046665 Bacteria 6546
519 Ga0495661_0013860 3300046665 Bacteria 5408
520 Ga0495661_0016657 3300046665 Bacteria 4865
521 Ga0495661_0041554 3300046665 Bacteria 2843
522 Ga0495661_0045935 3300046665 Bacteria 2668
523 Ga0495661_0051040 3300046665 Bacteria 2499
524 Ga0495661_0055611 3300046665 Bacteria 2371
525 Ga0495661_0057949 3300046665 Bacteria 2310
526 Ga0495661_0081300 3300046665 Bacteria 1867
527 Ga0495661_0095089 3300046665 Bacteria 1688
528 Ga0495661_0096335 3300046665 Bacteria 1673
529 Ga0495661_0134312 3300046665 Bacteria 1352
530 Ga0495661_0135979 3300046665 Bacteria 1341
531 Ga0495661_0455198 3300046665 Bacteria 615
532 Ga0495588_0000094 3300046674 Bacteria 176169
533 Ga0495588_0003039 3300046674 Bacteria 7258
534 Ga0495623_0302883 3300046679 Bacteria 883
535 Ga0495646_0126666 3300046680 Bacteria 1441
536 Ga0495669_0000015 3300046684 Bacteria 140309
537 Ga0495669_0007810 3300046684 Bacteria 4489
538 Ga0495669_0040390 3300046684 Bacteria 2069
539 Ga0495669_0053258 3300046684 Bacteria 1819
540 Ga0495669_0062257 3300046684 Bacteria 1690
541 Ga0495669_0093551 3300046684 Bacteria 1390
542 Ga0495669_0286884 3300046684 Bacteria 792
543 Ga0495613_0366204 3300046689 Bacteria 987
544 Ga0495670_0000086 3300046691 Bacteria 41361
545 Ga0495670_0000119 3300046691 Bacteria 34590
546 Ga0495670_0009933 3300046691 Bacteria 4678
547 Ga0495670_0028223 3300046691 Bacteria 2782
548 Ga0495670_0029410 3300046691 Bacteria 2726
549 Ga0495670_0059321 3300046691 Bacteria 1921
550 Ga0495671_0006226 3300046692 Bacteria 6916
551 Ga0495671_0144775 3300046692 Bacteria 1157
552 Ga0495671_0191063 3300046692 Bacteria 994
553 Ga0495671_0296853 3300046692 Bacteria 777
554 Ga0495649_0000678 3300046694 Bacteria 27709
555 Ga0495649_0014817 3300046694 Bacteria 4454
556 Ga0495649_0020731 3300046694 Bacteria 3684
557 Ga0495649_0071546 3300046694 Bacteria 1859
558 Ga0495649_0103157 3300046694 Bacteria 1514
559 Ga0495649_0109766 3300046694 Bacteria 1463
560 Ga0495649_0140146 3300046694 Bacteria 1273
561 Ga0495649_0435790 3300046694 Bacteria 655
562 Ga0495589_0000055 3300046794 Bacteria 110887
563 Ga0495589_0000069 3300046794 Bacteria 97385
564 Ga0495589_0000584 3300046794 Bacteria 25027
565 Ga0495589_0004549 3300046794 Bacteria 7367
566 Ga0495589_0006587 3300046794 Bacteria 6121
567 Ga0495589_0013813 3300046794 Bacteria 4165
568 Ga0495589_0017969 3300046794 Bacteria 3627
569 Ga0495589_0041204 3300046794 Bacteria 2304
570 Ga0495589_0079152 3300046794 Bacteria 1599
571 Ga0495660_0000059 3300046810 Bacteria 132883
572 Ga0495660_0007831 3300046810 Bacteria 6273
573 Ga0495660_0021216 3300046810 Bacteria 3720
574 Ga0495660_0021260 3300046810 Bacteria 3716
575 Ga0495660_0022744 3300046810 Bacteria 3577
576 Ga0495660_0025631 3300046810 Bacteria 3347
577 Ga0495660_0043132 3300046810 Bacteria 2489
578 Ga0495660_0262681 3300046810 Bacteria 796
579 Ga0495581_0006526 3300047315 Bacteria 6765
580 Ga0495604_0003551 3300047317 Bacteria 12444
581 Ga0495604_0058000 3300047317 Bacteria 2974
582 Ga0495636_0006895 3300047318 Bacteria 4467
583 Ga0495636_0009776 3300047318 Bacteria 3777
584 Ga0495636_0121846 3300047318 Bacteria 1154
585 Ga0495672_0000108 3300047320 Bacteria 132251
586 Ga0495672_0000257 3300047320 Bacteria 74176
587 Ga0495672_0000338 3300047320 Bacteria 60333
588 Ga0495672_0001037 3300047320 Bacteria 28565
589 Ga0495672_0020359 3300047320 Bacteria 4350
590 Ga0495672_0091189 3300047320 Bacteria 1673
591 Ga0495672_0273566 3300047320 Bacteria 810
592 Ga0495676_0000054 3300047321 Bacteria 93905
593 Ga0495676_0011260 3300047321 Bacteria 8084
594 Ga0495676_0102424 3300047321 Bacteria 2115
595 Ga0495680_0010490 3300047322 Bacteria 8267
596 Ga0495683_0000178 3300047323 Bacteria 62322
597 Ga0495683_0001790 3300047323 Bacteria 13552
598 Ga0495683_0007333 3300047323 Bacteria 5977
599 Ga0495683_0028240 3300047323 Bacteria 2868
600 Ga0495683_0046347 3300047323 Bacteria 2181
601 Ga0495683_0057213 3300047323 Bacteria 1938
602 Ga0495683_0064190 3300047323 Bacteria 1813
603 Ga0495683_0139245 3300047323 Bacteria 1138
604 Ga0495683_0176403 3300047323 Bacteria 979
605 Ga0495683_0325370 3300047323 Bacteria 654
606 Ga0495687_000110 3300047443 Bacteria 125363
607 Ga0495687_000139 3300047443 Bacteria 110721
608 Ga0495687_000355 3300047443 Bacteria 58149
609 Ga0495687_001210 3300047443 Bacteria 24710
610 Ga0495687_001518 3300047443 Bacteria 21170
611 Ga0495687_170006 3300047443 Unclassified 723
612 Ga0495675_0001460 3300047444 Bacteria 14305
613 Ga0495677_0000122 3300047445 Bacteria 37378
614 Ga0495677_0000147 3300047445 Bacteria 33620
615 Ga0495677_0000239 3300047445 Bacteria 24560
616 Ga0495677_0001224 3300047445 Bacteria 10285
617 Ga0495677_0003756 3300047445 Bacteria 5869
618 Ga0495677_0004591 3300047445 Bacteria 5273
619 Ga0495677_0015192 3300047445 Bacteria 2798
620 Ga0495677_0022063 3300047445 Bacteria 2307
621 Ga0495677_0024355 3300047445 Bacteria 2195
622 Ga0495677_0048424 3300047445 Bacteria 1561
623 Ga0495679_002570 3300047446 Bacteria 9152
624 Ga0495679_038322 3300047446 Bacteria 1501
625 Ga0495679_058888 3300047446 Bacteria 1132
626 Ga0495679_078206 3300047446 Bacteria 943
627 Ga0495679_144605 3300047446 Bacteria 640
628 Ga0495685_002935 3300047447 Bacteria 5394
629 Ga0495685_029642 3300047447 Bacteria 1882
630 Ga0495685_071517 3300047447 Bacteria 1161
631 Ga0495681_0000914 3300047470 Bacteria 22790
632 Ga0495681_0001127 3300047470 Bacteria 20300
633 Ga0495681_0007209 3300047470 Bacteria 7147
634 Ga0495681_0008769 3300047470 Bacteria 6302
635 Ga0495681_0021644 3300047470 Bacteria 3459
636 Ga0495681_0089035 3300047470 Bacteria 1366
637 Ga0495681_0089074 3300047470 Bacteria 1365
638 Ga0495681_0107046 3300047470 Bacteria 1215
639 Ga0495686_0000148 3300047472 Bacteria 137236
640 Ga0495686_0008879 3300047472 Bacteria 7310
641 Ga0495593_0027077 3300047673 Bacteria 3158
642 Ga0495614_0004870 3300048089 Bacteria 6061
643 Ga0495614_0007946 3300048089 Bacteria 4714
644 Ga0495626_0000146 3300048091 Bacteria 88653
645 Ga0495626_0003692 3300048091 Bacteria 9697
646 Ga0495626_0003783 3300048091 Bacteria 9522
647 Ga0495626_0007823 3300048091 Bacteria 5921
648 Ga0495626_0011118 3300048091 Bacteria 4772
649 Ga0495626_0014827 3300048091 Bacteria 4006
650 Ga0495626_0015630 3300048091 Bacteria 3879
651 Ga0495626_0017280 3300048091 Bacteria 3647
652 Ga0495626_0025166 3300048091 Bacteria 2912
653 Ga0495626_0028607 3300048091 Bacteria 2700
654 Ga0495626_0039730 3300048091 Bacteria 2225
655 Ga0495626_0058485 3300048091 Bacteria 1761
656 Ga0496101_0172107 3300048904 Bacteria 1665
657 Ga0496102_0494231 3300048905 Bacteria 1145
658 Ga0496104_0253191 3300048907 Bacteria 1674
659 Ga0496105_0419180 3300048908 Bacteria 1060
660 Ga0496105_0517567 3300048908 Bacteria 935
661 Ga0496106_0046464 3300048909 Bacteria 3264
662 Ga0496106_0580928 3300048909 Bacteria 898
663 Ga0496107_0064140 3300048910 Bacteria 2663
664 Ga0496107_0788124 3300048910 Bacteria 696
665 Ga0496108_0217400 3300048911 Bacteria 1660
666 Ga0496108_0354618 3300048911 Bacteria 1280
667 Ga0496108_0805571 3300048911 Bacteria 810
668 Ga0496110_0009597 3300048913 Bacteria 7831
669 Ga0496110_0584426 3300048913 Bacteria 1014
670 Ga0496111_0042238 3300048914 Bacteria 3273
671 Ga0496112_0062825 3300048915 Bacteria 3664
672 Ga0496112_0102293 3300048915 Bacteria 2835
673 Ga0496112_0349119 3300048915 Bacteria 1422
674 Ga0496113_0005132 3300048916 Bacteria 8140
675 Ga0496113_0012063 3300048916 Bacteria 5797
676 Ga0496122_0000483 3300048925 Bacteria 82763
677 Ga0496122_0008175 3300048925 Bacteria 11373
678 Ga0496122_0015218 3300048925 Bacteria 7362
679 Ga0496123_0000902 3300048926 Bacteria 46987
680 Ga0496123_0000970 3300048926 Bacteria 44328
681 Ga0496123_0008990 3300048926 Bacteria 9068
682 Ga0496123_0302318 3300048926 Bacteria 763
683 Ga0496124_0015304 3300048927 Bacteria 7362
684 Ga0496124_0019056 3300048927 Bacteria 6403
685 Ga0496124_0085939 3300048927 Bacteria 2576
686 Ga0496124_0109365 3300048927 Bacteria 2228
687 Ga0496124_0250054 3300048927 Bacteria 1312
688 Ga0496124_0266370 3300048927 Bacteria 1257
689 Ga0496124_0351174 3300048927 Bacteria 1043
690 Ga0496125_0002842 3300048928 Bacteria 21802
691 Ga0496125_0065889 3300048928 Bacteria 2866
692 Ga0495678_000117 3300049459 Bacteria 94597
693 Ga0495678_000342 3300049459 Bacteria 48420
694 Ga0495678_000526 3300049459 Bacteria 37355
695 Ga0495678_001545 3300049459 Bacteria 17787
696 Ga0495678_048355 3300049459 Bacteria 1659
697 Ga0495678_082837 3300049459 Bacteria 1147
698 Ga0495682_0000562 3300049460 Bacteria 25335
699 Ga0495682_0002811 3300049460 Bacteria 8029
700 Ga0495682_0003956 3300049460 Bacteria 6461
701 Ga0495682_0020573 3300049460 Bacteria 2476
702 Ga0495682_0055502 3300049460 Bacteria 1436
703 Ga0501034_0036737 3300049571 Bacteria 4961
704 Ga0501034_0408665 3300049571 Bacteria 1280
705 Ga0501036_0039335 3300049572 Bacteria 4002
706 Ga0501047_0760844 3300049581 Bacteria 784
707 Ga0501067_0751858 3300049583 Bacteria 549
708 Ga0501070_0517057 3300049586 Bacteria 958
709 Ga0501209_000102 3300049656 Bacteria 8705
710 Ga0501249_001780 3300049679 Bacteria 4393
711 Ga0501245_053784 3300049708 Bacteria 720
712 Ga0501080_0109548 3300049742 Bacteria 2560
713 Ga0501269_000003 3300049766 Bacteria 111299
714 Ga0501035_0000294 3300049822 Bacteria 59295
715 Ga0500621_168024 3300053126 Bacteria 807
716 Ga0500616_0009636 3300053153 Bacteria 5853
717 Ga0466962_0129428 3300061719 Bacteria 1219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042128 Ga0450897_012670 Ga0450897_012670_403_819 138
2 3300044694 Ga0466963_0941784 Ga0466963_0941784_177_593 138
3 3300047445 Ga0495677_0048424 Ga0495677_0048424_1135_1551 138
4 3300049586 Ga0501070_0517057 Ga0501070_0517057_21_443 138
5 3300039437 Ga0436365_0314322 Ga0436365_0314322_202_669 139
6 3300037312 Ga0395899_0006509 Ga0395899_0006509_1310_1777 142
7 3300037418 Ga0395900_0005345 Ga0395900_0005345_4121_4588 142
8 3300037466 Ga0395898_0046046 Ga0395898_0046046_1975_2442 142
9 3300046528 Ga0495642_0115852 Ga0495642_0115852_147_614 144
10 3300046615 Ga0495656_0110166 Ga0495656_0110166_275_742 144
11 3300047318 Ga0495636_0121846 Ga0495636_0121846_160_627 144
12 3300047443 Ga0495687_170006 Ga0495687_170006_215_679 145
13 3300048927 Ga0496124_0351174 Ga0496124_0351174_285_728 146
14 3300031995 Ga0307409_100410848 Ga0307409_1004108482 147
15 3300046528 Ga0495642_0038582 Ga0495642_0038582_1476_1925 149
16 iso_pu_bacteria 2808606418 2809146287 150
17 iso_pu_bacteria 2894414249 2894418054 150
18 iso_pu_bacteria 2919130084 2919131439 150
19 iso_pu_bacteria 2929195423 2929198139 150
20 iso_pu_bacteria 8047673197 8047674557 150
21 3300031824 Ga0307413_10253858 Ga0307413_102538581 152
22 3300031852 Ga0307410_10302514 Ga0307410_103025142 152
23 3300031911 Ga0307412_10600662 Ga0307412_106006622 152
24 3300032004 Ga0307414_10000550 Ga0307414_1000055018 152
25 3300032005 Ga0307411_10016761 Ga0307411_100167613 152
26 3300005614 Ga0068856_100008612 Ga0068856_1000086123 153
27 3300005937 Ga0081455_10031343 Ga0081455_100313432 153
28 3300009174 Ga0105241_11329714 Ga0105241_113297141 153
29 3300009545 Ga0105237_10107683 Ga0105237_101076832 153
30 3300013104 Ga0157370_10082113 Ga0157370_100821133 153
31 3300014497 Ga0182008_10149716 Ga0182008_101497162 153
32 3300025911 Ga0207654_11245468 Ga0207654_112454681 153
33 3300026078 Ga0207702_10016709 Ga0207702_100167092 153
34 3300031824 Ga0307413_11692851 Ga0307413_116928511 153
35 3300037471 Ga0395905_0090619 Ga0395905_0090619_760_1224 153
36 3300038443 Ga0395901_0085892 Ga0395901_0085892_2282_2746 153
37 3300046684 Ga0495669_0040390 Ga0495669_0040390_833_1300 153
38 3300049571 Ga0501034_0036737 Ga0501034_0036737_1620_2087 153
39 3300049656 Ga0501209_000102 Ga0501209_000102_7006_7467 153
40 3300003762 Ga0055542_1011038 Ga0055542_10110381 154
41 3300005262 Ga0065165_1000488 Ga0065165_100048850 154
42 3300005327 Ga0070658_10607424 Ga0070658_106074241 154
43 3300005328 Ga0070676_10532683 Ga0070676_105326832 154
44 3300005331 Ga0070670_100056427 Ga0070670_1000564273 154
45 3300005331 Ga0070670_101387567 Ga0070670_1013875672 154
46 3300005334 Ga0068869_100600397 Ga0068869_1006003972 154
47 3300005337 Ga0070682_100017388 Ga0070682_1000173881 154
48 3300005338 Ga0068868_100190194 Ga0068868_1001901942 154
49 3300005339 Ga0070660_100120090 Ga0070660_1001200902 154
50 3300005339 Ga0070660_100207178 Ga0070660_1002071782 154
51 3300005339 Ga0070660_100336855 Ga0070660_1003368552 154
52 3300005339 Ga0070660_100431034 Ga0070660_1004310342 154
53 3300005339 Ga0070660_100560847 Ga0070660_1005608471 154
54 3300005344 Ga0070661_100007934 Ga0070661_1000079342 154
55 3300005344 Ga0070661_100047321 Ga0070661_1000473214 154
56 3300005344 Ga0070661_100080308 Ga0070661_1000803083 154
57 3300005344 Ga0070661_100093381 Ga0070661_1000933812 154
58 3300005354 Ga0070675_100709641 Ga0070675_1007096412 154
59 3300005366 Ga0070659_100260942 Ga0070659_1002609422 154
60 3300005366 Ga0070659_100332645 Ga0070659_1003326452 154
61 3300005367 Ga0070667_100010185 Ga0070667_1000101855 154
62 3300005367 Ga0070667_100507166 Ga0070667_1005071662 154
63 3300005434 Ga0070709_10378838 Ga0070709_103788382 154
64 3300005439 Ga0070711_100189855 Ga0070711_1001898552 154
65 3300005455 Ga0070663_100034757 Ga0070663_1000347572 154
66 3300005457 Ga0070662_100150904 Ga0070662_1001509042 154
67 3300005457 Ga0070662_100386636 Ga0070662_1003866362 154
68 3300005457 Ga0070662_100817814 Ga0070662_1008178141 154
69 3300005530 Ga0070679_100221109 Ga0070679_1002211093 154
70 3300005530 Ga0070679_100412662 Ga0070679_1004126622 154
71 3300005539 Ga0068853_100041983 Ga0068853_1000419832 154
72 3300005539 Ga0068853_100089593 Ga0068853_1000895933 154
73 3300005539 Ga0068853_100187702 Ga0068853_1001877022 154
74 3300005539 Ga0068853_100410458 Ga0068853_1004104582 154
75 3300005543 Ga0070672_101261335 Ga0070672_1012613351 154
76 3300005563 Ga0068855_100016605 Ga0068855_1000166058 154
77 3300005563 Ga0068855_100032498 Ga0068855_1000324986 154
78 3300005563 Ga0068855_100052555 Ga0068855_1000525552 154
79 3300005563 Ga0068855_101936247 Ga0068855_1019362471 154
80 3300005564 Ga0070664_100097469 Ga0070664_1000974693 154
81 3300005564 Ga0070664_100134211 Ga0070664_1001342112 154
82 3300005564 Ga0070664_100438485 Ga0070664_1004384852 154
83 3300005564 Ga0070664_100598286 Ga0070664_1005982862 154
84 3300005577 Ga0068857_100105491 Ga0068857_1001054912 154
85 3300005577 Ga0068857_101246916 Ga0068857_1012469161 154
86 3300005578 Ga0068854_100177813 Ga0068854_1001778132 154
87 3300005578 Ga0068854_100382810 Ga0068854_1003828102 154
88 3300005578 Ga0068854_101333687 Ga0068854_1013336872 154
89 3300005614 Ga0068856_100094998 Ga0068856_1000949982 154
90 3300005614 Ga0068856_100111401 Ga0068856_1001114014 154
91 3300005616 Ga0068852_100116683 Ga0068852_1001166832 154
92 3300005616 Ga0068852_100364781 Ga0068852_1003647812 154
93 3300005616 Ga0068852_100424623 Ga0068852_1004246232 154
94 3300005616 Ga0068852_100567585 Ga0068852_1005675852 154
95 3300005718 Ga0068866_10054927 Ga0068866_100549271 154
96 3300005842 Ga0068858_100012357 Ga0068858_1000123578 154
97 3300005843 Ga0068860_100008414 Ga0068860_10000841410 154
98 3300009036 Ga0105244_10097686 Ga0105244_100976862 154
99 3300009093 Ga0105240_10061599 Ga0105240_100615996 154
100 3300009093 Ga0105240_10859327 Ga0105240_108593272 154
101 3300009093 Ga0105240_11603767 Ga0105240_116037672 154
102 3300009098 Ga0105245_11272568 Ga0105245_112725681 154
103 3300009148 Ga0105243_10057916 Ga0105243_100579162 154
104 3300009174 Ga0105241_10005862 Ga0105241_1000586212 154
105 3300009174 Ga0105241_10024681 Ga0105241_100246811 154
106 3300009174 Ga0105241_10055742 Ga0105241_100557422 154
107 3300009174 Ga0105241_10354610 Ga0105241_103546102 154
108 3300009174 Ga0105241_10817478 Ga0105241_108174781 154
109 3300009176 Ga0105242_10046623 Ga0105242_100466232 154
110 3300009176 Ga0105242_10152570 Ga0105242_101525702 154
111 3300009176 Ga0105242_10303209 Ga0105242_103032091 154
112 3300009177 Ga0105248_12461459 Ga0105248_124614591 154
113 3300009545 Ga0105237_10020762 Ga0105237_100207626 154
114 3300009545 Ga0105237_10093020 Ga0105237_100930202 154
115 3300009545 Ga0105237_10407862 Ga0105237_104078622 154
116 3300009551 Ga0105238_10002078 Ga0105238_1000207821 154
117 3300009551 Ga0105238_10013885 Ga0105238_100138852 154
118 3300009551 Ga0105238_10100351 Ga0105238_101003512 154
119 3300009553 Ga0105249_10262067 Ga0105249_102620672 154
120 3300010375 Ga0105239_10006515 Ga0105239_100065156 154
121 3300010375 Ga0105239_10008100 Ga0105239_100081002 154
122 3300010375 Ga0105239_11136019 Ga0105239_111360192 154
123 3300011119 Ga0105246_10027333 Ga0105246_100273334 154
124 3300013100 Ga0157373_10481371 Ga0157373_104813711 154
125 3300013102 Ga0157371_10634925 Ga0157371_106349252 154
126 3300013104 Ga0157370_10044733 Ga0157370_100447336 154
127 3300013105 Ga0157369_10000537 Ga0157369_1000053725 154
128 3300013105 Ga0157369_10018793 Ga0157369_100187937 154
129 3300013105 Ga0157369_10123354 Ga0157369_101233542 154
130 3300013297 Ga0157378_11614290 Ga0157378_116142901 154
131 3300013306 Ga0163162_11082024 Ga0163162_110820241 154
132 3300013307 Ga0157372_10000822 Ga0157372_1000082224 154
133 3300013307 Ga0157372_10121189 Ga0157372_101211893 154
134 3300013307 Ga0157372_10191597 Ga0157372_101915972 154
135 3300013307 Ga0157372_10219001 Ga0157372_102190012 154
136 3300013307 Ga0157372_10252853 Ga0157372_102528533 154
137 3300013307 Ga0157372_10263465 Ga0157372_102634652 154
138 3300013307 Ga0157372_10858474 Ga0157372_108584742 154
139 3300013307 Ga0157372_10949977 Ga0157372_109499771 154
140 3300013307 Ga0157372_12090398 Ga0157372_120903982 154
141 3300014325 Ga0163163_10000166 Ga0163163_1000016633 154
142 3300014325 Ga0163163_10286755 Ga0163163_102867553 154
143 3300014325 Ga0163163_12021383 Ga0163163_120213831 154
144 3300014497 Ga0182008_10112871 Ga0182008_101128712 154
145 3300014745 Ga0157377_10407272 Ga0157377_104072722 154
146 3300014968 Ga0157379_10136307 Ga0157379_101363072 154
147 3300015261 Ga0182006_1048586 Ga0182006_10485861 154
148 3300015262 Ga0182007_10183198 Ga0182007_101831982 154
149 3300020082 Ga0206353_10012008 Ga0206353_100120082 154
150 3300025254 Ga0209148_1000228 Ga0209148_100022841 154
151 3300025893 Ga0207682_10418126 Ga0207682_104181261 154
152 3300025903 Ga0207680_10001568 Ga0207680_100015684 154
153 3300025904 Ga0207647_10004955 Ga0207647_100049556 154
154 3300025906 Ga0207699_10365376 Ga0207699_103653762 154
155 3300025909 Ga0207705_10043771 Ga0207705_100437712 154
156 3300025909 Ga0207705_10341278 Ga0207705_103412782 154
157 3300025909 Ga0207705_10345475 Ga0207705_103454752 154
158 3300025909 Ga0207705_11362993 Ga0207705_113629931 154
159 3300025911 Ga0207654_10000768 Ga0207654_100007689 154
160 3300025911 Ga0207654_10001681 Ga0207654_100016812 154
161 3300025911 Ga0207654_10130136 Ga0207654_101301362 154
162 3300025911 Ga0207654_10352441 Ga0207654_103524412 154
163 3300025911 Ga0207654_10398278 Ga0207654_103982782 154
164 3300025913 Ga0207695_10000271 Ga0207695_10000271101 154
165 3300025913 Ga0207695_10004927 Ga0207695_1000492718 154
166 3300025914 Ga0207671_10003371 Ga0207671_100033719 154
167 3300025914 Ga0207671_10005095 Ga0207671_1000509512 154
168 3300025914 Ga0207671_10018216 Ga0207671_100182162 154
169 3300025914 Ga0207671_10388169 Ga0207671_103881691 154
170 3300025916 Ga0207663_10464804 Ga0207663_104648042 154
171 3300025919 Ga0207657_10006154 Ga0207657_100061549 154
172 3300025919 Ga0207657_10030064 Ga0207657_100300642 154
173 3300025919 Ga0207657_10735099 Ga0207657_107350991 154
174 3300025920 Ga0207649_10005114 Ga0207649_100051147 154
175 3300025920 Ga0207649_10134027 Ga0207649_101340272 154
176 3300025920 Ga0207649_10382373 Ga0207649_103823732 154
177 3300025921 Ga0207652_10164880 Ga0207652_101648802 154
178 3300025924 Ga0207694_10002811 Ga0207694_100028112 154
179 3300025924 Ga0207694_10062182 Ga0207694_100621824 154
180 3300025924 Ga0207694_10235615 Ga0207694_102356152 154
181 3300025924 Ga0207694_10763832 Ga0207694_107638322 154
182 3300025925 Ga0207650_10044375 Ga0207650_100443752 154
183 3300025927 Ga0207687_10349424 Ga0207687_103494241 154
184 3300025932 Ga0207690_10039586 Ga0207690_100395862 154
185 3300025932 Ga0207690_10157995 Ga0207690_101579952 154
186 3300025933 Ga0207706_10050478 Ga0207706_100504785 154
187 3300025933 Ga0207706_10372202 Ga0207706_103722021 154
188 3300025934 Ga0207686_10021392 Ga0207686_100213922 154
189 3300025934 Ga0207686_10125203 Ga0207686_101252032 154
190 3300025935 Ga0207709_10010303 Ga0207709_100103034 154
191 3300025940 Ga0207691_10935531 Ga0207691_109355312 154
192 3300025940 Ga0207691_10973910 Ga0207691_109739101 154
193 3300025942 Ga0207689_10224860 Ga0207689_102248602 154
194 3300025945 Ga0207679_10100827 Ga0207679_101008272 154
195 3300025949 Ga0207667_10012508 Ga0207667_100125082 154
196 3300025949 Ga0207667_10092366 Ga0207667_100923663 154
197 3300025949 Ga0207667_10458525 Ga0207667_104585252 154
198 3300025949 Ga0207667_10698075 Ga0207667_106980752 154
199 3300025961 Ga0207712_10173949 Ga0207712_101739492 154
200 3300025981 Ga0207640_10056312 Ga0207640_100563122 154
201 3300025981 Ga0207640_10099726 Ga0207640_100997262 154
202 3300025981 Ga0207640_10771158 Ga0207640_107711582 154
203 3300025981 Ga0207640_11110479 Ga0207640_111104792 154
204 3300025986 Ga0207658_10158024 Ga0207658_101580242 154
205 3300026023 Ga0207677_10066019 Ga0207677_100660192 154
206 3300026035 Ga0207703_10033276 Ga0207703_100332762 154
207 3300026041 Ga0207639_10003555 Ga0207639_100035552 154
208 3300026041 Ga0207639_10006491 Ga0207639_100064913 154
209 3300026041 Ga0207639_10010946 Ga0207639_100109462 154
210 3300026041 Ga0207639_10061478 Ga0207639_100614783 154
211 3300026041 Ga0207639_10198899 Ga0207639_101988992 154
212 3300026041 Ga0207639_10271686 Ga0207639_102716862 154
213 3300026041 Ga0207639_10440179 Ga0207639_104401792 154
214 3300026067 Ga0207678_10007414 Ga0207678_100074143 154
215 3300026067 Ga0207678_10827221 Ga0207678_108272212 154
216 3300026078 Ga0207702_10275579 Ga0207702_102755792 154
217 3300026089 Ga0207648_10815686 Ga0207648_108156862 154
218 3300026116 Ga0207674_10007508 Ga0207674_100075089 154
219 3300026116 Ga0207674_10013156 Ga0207674_100131563 154
220 3300026116 Ga0207674_10035024 Ga0207674_100350243 154
221 3300026121 Ga0207683_10646689 Ga0207683_106466892 154
222 3300026142 Ga0207698_10063699 Ga0207698_100636992 154
223 3300026142 Ga0207698_10953859 Ga0207698_109538592 154
224 3300026142 Ga0207698_11920552 Ga0207698_119205522 154
225 3300028381 Ga0268264_10019569 Ga0268264_100195694 154
226 3300031616 Ga0307508_10381090 Ga0307508_103810902 154
227 3300031649 Ga0307514_10356528 Ga0307514_103565281 154
228 3300031730 Ga0307516_10051539 Ga0307516_100515391 154
229 3300031852 Ga0307410_10228109 Ga0307410_102281092 154
230 3300031911 Ga0307412_10724601 Ga0307412_107246012 154
231 3300031995 Ga0307409_100972407 Ga0307409_1009724072 154
232 3300031995 Ga0307409_101211898 Ga0307409_1012118982 154
233 3300032005 Ga0307411_10013817 Ga0307411_100138176 154
234 3300037068 Ga0373925_1272450 Ga0373925_1272450_101_565 154
235 3300037312 Ga0395899_0003921 Ga0395899_0003921_6453_6917 154
236 3300037312 Ga0395899_0037027 Ga0395899_0037027_213_680 154
237 3300037312 Ga0395899_0074422 Ga0395899_0074422_1873_2340 154
238 3300037312 Ga0395899_0074909 Ga0395899_0074909_1607_2071 154
239 3300037312 Ga0395899_0131495 Ga0395899_0131495_1004_1471 154
240 3300037312 Ga0395899_0524113 Ga0395899_0524113_61_525 154
241 3300037418 Ga0395900_0000281 Ga0395900_0000281_69326_69790 154
242 3300037418 Ga0395900_0017032 Ga0395900_0017032_4338_4805 154
243 3300037418 Ga0395900_0020631 Ga0395900_0020631_2752_3216 154
244 3300037418 Ga0395900_0065301 Ga0395900_0065301_848_1315 154
245 3300037418 Ga0395900_0144886 Ga0395900_0144886_379_843 154
246 3300037418 Ga0395900_0215561 Ga0395900_0215561_50_514 154
247 3300037418 Ga0395900_0388865 Ga0395900_0388865_785_1249 154
248 3300037418 Ga0395900_0477285 Ga0395900_0477285_202_681 154
249 3300037418 Ga0395900_0938020 Ga0395900_0938020_285_749 154
250 3300037418 Ga0395900_0943402 Ga0395900_0943402_197_661 154
251 3300037466 Ga0395898_0015043 Ga0395898_0015043_1646_2113 154
252 3300037466 Ga0395898_0152522 Ga0395898_0152522_377_841 154
253 3300037466 Ga0395898_1120150 Ga0395898_1120150_156_620 154
254 3300037471 Ga0395905_0009481 Ga0395905_0009481_5237_5701 154
255 3300037471 Ga0395905_0039579 Ga0395905_0039579_1191_1658 154
256 3300037471 Ga0395905_0076650 Ga0395905_0076650_1023_1487 154
257 3300037471 Ga0395905_0143648 Ga0395905_0143648_999_1463 154
258 3300037471 Ga0395905_0284142 Ga0395905_0284142_825_1289 154
259 3300037471 Ga0395905_0979715 Ga0395905_0979715_157_621 154
260 3300038443 Ga0395901_0000066 Ga0395901_0000066_61062_61526 154
261 3300038443 Ga0395901_0036959 Ga0395901_0036959_3861_4328 154
262 3300038443 Ga0395901_0046365 Ga0395901_0046365_2402_2869 154
263 3300038443 Ga0395901_0066817 Ga0395901_0066817_2211_2675 154
264 3300038443 Ga0395901_0170104 Ga0395901_0170104_482_946 154
265 3300038443 Ga0395901_0690011 Ga0395901_0690011_114_593 154
266 3300038443 Ga0395901_1149725 Ga0395901_1149725_12_476 154
267 3300041486 Ga0451807_2255487 Ga0451807_2255487_290_757 154
268 3300041494 Ga0451837_0366839 Ga0451837_0366839_1125_1601 154
269 3300041501 Ga0451845_0927954 Ga0451845_0927954_412_876 154
270 3300041509 Ga0451843_0717656 Ga0451843_0717656_522_992 154
271 3300042005 Ga0439448_0000035 Ga0439448_0000035_4359_4826 154
272 3300042005 Ga0439448_0001585 Ga0439448_0001585_1329_1793 154
273 3300042005 Ga0439448_0014282 Ga0439448_0014282_321_785 154
274 3300042007 Ga0439449_0026201 Ga0439449_0026201_850_1314 154
275 3300042007 Ga0439449_0145343 Ga0439449_0145343_102_566 154
276 3300042008 Ga0439450_044216 Ga0439450_044216_316_780 154
277 3300042011 Ga0439454_027621 Ga0439454_027621_157_621 154
278 3300042012 Ga0439455_0020312 Ga0439455_0020312_742_1206 154
279 3300042145 Ga0450906_089110 Ga0450906_089110_80_544 154
280 3300042532 Ga0450893_0010053 Ga0450893_0010053_80_544 154
281 3300044656 Ga0466969_0013623 Ga0466969_0013623_1472_1936 154
282 3300044656 Ga0466969_0452250 Ga0466969_0452250_42_506 154
283 3300044658 Ga0466972_0000857 Ga0466972_0000857_12167_12631 154
284 3300044658 Ga0466972_0267794 Ga0466972_0267794_137_616 154
285 3300044683 Ga0466965_0003457 Ga0466965_0003457_5128_5592 154
286 3300044683 Ga0466965_0016153 Ga0466965_0016153_2625_3089 154
287 3300044683 Ga0466965_0057938 Ga0466965_0057938_310_774 154
288 3300044683 Ga0466965_0385142 Ga0466965_0385142_179_658 154
289 3300044684 Ga0466966_0004567 Ga0466966_0004567_1937_2401 154
290 3300044684 Ga0466966_0010721 Ga0466966_0010721_1066_1530 154
291 3300044684 Ga0466966_0042794 Ga0466966_0042794_1851_2318 154
292 3300044684 Ga0466966_0065023 Ga0466966_0065023_1324_1788 154
293 3300044684 Ga0466966_0168759 Ga0466966_0168759_822_1286 154
294 3300044684 Ga0466966_0539916 Ga0466966_0539916_157_621 154
295 3300044693 Ga0466961_0130654 Ga0466961_0130654_567_1031 154
296 3300044693 Ga0466961_0289584 Ga0466961_0289584_320_784 154
297 3300044694 Ga0466963_0639376 Ga0466963_0639376_208_672 154
298 3300044706 Ga0466964_0000136 Ga0466964_0000136_5038_5502 154
299 3300044706 Ga0466964_0005241 Ga0466964_0005241_550_1014 154
300 3300044706 Ga0466964_0006411 Ga0466964_0006411_1642_2106 154
301 3300044706 Ga0466964_0402583 Ga0466964_0402583_223_687 154
302 3300044735 Ga0466968_0000240 Ga0466968_0000240_7820_8284 154
303 3300044735 Ga0466968_0182074 Ga0466968_0182074_132_596 154
304 3300044765 Ga0466970_0038961 Ga0466970_0038961_16_480 154
305 3300044765 Ga0466970_0045096 Ga0466970_0045096_1727_2191 154
306 3300044765 Ga0466970_0085796 Ga0466970_0085796_363_827 154
307 3300044765 Ga0466970_0348550 Ga0466970_0348550_270_749 154
308 3300044842 Ga0466957_0000601 Ga0466957_0000601_13298_13762 154
309 3300044842 Ga0466957_0010985 Ga0466957_0010985_2441_2905 154
310 3300044842 Ga0466957_0027041 Ga0466957_0027041_1337_1801 154
311 3300044842 Ga0466957_0103396 Ga0466957_0103396_1277_1741 154
312 3300044842 Ga0466957_0346870 Ga0466957_0346870_474_938 154
313 3300044901 Ga0466960_0028223 Ga0466960_0028223_1703_2167 154
314 3300044901 Ga0466960_0853530 Ga0466960_0853530_27_491 154
315 3300045049 Ga0466959_0028061 Ga0466959_0028061_596_1060 154
316 3300045049 Ga0466959_0071893 Ga0466959_0071893_1394_1858 154
317 3300045049 Ga0466959_0090437 Ga0466959_0090437_1675_2139 154
318 3300045049 Ga0466959_0101674 Ga0466959_0101674_1564_2028 154
319 3300045049 Ga0466959_0287357 Ga0466959_0287357_553_1017 154
320 3300045051 Ga0451576_0185585 Ga0451576_0185585_269_736 154
321 3300045836 Ga0466958_0077662 Ga0466958_0077662_1047_1511 154
322 3300045836 Ga0466958_0125013 Ga0466958_0125013_484_948 154
323 3300045836 Ga0466958_0358359 Ga0466958_0358359_395_859 154
324 3300045976 Ga0466967_0002277 Ga0466967_0002277_5470_5934 154
325 3300045976 Ga0466967_0062002 Ga0466967_0062002_2841_3305 154
326 3300045976 Ga0466967_0136715 Ga0466967_0136715_1649_2113 154
327 3300045976 Ga0466967_0905931 Ga0466967_0905931_325_804 154
328 3300046452 Ga0495617_052458 Ga0495617_052458_235_699 154
329 3300046453 Ga0495627_007110 Ga0495627_007110_3539_4006 154
330 3300046453 Ga0495627_020880 Ga0495627_020880_366_830 154
331 3300046455 Ga0495603_0100601 Ga0495603_0100601_579_1043 154
332 3300046457 Ga0495590_0000009 Ga0495590_0000009_31654_32121 154
333 3300046457 Ga0495590_0012975 Ga0495590_0012975_112_576 154
334 3300046457 Ga0495590_0099445 Ga0495590_0099445_416_886 154
335 3300046458 Ga0495591_000408 Ga0495591_000408_31614_32081 154
336 3300046458 Ga0495591_017014 Ga0495591_017014_426_896 154
337 3300046459 Ga0495629_0020934 Ga0495629_0020934_1570_2034 154
338 3300046459 Ga0495629_0149211 Ga0495629_0149211_305_811 154
339 3300046460 Ga0495638_0060691 Ga0495638_0060691_598_1065 154
340 3300046460 Ga0495638_0281049 Ga0495638_0281049_44_508 154
341 3300046460 Ga0495638_0427046 Ga0495638_0427046_180_647 154
342 3300046463 Ga0495653_0263010 Ga0495653_0263010_226_690 154
343 3300046471 Ga0495650_0000383 Ga0495650_0000383_51598_52062 154
344 3300046472 Ga0495580_0444061 Ga0495580_0444061_69_533 154
345 3300046473 Ga0495582_0012904 Ga0495582_0012904_2039_2503 154
346 3300046474 Ga0495605_0000099 Ga0495605_0000099_18125_18589 154
347 3300046474 Ga0495605_0001634 Ga0495605_0001634_7741_8205 154
348 3300046474 Ga0495605_0016563 Ga0495605_0016563_279_746 154
349 3300046474 Ga0495605_0020319 Ga0495605_0020319_2881_3345 154
350 3300046474 Ga0495605_0025802 Ga0495605_0025802_1728_2192 154
351 3300046474 Ga0495605_0105255 Ga0495605_0105255_382_852 154
352 3300046491 Ga0495584_0000200 Ga0495584_0000200_10430_10897 154
353 3300046491 Ga0495584_0000685 Ga0495584_0000685_13176_13640 154
354 3300046491 Ga0495584_0004558 Ga0495584_0004558_469_933 154
355 3300046491 Ga0495584_0006320 Ga0495584_0006320_5564_6028 154
356 3300046491 Ga0495584_0012796 Ga0495584_0012796_1291_1755 154
357 3300046491 Ga0495584_0048029 Ga0495584_0048029_1369_1839 154
358 3300046491 Ga0495584_0127429 Ga0495584_0127429_186_650 154
359 3300046492 Ga0495585_0000053 Ga0495585_0000053_100254_100718 154
360 3300046492 Ga0495585_0000401 Ga0495585_0000401_30140_30604 154
361 3300046492 Ga0495585_0006473 Ga0495585_0006473_4661_5128 154
362 3300046492 Ga0495585_0015748 Ga0495585_0015748_629_1093 154
363 3300046492 Ga0495585_0023981 Ga0495585_0023981_2926_3396 154
364 3300046492 Ga0495585_0055501 Ga0495585_0055501_259_723 154
365 3300046492 Ga0495585_0059278 Ga0495585_0059278_234_701 154
366 3300046492 Ga0495585_0069651 Ga0495585_0069651_267_737 154
367 3300046492 Ga0495585_0106338 Ga0495585_0106338_974_1438 154
368 3300046492 Ga0495585_0123561 Ga0495585_0123561_687_1151 154
369 3300046492 Ga0495585_0166645 Ga0495585_0166645_217_681 154
370 3300046492 Ga0495585_0185168 Ga0495585_0185168_526_990 154
371 3300046499 Ga0495594_0016643 Ga0495594_0016643_2015_2479 154
372 3300046500 Ga0495596_0000097 Ga0495596_0000097_18074_18538 154
373 3300046500 Ga0495596_0001644 Ga0495596_0001644_6928_7392 154
374 3300046500 Ga0495596_0007668 Ga0495596_0007668_1299_1763 154
375 3300046500 Ga0495596_0010763 Ga0495596_0010763_2983_3447 154
376 3300046500 Ga0495596_0012689 Ga0495596_0012689_179_643 154
377 3300046500 Ga0495596_0022163 Ga0495596_0022163_26_490 154
378 3300046500 Ga0495596_0022881 Ga0495596_0022881_477_941 154
379 3300046500 Ga0495596_0054860 Ga0495596_0054860_971_1435 154
380 3300046500 Ga0495596_0059890 Ga0495596_0059890_188_655 154
381 3300046500 Ga0495596_0078187 Ga0495596_0078187_632_1096 154
382 3300046500 Ga0495596_0120981 Ga0495596_0120981_537_1001 154
383 3300046500 Ga0495596_0125168 Ga0495596_0125168_39_503 154
384 3300046501 Ga0495607_0000412 Ga0495607_0000412_11460_11924 154
385 3300046501 Ga0495607_0000440 Ga0495607_0000440_31026_31493 154
386 3300046501 Ga0495607_0000798 Ga0495607_0000798_20456_20923 154
387 3300046501 Ga0495607_0001423 Ga0495607_0001423_6154_6618 154
388 3300046501 Ga0495607_0001730 Ga0495607_0001730_7768_8232 154
389 3300046501 Ga0495607_0006708 Ga0495607_0006708_3734_4198 154
390 3300046501 Ga0495607_0034399 Ga0495607_0034399_664_1134 154
391 3300046501 Ga0495607_0082021 Ga0495607_0082021_1285_1749 154
392 3300046501 Ga0495607_0097003 Ga0495607_0097003_339_803 154
393 3300046501 Ga0495607_0117976 Ga0495607_0117976_622_1086 154
394 3300046506 Ga0495583_0000713 Ga0495583_0000713_10672_11139 154
395 3300046506 Ga0495583_0000723 Ga0495583_0000723_3966_4430 154
396 3300046506 Ga0495583_0000836 Ga0495583_0000836_34927_35391 154
397 3300046506 Ga0495583_0002049 Ga0495583_0002049_17653_18117 154
398 3300046506 Ga0495583_0004776 Ga0495583_0004776_2284_2748 154
399 3300046506 Ga0495583_0006461 Ga0495583_0006461_3559_4029 154
400 3300046506 Ga0495583_0051366 Ga0495583_0051366_170_634 154
401 3300046506 Ga0495583_0114885 Ga0495583_0114885_111_575 154
402 3300046506 Ga0495583_0228060 Ga0495583_0228060_188_652 154
403 3300046507 Ga0495606_0010360 Ga0495606_0010360_2442_2906 154
404 3300046507 Ga0495606_0010533 Ga0495606_0010533_1314_1778 154
405 3300046507 Ga0495606_0027945 Ga0495606_0027945_1341_1805 154
406 3300046507 Ga0495606_0037124 Ga0495606_0037124_542_1006 154
407 3300046507 Ga0495606_0056783 Ga0495606_0056783_213_680 154
408 3300046507 Ga0495606_0246343 Ga0495606_0246343_401_871 154
409 3300046507 Ga0495606_0366003 Ga0495606_0366003_257_721 154
410 3300046512 Ga0495610_0000685 Ga0495610_0000685_11327_11794 154
411 3300046512 Ga0495610_0205980 Ga0495610_0205980_284_754 154
412 3300046513 Ga0495616_0000033 Ga0495616_0000033_97827_98291 154
413 3300046513 Ga0495616_0003653 Ga0495616_0003653_5236_5700 154
414 3300046513 Ga0495616_0008169 Ga0495616_0008169_3980_4450 154
415 3300046513 Ga0495616_0010678 Ga0495616_0010678_2569_3036 154
416 3300046513 Ga0495616_0014419 Ga0495616_0014419_1598_2062 154
417 3300046513 Ga0495616_0016468 Ga0495616_0016468_43_507 154
418 3300046513 Ga0495616_0022346 Ga0495616_0022346_273_737 154
419 3300046513 Ga0495616_0024676 Ga0495616_0024676_307_771 154
420 3300046513 Ga0495616_0032989 Ga0495616_0032989_234_698 154
421 3300046513 Ga0495616_0048354 Ga0495616_0048354_1257_1721 154
422 3300046513 Ga0495616_0051836 Ga0495616_0051836_390_854 154
423 3300046513 Ga0495616_0201150 Ga0495616_0201150_120_584 154
424 3300046513 Ga0495616_0260920 Ga0495616_0260920_238_702 154
425 3300046518 Ga0495631_0000823 Ga0495631_0000823_10560_11027 154
426 3300046518 Ga0495631_0002023 Ga0495631_0002023_1314_1778 154
427 3300046518 Ga0495631_0002536 Ga0495631_0002536_9066_9530 154
428 3300046518 Ga0495631_0010021 Ga0495631_0010021_3868_4335 154
429 3300046518 Ga0495631_0013485 Ga0495631_0013485_1171_1635 154
430 3300046518 Ga0495631_0017998 Ga0495631_0017998_1421_1885 154
431 3300046518 Ga0495631_0027268 Ga0495631_0027268_457_921 154
432 3300046518 Ga0495631_0047151 Ga0495631_0047151_311_775 154
433 3300046518 Ga0495631_0134161 Ga0495631_0134161_579_1043 154
434 3300046518 Ga0495631_0217666 Ga0495631_0217666_306_776 154
435 3300046519 Ga0495632_0000017 Ga0495632_0000017_146060_146524 154
436 3300046519 Ga0495632_0001065 Ga0495632_0001065_17550_18014 154
437 3300046519 Ga0495632_0001389 Ga0495632_0001389_6653_7120 154
438 3300046519 Ga0495632_0006033 Ga0495632_0006033_4815_5279 154
439 3300046519 Ga0495632_0025614 Ga0495632_0025614_2417_2884 154
440 3300046519 Ga0495632_0038249 Ga0495632_0038249_523_993 154
441 3300046519 Ga0495632_0092693 Ga0495632_0092693_490_954 154
442 3300046520 Ga0495637_0000003 Ga0495637_0000003_269775_270242 154
443 3300046520 Ga0495637_0124910 Ga0495637_0124910_126_590 154
444 3300046522 Ga0495643_0000426 Ga0495643_0000426_43125_43589 154
445 3300046522 Ga0495643_0002094 Ga0495643_0002094_6456_6920 154
446 3300046522 Ga0495643_0006209 Ga0495643_0006209_3634_4101 154
447 3300046522 Ga0495643_0041795 Ga0495643_0041795_1576_2040 154
448 3300046522 Ga0495643_0119813 Ga0495643_0119813_308_775 154
449 3300046523 Ga0495644_0000913 Ga0495644_0000913_4418_4882 154
450 3300046523 Ga0495644_0012848 Ga0495644_0012848_1110_1577 154
451 3300046523 Ga0495644_0019663 Ga0495644_0019663_1956_2426 154
452 3300046523 Ga0495644_0032923 Ga0495644_0032923_941_1405 154
453 3300046523 Ga0495644_0033515 Ga0495644_0033515_210_674 154
454 3300046523 Ga0495644_0036714 Ga0495644_0036714_1046_1510 154
455 3300046524 Ga0495648_0000829 Ga0495648_0000829_9284_9748 154
456 3300046524 Ga0495648_0001630 Ga0495648_0001630_15726_16193 154
457 3300046524 Ga0495648_0009222 Ga0495648_0009222_3976_4446 154
458 3300046524 Ga0495648_0030282 Ga0495648_0030282_3079_3543 154
459 3300046524 Ga0495648_0170840 Ga0495648_0170840_261_728 154
460 3300046524 Ga0495648_0361606 Ga0495648_0361606_38_502 154
461 3300046525 Ga0495663_0055858 Ga0495663_0055858_440_904 154
462 3300046526 Ga0495666_0001317 Ga0495666_0001317_1173_1637 154
463 3300046528 Ga0495642_0000608 Ga0495642_0000608_10833_11300 154
464 3300046528 Ga0495642_0002207 Ga0495642_0002207_3715_4179 154
465 3300046528 Ga0495642_0003761 Ga0495642_0003761_3921_4385 154
466 3300046528 Ga0495642_0005474 Ga0495642_0005474_2063_2530 154
467 3300046528 Ga0495642_0019961 Ga0495642_0019961_187_651 154
468 3300046528 Ga0495642_0029655 Ga0495642_0029655_1654_2118 154
469 3300046528 Ga0495642_0040895 Ga0495642_0040895_1087_1557 154
470 3300046528 Ga0495642_0054291 Ga0495642_0054291_986_1450 154
471 3300046528 Ga0495642_0060921 Ga0495642_0060921_665_1129 154
472 3300046528 Ga0495642_0125411 Ga0495642_0125411_228_692 154
473 3300046528 Ga0495642_0180182 Ga0495642_0180182_298_762 154
474 3300046528 Ga0495642_0373697 Ga0495642_0373697_24_488 154
475 3300046530 Ga0495654_0002973 Ga0495654_0002973_1927_2391 154
476 3300046530 Ga0495654_0073099 Ga0495654_0073099_256_720 154
477 3300046531 Ga0495665_0014830 Ga0495665_0014830_2089_2553 154
478 3300046533 Ga0495640_0072968 Ga0495640_0072968_1719_2183 154
479 3300046535 Ga0495586_0004569 Ga0495586_0004569_6644_7108 154
480 3300046535 Ga0495586_0269081 Ga0495586_0269081_463_927 154
481 3300046538 Ga0495609_0000086 Ga0495609_0000086_25074_25538 154
482 3300046538 Ga0495609_0000423 Ga0495609_0000423_11046_11510 154
483 3300046538 Ga0495609_0004268 Ga0495609_0004268_4404_4868 154
484 3300046538 Ga0495609_0010278 Ga0495609_0010278_472_936 154
485 3300046538 Ga0495609_0016472 Ga0495609_0016472_2610_3074 154
486 3300046538 Ga0495609_0043513 Ga0495609_0043513_24_488 154
487 3300046538 Ga0495609_0056867 Ga0495609_0056867_1080_1550 154
488 3300046538 Ga0495609_0075141 Ga0495609_0075141_139_603 154
489 3300046542 Ga0495597_0000483 Ga0495597_0000483_6292_6756 154
490 3300046542 Ga0495597_0000709 Ga0495597_0000709_11406_11873 154
491 3300046542 Ga0495597_0002261 Ga0495597_0002261_7874_8338 154
492 3300046542 Ga0495597_0002669 Ga0495597_0002669_7396_7860 154
493 3300046542 Ga0495597_0023126 Ga0495597_0023126_2083_2547 154
494 3300046542 Ga0495597_0035877 Ga0495597_0035877_117_581 154
495 3300046542 Ga0495597_0045624 Ga0495597_0045624_779_1243 154
496 3300046542 Ga0495597_0094504 Ga0495597_0094504_679_1146 154
497 3300046542 Ga0495597_0158786 Ga0495597_0158786_176_640 154
498 3300046558 Ga0495633_0001443 Ga0495633_0001443_11094_11558 154
499 3300046558 Ga0495633_0003300 Ga0495633_0003300_1509_1976 154
500 3300046558 Ga0495633_0028578 Ga0495633_0028578_1465_1929 154
501 3300046558 Ga0495633_0075677 Ga0495633_0075677_671_1135 154
502 3300046615 Ga0495656_0180525 Ga0495656_0180525_280_744 154
503 3300046616 Ga0495668_0001132 Ga0495668_0001132_8302_8769 154
504 3300046616 Ga0495668_0006814 Ga0495668_0006814_1542_2006 154
505 3300046616 Ga0495668_0012433 Ga0495668_0012433_3370_3834 154
506 3300046616 Ga0495668_0019025 Ga0495668_0019025_186_650 154
507 3300046616 Ga0495668_0037566 Ga0495668_0037566_144_608 154
508 3300046616 Ga0495668_0050247 Ga0495668_0050247_479_946 154
509 3300046616 Ga0495668_0057701 Ga0495668_0057701_481_948 154
510 3300046616 Ga0495668_0096748 Ga0495668_0096748_417_881 154
511 3300046616 Ga0495668_0115448 Ga0495668_0115448_436_906 154
512 3300046616 Ga0495668_0203263 Ga0495668_0203263_186_650 154
513 3300046616 Ga0495668_0258459 Ga0495668_0258459_170_634 154
514 3300046642 Ga0495634_0577173 Ga0495634_0577173_90_596 154
515 3300046648 Ga0495611_0000492 Ga0495611_0000492_20841_21308 154
516 3300046648 Ga0495611_0003110 Ga0495611_0003110_3009_3476 154
517 3300046648 Ga0495611_0007491 Ga0495611_0007491_3281_3745 154
518 3300046648 Ga0495611_0052517 Ga0495611_0052517_1307_1771 154
519 3300046648 Ga0495611_0137980 Ga0495611_0137980_381_851 154
520 3300046648 Ga0495611_0254537 Ga0495611_0254537_190_654 154
521 3300046660 Ga0495625_0017173 Ga0495625_0017173_2763_3227 154
522 3300046660 Ga0495625_0037001 Ga0495625_0037001_1055_1522 154
523 3300046660 Ga0495625_0171216 Ga0495625_0171216_272_739 154
524 3300046660 Ga0495625_0174317 Ga0495625_0174317_896_1360 154
525 3300046660 Ga0495625_0843475 Ga0495625_0843475_12_476 154
526 3300046663 Ga0495635_0009755 Ga0495635_0009755_855_1361 154
527 3300046665 Ga0495661_0000457 Ga0495661_0000457_31768_32238 154
528 3300046665 Ga0495661_0000724 Ga0495661_0000724_25074_25538 154
529 3300046665 Ga0495661_0001752 Ga0495661_0001752_11386_11850 154
530 3300046665 Ga0495661_0002435 Ga0495661_0002435_7701_8165 154
531 3300046665 Ga0495661_0009820 Ga0495661_0009820_5457_5924 154
532 3300046665 Ga0495661_0013860 Ga0495661_0013860_1753_2220 154
533 3300046665 Ga0495661_0016657 Ga0495661_0016657_1463_1927 154
534 3300046665 Ga0495661_0041554 Ga0495661_0041554_956_1420 154
535 3300046665 Ga0495661_0045935 Ga0495661_0045935_1665_2129 154
536 3300046665 Ga0495661_0051040 Ga0495661_0051040_193_657 154
537 3300046665 Ga0495661_0055611 Ga0495661_0055611_1475_1939 154
538 3300046665 Ga0495661_0057949 Ga0495661_0057949_56_520 154
539 3300046665 Ga0495661_0081300 Ga0495661_0081300_958_1422 154
540 3300046665 Ga0495661_0095089 Ga0495661_0095089_1091_1561 154
541 3300046665 Ga0495661_0096335 Ga0495661_0096335_99_566 154
542 3300046665 Ga0495661_0134312 Ga0495661_0134312_653_1120 154
543 3300046665 Ga0495661_0135979 Ga0495661_0135979_585_1055 154
544 3300046665 Ga0495661_0455198 Ga0495661_0455198_94_558 154
545 3300046674 Ga0495588_0000094 Ga0495588_0000094_54325_54789 154
546 3300046674 Ga0495588_0003039 Ga0495588_0003039_3059_3523 154
547 3300046679 Ga0495623_0302883 Ga0495623_0302883_292_756 154
548 3300046680 Ga0495646_0126666 Ga0495646_0126666_935_1399 154
549 3300046684 Ga0495669_0000015 Ga0495669_0000015_100788_101252 154
550 3300046684 Ga0495669_0007810 Ga0495669_0007810_1205_1672 154
551 3300046684 Ga0495669_0053258 Ga0495669_0053258_455_925 154
552 3300046684 Ga0495669_0062257 Ga0495669_0062257_382_846 154
553 3300046684 Ga0495669_0093551 Ga0495669_0093551_168_632 154
554 3300046684 Ga0495669_0286884 Ga0495669_0286884_128_592 154
555 3300046689 Ga0495613_0366204 Ga0495613_0366204_73_537 154
556 3300046691 Ga0495670_0000086 Ga0495670_0000086_29531_29995 154
557 3300046691 Ga0495670_0000119 Ga0495670_0000119_13832_14296 154
558 3300046691 Ga0495670_0009933 Ga0495670_0009933_334_804 154
559 3300046691 Ga0495670_0028223 Ga0495670_0028223_2183_2647 154
560 3300046691 Ga0495670_0029410 Ga0495670_0029410_904_1368 154
561 3300046691 Ga0495670_0059321 Ga0495670_0059321_534_998 154
562 3300046692 Ga0495671_0006226 Ga0495671_0006226_3018_3482 154
563 3300046692 Ga0495671_0144775 Ga0495671_0144775_441_905 154
564 3300046692 Ga0495671_0191063 Ga0495671_0191063_50_520 154
565 3300046692 Ga0495671_0296853 Ga0495671_0296853_26_490 154
566 3300046694 Ga0495649_0000678 Ga0495649_0000678_10616_11083 154
567 3300046694 Ga0495649_0014817 Ga0495649_0014817_963_1427 154
568 3300046694 Ga0495649_0020731 Ga0495649_0020731_2232_2696 154
569 3300046694 Ga0495649_0071546 Ga0495649_0071546_984_1448 154
570 3300046694 Ga0495649_0103157 Ga0495649_0103157_473_940 154
571 3300046694 Ga0495649_0109766 Ga0495649_0109766_866_1330 154
572 3300046694 Ga0495649_0140146 Ga0495649_0140146_158_622 154
573 3300046694 Ga0495649_0435790 Ga0495649_0435790_156_620 154
574 3300046794 Ga0495589_0000055 Ga0495589_0000055_85350_85814 154
575 3300046794 Ga0495589_0000069 Ga0495589_0000069_9887_10351 154
576 3300046794 Ga0495589_0000584 Ga0495589_0000584_16133_16597 154
577 3300046794 Ga0495589_0004549 Ga0495589_0004549_6396_6860 154
578 3300046794 Ga0495589_0006587 Ga0495589_0006587_464_928 154
579 3300046794 Ga0495589_0013813 Ga0495589_0013813_2588_3052 154
580 3300046794 Ga0495589_0017969 Ga0495589_0017969_1949_2416 154
581 3300046794 Ga0495589_0041204 Ga0495589_0041204_690_1160 154
582 3300046794 Ga0495589_0079152 Ga0495589_0079152_169_633 154
583 3300046810 Ga0495660_0000059 Ga0495660_0000059_93212_93676 154
584 3300046810 Ga0495660_0007831 Ga0495660_0007831_551_1015 154
585 3300046810 Ga0495660_0021216 Ga0495660_0021216_846_1313 154
586 3300046810 Ga0495660_0021260 Ga0495660_0021260_2002_2466 154
587 3300046810 Ga0495660_0022744 Ga0495660_0022744_556_1023 154
588 3300046810 Ga0495660_0025631 Ga0495660_0025631_295_759 154
589 3300046810 Ga0495660_0043132 Ga0495660_0043132_1862_2326 154
590 3300046810 Ga0495660_0262681 Ga0495660_0262681_174_638 154
591 3300047315 Ga0495581_0006526 Ga0495581_0006526_2031_2495 154
592 3300047317 Ga0495604_0003551 Ga0495604_0003551_3674_4180 154
593 3300047317 Ga0495604_0058000 Ga0495604_0058000_1436_1900 154
594 3300047318 Ga0495636_0006895 Ga0495636_0006895_1988_2452 154
595 3300047318 Ga0495636_0009776 Ga0495636_0009776_326_790 154
596 3300047320 Ga0495672_0000108 Ga0495672_0000108_44689_45153 154
597 3300047320 Ga0495672_0000257 Ga0495672_0000257_49571_50035 154
598 3300047320 Ga0495672_0000338 Ga0495672_0000338_49464_49931 154
599 3300047320 Ga0495672_0001037 Ga0495672_0001037_11902_12366 154
600 3300047320 Ga0495672_0020359 Ga0495672_0020359_485_949 154
601 3300047320 Ga0495672_0091189 Ga0495672_0091189_521_985 154
602 3300047320 Ga0495672_0273566 Ga0495672_0273566_176_640 154
603 3300047321 Ga0495676_0000054 Ga0495676_0000054_27608_28072 154
604 3300047321 Ga0495676_0011260 Ga0495676_0011260_1006_1470 154
605 3300047321 Ga0495676_0102424 Ga0495676_0102424_54_518 154
606 3300047322 Ga0495680_0010490 Ga0495680_0010490_7315_7779 154
607 3300047323 Ga0495683_0000178 Ga0495683_0000178_12392_12859 154
608 3300047323 Ga0495683_0001790 Ga0495683_0001790_7298_7762 154
609 3300047323 Ga0495683_0007333 Ga0495683_0007333_3349_3813 154
610 3300047323 Ga0495683_0028240 Ga0495683_0028240_524_994 154
611 3300047323 Ga0495683_0046347 Ga0495683_0046347_1371_1835 154
612 3300047323 Ga0495683_0057213 Ga0495683_0057213_1006_1470 154
613 3300047323 Ga0495683_0064190 Ga0495683_0064190_658_1122 154
614 3300047323 Ga0495683_0139245 Ga0495683_0139245_162_626 154
615 3300047323 Ga0495683_0176403 Ga0495683_0176403_416_880 154
616 3300047323 Ga0495683_0325370 Ga0495683_0325370_129_593 154
617 3300047443 Ga0495687_000110 Ga0495687_000110_91497_91961 154
618 3300047443 Ga0495687_000139 Ga0495687_000139_25074_25538 154
619 3300047443 Ga0495687_000355 Ga0495687_000355_40820_41284 154
620 3300047443 Ga0495687_001210 Ga0495687_001210_13830_14297 154
621 3300047443 Ga0495687_001518 Ga0495687_001518_16264_16728 154
622 3300047444 Ga0495675_0001460 Ga0495675_0001460_10253_10717 154
623 3300047445 Ga0495677_0000122 Ga0495677_0000122_29914_30378 154
624 3300047445 Ga0495677_0000147 Ga0495677_0000147_7009_7473 154
625 3300047445 Ga0495677_0000239 Ga0495677_0000239_22560_23027 154
626 3300047445 Ga0495677_0001224 Ga0495677_0001224_4177_4641 154
627 3300047445 Ga0495677_0003756 Ga0495677_0003756_2285_2749 154
628 3300047445 Ga0495677_0004591 Ga0495677_0004591_1030_1494 154
629 3300047445 Ga0495677_0015192 Ga0495677_0015192_1113_1577 154
630 3300047445 Ga0495677_0022063 Ga0495677_0022063_695_1159 154
631 3300047445 Ga0495677_0024355 Ga0495677_0024355_1395_1862 154
632 3300047446 Ga0495679_002570 Ga0495679_002570_8139_8603 154
633 3300047446 Ga0495679_038322 Ga0495679_038322_610_1077 154
634 3300047446 Ga0495679_058888 Ga0495679_058888_458_922 154
635 3300047446 Ga0495679_078206 Ga0495679_078206_163_633 154
636 3300047446 Ga0495679_144605 Ga0495679_144605_155_619 154
637 3300047447 Ga0495685_002935 Ga0495685_002935_523_993 154
638 3300047447 Ga0495685_029642 Ga0495685_029642_527_991 154
639 3300047447 Ga0495685_071517 Ga0495685_071517_206_670 154
640 3300047470 Ga0495681_0000914 Ga0495681_0000914_3829_4293 154
641 3300047470 Ga0495681_0001127 Ga0495681_0001127_13194_13658 154
642 3300047470 Ga0495681_0007209 Ga0495681_0007209_3247_3711 154
643 3300047470 Ga0495681_0008769 Ga0495681_0008769_1762_2226 154
644 3300047470 Ga0495681_0021644 Ga0495681_0021644_1214_1678 154
645 3300047470 Ga0495681_0089035 Ga0495681_0089035_421_888 154
646 3300047470 Ga0495681_0089074 Ga0495681_0089074_474_941 154
647 3300047470 Ga0495681_0107046 Ga0495681_0107046_370_840 154
648 3300047472 Ga0495686_0000148 Ga0495686_0000148_15429_15896 154
649 3300047472 Ga0495686_0008879 Ga0495686_0008879_4109_4576 154
650 3300047673 Ga0495593_0027077 Ga0495593_0027077_798_1304 154
651 3300048089 Ga0495614_0004870 Ga0495614_0004870_2834_3340 154
652 3300048089 Ga0495614_0007946 Ga0495614_0007946_34_498 154
653 3300048091 Ga0495626_0000146 Ga0495626_0000146_1379_1843 154
654 3300048091 Ga0495626_0003692 Ga0495626_0003692_5126_5590 154
655 3300048091 Ga0495626_0003783 Ga0495626_0003783_4437_4901 154
656 3300048091 Ga0495626_0007823 Ga0495626_0007823_3576_4040 154
657 3300048091 Ga0495626_0011118 Ga0495626_0011118_2629_3093 154
658 3300048091 Ga0495626_0014827 Ga0495626_0014827_425_892 154
659 3300048091 Ga0495626_0015630 Ga0495626_0015630_2346_2810 154
660 3300048091 Ga0495626_0017280 Ga0495626_0017280_77_541 154
661 3300048091 Ga0495626_0025166 Ga0495626_0025166_1271_1735 154
662 3300048091 Ga0495626_0028607 Ga0495626_0028607_1688_2152 154
663 3300048091 Ga0495626_0039730 Ga0495626_0039730_1037_1501 154
664 3300048091 Ga0495626_0058485 Ga0495626_0058485_700_1164 154
665 3300048904 Ga0496101_0172107 Ga0496101_0172107_880_1344 154
666 3300048905 Ga0496102_0494231 Ga0496102_0494231_632_1096 154
667 3300048907 Ga0496104_0253191 Ga0496104_0253191_174_638 154
668 3300048908 Ga0496105_0419180 Ga0496105_0419180_507_971 154
669 3300048908 Ga0496105_0517567 Ga0496105_0517567_327_794 154
670 3300048909 Ga0496106_0046464 Ga0496106_0046464_1083_1547 154
671 3300048909 Ga0496106_0580928 Ga0496106_0580928_300_764 154
672 3300048910 Ga0496107_0064140 Ga0496107_0064140_1031_1495 154
673 3300048910 Ga0496107_0788124 Ga0496107_0788124_204_668 154
674 3300048911 Ga0496108_0217400 Ga0496108_0217400_1179_1649 154
675 3300048911 Ga0496108_0354618 Ga0496108_0354618_221_691 154
676 3300048911 Ga0496108_0805571 Ga0496108_0805571_174_638 154
677 3300048913 Ga0496110_0009597 Ga0496110_0009597_130_597 154
678 3300048913 Ga0496110_0584426 Ga0496110_0584426_268_732 154
679 3300048914 Ga0496111_0042238 Ga0496111_0042238_1497_1964 154
680 3300048915 Ga0496112_0062825 Ga0496112_0062825_2038_2502 154
681 3300048915 Ga0496112_0102293 Ga0496112_0102293_93_563 154
682 3300048915 Ga0496112_0349119 Ga0496112_0349119_308_772 154
683 3300048916 Ga0496113_0005132 Ga0496113_0005132_7199_7663 154
684 3300048916 Ga0496113_0012063 Ga0496113_0012063_4524_4994 154
685 3300048925 Ga0496122_0000483 Ga0496122_0000483_76807_77277 154
686 3300048925 Ga0496122_0008175 Ga0496122_0008175_4925_5389 154
687 3300048925 Ga0496122_0015218 Ga0496122_0015218_2896_3360 154
688 3300048926 Ga0496123_0000902 Ga0496123_0000902_41766_42236 154
689 3300048926 Ga0496123_0000970 Ga0496123_0000970_5017_5481 154
690 3300048926 Ga0496123_0008990 Ga0496123_0008990_8521_8985 154
691 3300048926 Ga0496123_0302318 Ga0496123_0302318_75_542 154
692 3300048927 Ga0496124_0015304 Ga0496124_0015304_6747_7211 154
693 3300048927 Ga0496124_0019056 Ga0496124_0019056_2897_3361 154
694 3300048927 Ga0496124_0085939 Ga0496124_0085939_1596_2063 154
695 3300048927 Ga0496124_0109365 Ga0496124_0109365_1270_1734 154
696 3300048927 Ga0496124_0250054 Ga0496124_0250054_316_783 154
697 3300048927 Ga0496124_0266370 Ga0496124_0266370_387_851 154
698 3300048928 Ga0496125_0002842 Ga0496125_0002842_15271_15741 154
699 3300048928 Ga0496125_0065889 Ga0496125_0065889_1417_1881 154
700 3300049459 Ga0495678_000117 Ga0495678_000117_62736_63203 154
701 3300049459 Ga0495678_000342 Ga0495678_000342_14038_14502 154
702 3300049459 Ga0495678_000526 Ga0495678_000526_13826_14290 154
703 3300049459 Ga0495678_001545 Ga0495678_001545_4015_4482 154
704 3300049459 Ga0495678_048355 Ga0495678_048355_798_1268 154
705 3300049459 Ga0495678_082837 Ga0495678_082837_561_1025 154
706 3300049460 Ga0495682_0000562 Ga0495682_0000562_11590_12054 154
707 3300049460 Ga0495682_0002811 Ga0495682_0002811_2190_2657 154
708 3300049460 Ga0495682_0003956 Ga0495682_0003956_5885_6349 154
709 3300049460 Ga0495682_0020573 Ga0495682_0020573_1149_1619 154
710 3300049460 Ga0495682_0055502 Ga0495682_0055502_545_1012 154
711 3300049571 Ga0501034_0408665 Ga0501034_0408665_407_871 154
712 3300049572 Ga0501036_0039335 Ga0501036_0039335_1035_1499 154
713 3300049581 Ga0501047_0760844 Ga0501047_0760844_53_517 154
714 3300049583 Ga0501067_0751858 Ga0501067_0751858_39_515 154
715 3300049679 Ga0501249_001780 Ga0501249_001780_3431_3895 154
716 3300049708 Ga0501245_053784 Ga0501245_053784_228_692 154
717 3300049742 Ga0501080_0109548 Ga0501080_0109548_2048_2512 154
718 3300049766 Ga0501269_000003 Ga0501269_000003_61016_61480 154
719 3300049822 Ga0501035_0000294 Ga0501035_0000294_47599_48063 154
720 3300053126 Ga0500621_168024 Ga0500621_168024_250_720 154
721 3300053153 Ga0500616_0009636 Ga0500616_0009636_2855_3319 154
722 3300061719 Ga0466962_0129428 Ga0466962_0129428_741_1205 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

18

167

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t6g-assembly2.cif.gz_D structure of the complex between nsp3 (shep1) and p130cas 0.5864 6 153
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.5792 4 153
3t6g-assembly2.cif.gz_D structure of the complex between nsp3 (shep1) and p130cas 0.5771 6 153
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.5625 11 149
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.5598 10 150
ID Description Score Start End Superfamily
af_A0A0R0GPA9_387_501_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6512 44 153 1.20.140.150
af_Q4PIV2_6_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6457 75 152 1.20.140.150
af_Q7HP05_85_278_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6452 9 150 1.20.120.80
af_Q1LU92_154_264_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6321 19 153 1.20.120.230
af_K7MAD8_538_651_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.628 57 153 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A4Q3QCN3-F1-model_v4 deleted 0.9779 73 153
AF-A0A7Y6NMP4-F1-model_v4 DUF2269 domain-containing protein 0.9746 1 154 GO:0016020
AF-A0A3S2EEL8-F1-model_v4 DUF2269 domain-containing protein 0.9701 26 153 GO:0016020
AF-A0A0Q7PJL4-F1-model_v4 DUF2269 domain-containing protein 0.9693 2 153 GO:0016020
AF-A0A1F8I2W7-F1-model_v4 deleted 0.9686 22 153

Feature Viewer

pLDDT pTM Quality
94.97 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map