F476732

General Info

Members Datasets Scaffolds Average Seq Length
710 349 707 110

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0062232|Ga0501032_0062232_440_844
Length 134
Sequence MQTAHIAGQTGPGRVSAAGRNRSFLMSTVKVTDATFDKDVLQASGPVLVDFWAEWCGPCKQIAPALEQIADELGAKVTIAKLDIEESPTTPSRYGVRGIPTMMLFKDGQMASMKVGAMPKQKILEWLSEAGVTA

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
176 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
211 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
304 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
310 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
311 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
312 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
315 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
316 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
319 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
320 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
321 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
322 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
326 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
327 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
328 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
329 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
332 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
335 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
336 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
337 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
338 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
339 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
340 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
341 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
346 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 1.69
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.39
Nodule 0
Rhizoplane 3.66
Rhizosphere 80.42
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10004751 3300003791 Bacteria 6832
2 Ga0055531_10001345 3300003794 Bacteria 18361
3 Ga0065715_10134927 3300005293 Bacteria 1946
4 Ga0070658_10066333 3300005327 Bacteria 2948
5 Ga0070658_10289389 3300005327 Bacteria 1396
6 Ga0070658_10863680 3300005327 Bacteria 786
7 Ga0070676_10178648 3300005328 Bacteria 1378
8 Ga0070683_101132713 3300005329 Bacteria 752
9 Ga0070690_100291837 3300005330 Bacteria 1166
10 Ga0070670_100000022 3300005331 Bacteria 199146
11 Ga0070670_100000456 3300005331 Bacteria 33057
12 Ga0070670_100042264 3300005331 Bacteria 3919
13 Ga0070670_100133578 3300005331 Bacteria 2144
14 Ga0068869_100068449 3300005334 Bacteria 2622
15 Ga0068869_101050744 3300005334 Bacteria 711
16 Ga0068869_101167203 3300005334 Bacteria 676
17 Ga0068869_101530919 3300005334 Bacteria 593
18 Ga0070666_10021858 3300005335 Bacteria 4149
19 Ga0070666_10362318 3300005335 Bacteria 1039
20 Ga0070680_100532103 3300005336 Bacteria 1007
21 Ga0070682_100089299 3300005337 Bacteria 2013
22 Ga0068868_100100641 3300005338 Bacteria 2338
23 Ga0068868_100620635 3300005338 Bacteria 960
24 Ga0070660_100064715 3300005339 Bacteria 2845
25 Ga0070689_100771642 3300005340 Bacteria 844
26 Ga0070689_101648867 3300005340 Bacteria 583
27 Ga0070661_101077437 3300005344 Bacteria 669
28 Ga0070668_100001157 3300005347 Bacteria 18611
29 Ga0070668_100001210 3300005347 Bacteria 18336
30 Ga0070668_100007207 3300005347 Bacteria 8246
31 Ga0070668_100028982 3300005347 Bacteria 4203
32 Ga0070668_100094897 3300005347 Bacteria 2355
33 Ga0070668_100099959 3300005347 Bacteria 2297
34 Ga0070668_100424745 3300005347 Bacteria 1138
35 Ga0070668_102019917 3300005347 Bacteria 532
36 Ga0070669_100012619 3300005353 Bacteria 5997
37 Ga0070669_100072981 3300005353 Bacteria 2542
38 Ga0070669_100434927 3300005353 Bacteria 1079
39 Ga0070669_100697790 3300005353 Bacteria 857
40 Ga0070675_100137670 3300005354 Bacteria 2085
41 Ga0070675_101144236 3300005354 Bacteria 716
42 Ga0070675_101344275 3300005354 Bacteria 659
43 Ga0070671_100012583 3300005355 Bacteria 6816
44 Ga0070671_100268298 3300005355 Bacteria 1451
45 Ga0070671_100517825 3300005355 Bacteria 1027
46 Ga0070671_100655497 3300005355 Bacteria 909
47 Ga0070673_100125525 3300005364 Bacteria 2147
48 Ga0070688_101028237 3300005365 Bacteria 656
49 Ga0070688_101471346 3300005365 Bacteria 554
50 Ga0070659_100003826 3300005366 Bacteria 10736
51 Ga0070659_102117124 3300005366 Bacteria 506
52 Ga0070667_100000369 3300005367 Bacteria 49025
53 Ga0070667_100003061 3300005367 Bacteria 14375
54 Ga0070667_100018158 3300005367 Bacteria 5832
55 Ga0070667_100020340 3300005367 Bacteria 5510
56 Ga0070667_100153467 3300005367 Bacteria 2025
57 Ga0070667_101281218 3300005367 Bacteria 686
58 Ga0070667_101461340 3300005367 Bacteria 642
59 Ga0070705_100193153 3300005440 Bacteria 1389
60 Ga0070700_100417570 3300005441 Bacteria 1013
61 Ga0070708_100000083 3300005445 Bacteria 61330
62 Ga0070663_100321384 3300005455 Bacteria 1244
63 Ga0070663_102046216 3300005455 Bacteria 516
64 Ga0070678_100388221 3300005456 Bacteria 1210
65 Ga0070662_100036465 3300005457 Bacteria 3479
66 Ga0070662_101066775 3300005457 Bacteria 693
67 Ga0070681_10173842 3300005458 Bacteria 2075
68 Ga0068867_100000391 3300005459 Bacteria 29282
69 Ga0068867_100722910 3300005459 Bacteria 881
70 Ga0070679_100018957 3300005530 Bacteria 6681
71 Ga0068853_100013327 3300005539 Bacteria 6712
72 Ga0068853_100119847 3300005539 Bacteria 2346
73 Ga0068853_100549815 3300005539 Bacteria 1094
74 Ga0068853_101777143 3300005539 Bacteria 598
75 Ga0070672_100071914 3300005543 Bacteria 2753
76 Ga0070672_100869143 3300005543 Bacteria 796
77 Ga0070696_100360652 3300005546 Bacteria 1128
78 Ga0070665_100000744 3300005548 Bacteria 43397
79 Ga0070665_100002444 3300005548 Bacteria 20483
80 Ga0070665_100021958 3300005548 Bacteria 6420
81 Ga0070665_100033955 3300005548 Bacteria 5131
82 Ga0070665_100043150 3300005548 Bacteria 4533
83 Ga0070665_100049119 3300005548 Bacteria 4234
84 Ga0070704_100483662 3300005549 Bacteria 1072
85 Ga0068855_100085443 3300005563 Bacteria 3650
86 Ga0068855_100096809 3300005563 Bacteria 3399
87 Ga0068855_100324870 3300005563 Bacteria 1700
88 Ga0068855_100696335 3300005563 Bacteria 1088
89 Ga0070664_100035738 3300005564 Bacteria 4172
90 Ga0070664_100975742 3300005564 Bacteria 796
91 Ga0068857_100140345 3300005577 Bacteria 2184
92 Ga0068857_101810895 3300005577 Bacteria 598
93 Ga0068854_100089768 3300005578 Bacteria 2284
94 Ga0068854_100528906 3300005578 Bacteria 997
95 Ga0068854_100557438 3300005578 Bacteria 973
96 Ga0068856_100368204 3300005614 Bacteria 1456
97 Ga0068856_100447197 3300005614 Bacteria 1313
98 Ga0068856_100936799 3300005614 Bacteria 885
99 Ga0070702_100600198 3300005615 Bacteria 825
100 Ga0068852_102087501 3300005616 Bacteria 589
101 Ga0068859_100000658 3300005617 Bacteria 34599
102 Ga0068859_100008741 3300005617 Bacteria 10234
103 Ga0068859_100034349 3300005617 Bacteria 5090
104 Ga0068859_100360048 3300005617 Bacteria 1550
105 Ga0068859_100576570 3300005617 Bacteria 1219
106 Ga0068859_101549260 3300005617 Bacteria 732
107 Ga0068859_101777909 3300005617 Bacteria 681
108 Ga0068864_100000125 3300005618 Bacteria 74686
109 Ga0068864_100001114 3300005618 Bacteria 22461
110 Ga0068864_100008551 3300005618 Bacteria 8448
111 Ga0068864_100270715 3300005618 Bacteria 1583
112 Ga0068864_100612293 3300005618 Bacteria 1058
113 Ga0068864_101036376 3300005618 Bacteria 815
114 Ga0068861_100017594 3300005719 Bacteria 5078
115 Ga0068861_100324031 3300005719 Bacteria 1343
116 Ga0068861_100521407 3300005719 Bacteria 1078
117 Ga0068870_10063024 3300005840 Bacteria 1998
118 Ga0068870_11128339 3300005840 Bacteria 565
119 Ga0068870_11415080 3300005840 Bacteria 510
120 Ga0068863_100000066 3300005841 Bacteria 117816
121 Ga0068863_100000119 3300005841 Bacteria 82539
122 Ga0068863_100006603 3300005841 Bacteria 11386
123 Ga0068863_100036368 3300005841 Bacteria 4690
124 Ga0068863_100074860 3300005841 Bacteria 3203
125 Ga0068863_100099103 3300005841 Bacteria 2768
126 Ga0068863_100240404 3300005841 Bacteria 1748
127 Ga0068863_100767573 3300005841 Bacteria 960
128 Ga0068858_100000136 3300005842 Bacteria 77380
129 Ga0068858_100001636 3300005842 Bacteria 22861
130 Ga0068858_100021861 3300005842 Bacteria 5975
131 Ga0068858_100043046 3300005842 Bacteria 4187
132 Ga0068858_100238465 3300005842 Bacteria 1725
133 Ga0068858_100281195 3300005842 Bacteria 1584
134 Ga0068858_100805192 3300005842 Bacteria 917
135 Ga0068858_101830585 3300005842 Bacteria 600
136 Ga0068860_100000507 3300005843 Bacteria 48348
137 Ga0068860_100002642 3300005843 Bacteria 18640
138 Ga0068860_100036580 3300005843 Bacteria 4703
139 Ga0068860_100078297 3300005843 Bacteria 3143
140 Ga0068860_100252610 3300005843 Bacteria 1717
141 Ga0068860_100426902 3300005843 Bacteria 1315
142 Ga0068860_100958106 3300005843 Bacteria 873
143 Ga0068862_100000551 3300005844 Bacteria 39201
144 Ga0068862_100001506 3300005844 Bacteria 21360
145 Ga0068862_100004114 3300005844 Bacteria 12331
146 Ga0068862_100019422 3300005844 Bacteria 5671
147 Ga0068862_100020394 3300005844 Bacteria 5537
148 Ga0068862_100159950 3300005844 Bacteria 2010
149 Ga0068862_100469155 3300005844 Bacteria 1189
150 Ga0068862_100527090 3300005844 Bacteria 1125
151 Ga0081455_10190985 3300005937 Bacteria 1542
152 Ga0070717_10014486 3300006028 Bacteria 6068
153 Ga0075368_10085032 3300006042 Bacteria 1290
154 Ga0075364_10003677 3300006051 Bacteria 8750
155 Ga0075364_11152952 3300006051 Bacteria 526
156 Ga0070712_100311140 3300006175 Bacteria 1278
157 Ga0075367_10014602 3300006178 Bacteria 4253
158 Ga0075369_10005143 3300006186 Bacteria 4873
159 Ga0075366_10019110 3300006195 Bacteria 3960
160 Ga0075366_10040927 3300006195 Bacteria 2742
161 Ga0075366_10210033 3300006195 Bacteria 1185
162 Ga0097621_101603748 3300006237 Bacteria 619
163 Ga0075370_10466454 3300006353 Bacteria 760
164 Ga0068871_100199218 3300006358 Bacteria 1728
165 Ga0068871_100802712 3300006358 Bacteria 868
166 Ga0068871_101324500 3300006358 Bacteria 678
167 Ga0075434_100285818 3300006871 Bacteria 1669
168 Ga0068865_100002000 3300006881 Bacteria 12032
169 Ga0068865_100617916 3300006881 Bacteria 918
170 Ga0097620_100000658 3300006931 Bacteria 34599
171 Ga0097620_100008741 3300006931 Bacteria 10234
172 Ga0097620_100034349 3300006931 Bacteria 5090
173 Ga0097620_100360041 3300006931 Bacteria 1550
174 Ga0097620_100576581 3300006931 Bacteria 1219
175 Ga0097620_101548899 3300006931 Bacteria 732
176 Ga0097620_101778039 3300006931 Bacteria 681
177 Ga0105250_10007609 3300009092 Bacteria 4644
178 Ga0105240_10144540 3300009093 Bacteria 2839
179 Ga0105240_10270228 3300009093 Bacteria 1958
180 Ga0105240_10316167 3300009093 Bacteria 1781
181 Ga0105240_11416047 3300009093 Bacteria 730
182 Ga0111539_10100965 3300009094 Bacteria 3387
183 Ga0111539_12083509 3300009094 Bacteria 658
184 Ga0105245_10044111 3300009098 Bacteria 3979
185 Ga0105245_11175686 3300009098 Bacteria 815
186 Ga0105247_10092384 3300009101 Bacteria 1922
187 Ga0105243_10672565 3300009148 Bacteria 1006
188 Ga0105243_11074835 3300009148 Bacteria 811
189 Ga0105241_10786305 3300009174 Bacteria 875
190 Ga0105248_10002412 3300009177 Bacteria 20747
191 Ga0105248_10005197 3300009177 Bacteria 14344
192 Ga0105248_10092559 3300009177 Bacteria 3405
193 Ga0105248_10281479 3300009177 Bacteria 1872
194 Ga0105248_10348494 3300009177 Bacteria 1667
195 Ga0105248_10446752 3300009177 Bacteria 1457
196 Ga0105248_10541741 3300009177 Bacteria 1313
197 Ga0105248_10780300 3300009177 Bacteria 1078
198 Ga0105248_10817129 3300009177 Bacteria 1052
199 Ga0105248_11056934 3300009177 Bacteria 917
200 Ga0105248_11164959 3300009177 Bacteria 871
201 Ga0105237_10435108 3300009545 Bacteria 1317
202 Ga0105237_10772580 3300009545 Bacteria 967
203 Ga0105238_10047528 3300009551 Bacteria 4326
204 Ga0105238_10537228 3300009551 Bacteria 1173
205 Ga0105238_10905964 3300009551 Bacteria 900
206 Ga0105238_11099049 3300009551 Bacteria 818
207 Ga0105249_10000647 3300009553 Bacteria 31757
208 Ga0105249_10688284 3300009553 Bacteria 1082
209 Ga0105249_10747304 3300009553 Bacteria 1040
210 Ga0105249_10780868 3300009553 Bacteria 1018
211 Ga0105249_11402679 3300009553 Bacteria 771
212 Ga0105249_12838008 3300009553 Bacteria 556
213 Ga0105239_10702040 3300010375 Bacteria 1157
214 Ga0105239_10798067 3300010375 Bacteria 1082
215 Ga0105246_10210578 3300011119 Bacteria 1517
216 Ga0157370_10455023 3300013104 Bacteria 1177
217 Ga0157370_10473849 3300013104 Bacteria 1150
218 Ga0157369_10410770 3300013105 Bacteria 1404
219 Ga0157374_10484561 3300013296 Bacteria 1240
220 Ga0157374_10921955 3300013296 Bacteria 891
221 Ga0163162_10166096 3300013306 Bacteria 2331
222 Ga0163162_10296137 3300013306 Bacteria 1750
223 Ga0163162_11869829 3300013306 Bacteria 687
224 Ga0157375_10059737 3300013308 Bacteria 3778
225 Ga0157375_10088010 3300013308 Bacteria 3160
226 Ga0157375_10672011 3300013308 Bacteria 1191
227 Ga0157375_10976234 3300013308 Bacteria 988
228 Ga0157375_11453498 3300013308 Bacteria 808
229 Ga0157375_11455333 3300013308 Bacteria 808
230 Ga0157375_13039338 3300013308 Bacteria 560
231 Ga0163163_10000747 3300014325 Bacteria 27697
232 Ga0163163_10035635 3300014325 Bacteria 4828
233 Ga0163163_10036040 3300014325 Bacteria 4803
234 Ga0163163_10086268 3300014325 Bacteria 3148
235 Ga0163163_10086973 3300014325 Bacteria 3135
236 Ga0163163_10284725 3300014325 Bacteria 1705
237 Ga0163163_11501748 3300014325 Bacteria 735
238 Ga0157377_10133223 3300014745 Bacteria 1520
239 Ga0157379_10001591 3300014968 Bacteria 18725
240 Ga0157379_10006169 3300014968 Bacteria 10322
241 Ga0157379_10009800 3300014968 Bacteria 8348
242 Ga0157379_10099588 3300014968 Bacteria 2609
243 Ga0157379_10529441 3300014968 Bacteria 1095
244 Ga0157376_11889106 3300014969 Bacteria 634
245 Ga0182007_10066676 3300015262 Bacteria 1179
246 Ga0163161_11617111 3300017792 Bacteria 572
247 Ga0206356_10061775 3300020070 Bacteria 797
248 Ga0213874_10026944 3300021377 Bacteria 1632
249 Ga0213876_10017428 3300021384 Bacteria 3793
250 Ga0209148_1027686 3300025254 Bacteria 870
251 Ga0209676_1000308 3300025292 Bacteria 95847
252 Ga0209676_1000320 3300025292 Bacteria 93515
253 Ga0209051_1006510 3300025303 Bacteria 6567
254 Ga0209257_1000338 3300025304 Bacteria 97721
255 Ga0207697_10230297 3300025315 Bacteria 818
256 Ga0207696_1014612 3300025711 Bacteria 2686
257 Ga0207710_10163347 3300025900 Bacteria 1086
258 Ga0207710_10316804 3300025900 Bacteria 790
259 Ga0207688_10210727 3300025901 Bacteria 1167
260 Ga0207688_10326514 3300025901 Bacteria 942
261 Ga0207688_10353359 3300025901 Bacteria 906
262 Ga0207645_10163495 3300025907 Bacteria 1457
263 Ga0207643_10126958 3300025908 Bacteria 1515
264 Ga0207643_11042518 3300025908 Bacteria 528
265 Ga0207705_10137554 3300025909 Bacteria 1822
266 Ga0207705_10850172 3300025909 Bacteria 707
267 Ga0207707_10519370 3300025912 Bacteria 1014
268 Ga0207695_10002610 3300025913 Bacteria 26389
269 Ga0207695_10007189 3300025913 Bacteria 14236
270 Ga0207695_10009967 3300025913 Bacteria 11671
271 Ga0207695_10106175 3300025913 Bacteria 2794
272 Ga0207695_11588306 3300025913 Bacteria 535
273 Ga0207671_10440852 3300025914 Bacteria 1037
274 Ga0207671_10973424 3300025914 Bacteria 669
275 Ga0207693_10322962 3300025915 Bacteria 1208
276 Ga0207693_11409298 3300025915 Bacteria 517
277 Ga0207660_10363512 3300025917 Bacteria 1161
278 Ga0207657_10206326 3300025919 Bacteria 1579
279 Ga0207649_10593911 3300025920 Bacteria 851
280 Ga0207649_10817524 3300025920 Bacteria 728
281 Ga0207652_10145632 3300025921 Bacteria 2120
282 Ga0207681_10008537 3300025923 Bacteria 6255
283 Ga0207681_10062890 3300025923 Bacteria 2557
284 Ga0207681_10651016 3300025923 Bacteria 873
285 Ga0207681_11008640 3300025923 Bacteria 698
286 Ga0207681_11804041 3300025923 Bacteria 510
287 Ga0207694_10290496 3300025924 Bacteria 1344
288 Ga0207694_10726189 3300025924 Bacteria 838
289 Ga0207694_10752463 3300025924 Bacteria 823
290 Ga0207650_10000016 3300025925 Bacteria 361958
291 Ga0207650_10021394 3300025925 Bacteria 4571
292 Ga0207650_10106996 3300025925 Bacteria 2160
293 Ga0207650_10170200 3300025925 Bacteria 1731
294 Ga0207650_10382861 3300025925 Bacteria 1162
295 Ga0207650_10611340 3300025925 Bacteria 917
296 Ga0207659_10011417 3300025926 Bacteria 5611
297 Ga0207644_10004412 3300025931 Bacteria 9129
298 Ga0207644_10457928 3300025931 Bacteria 1048
299 Ga0207644_10685221 3300025931 Bacteria 854
300 Ga0207690_10000737 3300025932 Bacteria 21081
301 Ga0207706_10066738 3300025933 Bacteria 3166
302 Ga0207706_10639466 3300025933 Bacteria 912
303 Ga0207670_11026772 3300025936 Bacteria 694
304 Ga0207704_10001149 3300025938 Bacteria 11769
305 Ga0207704_10475201 3300025938 Bacteria 1002
306 Ga0207665_10968757 3300025939 Bacteria 676
307 Ga0207691_10117860 3300025940 Bacteria 2355
308 Ga0207691_10191749 3300025940 Bacteria 1782
309 Ga0207711_10006764 3300025941 Bacteria 9641
310 Ga0207711_10011270 3300025941 Bacteria 7429
311 Ga0207711_10057519 3300025941 Bacteria 3343
312 Ga0207711_10150542 3300025941 Bacteria 2099
313 Ga0207711_10282445 3300025941 Bacteria 1529
314 Ga0207711_10298732 3300025941 Bacteria 1485
315 Ga0207711_10545059 3300025941 Bacteria 1082
316 Ga0207711_10723374 3300025941 Bacteria 928
317 Ga0207711_10888085 3300025941 Bacteria 829
318 Ga0207711_11192252 3300025941 Bacteria 703
319 Ga0207711_11503358 3300025941 Bacteria 616
320 Ga0207689_10000270 3300025942 Bacteria 46976
321 Ga0207689_10234791 3300025942 Bacteria 1516
322 Ga0207689_10404155 3300025942 Bacteria 1139
323 Ga0207661_10365028 3300025944 Bacteria 1305
324 Ga0207679_10042261 3300025945 Bacteria 3275
325 Ga0207679_10113372 3300025945 Bacteria 2144
326 Ga0207679_10518780 3300025945 Bacteria 1065
327 Ga0207667_10129238 3300025949 Bacteria 2602
328 Ga0207667_10142666 3300025949 Bacteria 2466
329 Ga0207667_10291033 3300025949 Bacteria 1669
330 Ga0207667_10597305 3300025949 Bacteria 1113
331 Ga0207667_10641522 3300025949 Bacteria 1068
332 Ga0207667_10928144 3300025949 Bacteria 861
333 Ga0207651_10096418 3300025960 Bacteria 2181
334 Ga0207712_10019237 3300025961 Bacteria 4457
335 Ga0207712_10500857 3300025961 Bacteria 1038
336 Ga0207712_10986534 3300025961 Bacteria 747
337 Ga0207712_11213678 3300025961 Bacteria 673
338 Ga0207712_11552942 3300025961 Bacteria 593
339 Ga0207668_10000019 3300025972 Bacteria 152108
340 Ga0207668_10001481 3300025972 Bacteria 13761
341 Ga0207668_10002967 3300025972 Bacteria 9948
342 Ga0207668_10067315 3300025972 Bacteria 2542
343 Ga0207668_10131840 3300025972 Bacteria 1909
344 Ga0207668_10141984 3300025972 Bacteria 1848
345 Ga0207640_10895196 3300025981 Bacteria 775
346 Ga0207658_10000384 3300025986 Bacteria 43187
347 Ga0207658_10005402 3300025986 Bacteria 8767
348 Ga0207658_10016890 3300025986 Bacteria 5023
349 Ga0207658_10016937 3300025986 Bacteria 5017
350 Ga0207658_10488657 3300025986 Bacteria 1095
351 Ga0207658_10587660 3300025986 Bacteria 999
352 Ga0207658_10983785 3300025986 Bacteria 769
353 Ga0207658_11317083 3300025986 Bacteria 660
354 Ga0207677_10078840 3300026023 Bacteria 2353
355 Ga0207677_11610545 3300026023 Bacteria 601
356 Ga0207703_10000065 3300026035 Bacteria 126087
357 Ga0207703_10000884 3300026035 Bacteria 29465
358 Ga0207703_10004121 3300026035 Bacteria 12002
359 Ga0207703_10010902 3300026035 Bacteria 7085
360 Ga0207703_10175564 3300026035 Bacteria 1888
361 Ga0207703_10495807 3300026035 Bacteria 1146
362 Ga0207639_10009353 3300026041 Bacteria 6757
363 Ga0207639_10095343 3300026041 Bacteria 2391
364 Ga0207639_12287668 3300026041 Bacteria 502
365 Ga0207678_10872845 3300026067 Bacteria 795
366 Ga0207678_11046240 3300026067 Bacteria 723
367 Ga0207678_11552351 3300026067 Bacteria 584
368 Ga0207708_10095437 3300026075 Bacteria 2297
369 Ga0207708_10509353 3300026075 Bacteria 1010
370 Ga0207702_10196376 3300026078 Bacteria 1868
371 Ga0207702_12451541 3300026078 Bacteria 508
372 Ga0207641_10000011 3300026088 Bacteria 384362
373 Ga0207641_10029739 3300026088 Bacteria 4518
374 Ga0207641_10031038 3300026088 Bacteria 4430
375 Ga0207641_10033654 3300026088 Bacteria 4257
376 Ga0207641_10051707 3300026088 Bacteria 3479
377 Ga0207641_10151392 3300026088 Bacteria 2101
378 Ga0207641_10848983 3300026088 Bacteria 905
379 Ga0207641_11879215 3300026088 Bacteria 600
380 Ga0207641_12069509 3300026088 Bacteria 570
381 Ga0207648_10003469 3300026089 Bacteria 16532
382 Ga0207648_11204150 3300026089 Bacteria 711
383 Ga0207648_11776398 3300026089 Bacteria 578
384 Ga0207676_10000148 3300026095 Bacteria 61016
385 Ga0207676_10001859 3300026095 Bacteria 15463
386 Ga0207676_10002341 3300026095 Bacteria 13555
387 Ga0207676_10212164 3300026095 Bacteria 1718
388 Ga0207676_10244399 3300026095 Bacteria 1612
389 Ga0207676_10245949 3300026095 Bacteria 1607
390 Ga0207674_10010555 3300026116 Bacteria 10454
391 Ga0207674_11324584 3300026116 Bacteria 689
392 Ga0207675_100035652 3300026118 Bacteria 4640
393 Ga0207683_10027153 3300026121 Bacteria 4947
394 Ga0207683_10402481 3300026121 Bacteria 1259
395 Ga0207698_11438426 3300026142 Bacteria 704
396 Ga0209999_1089808 3300027543 Bacteria 595
397 Ga0209813_10048916 3300027866 Bacteria 1314
398 Ga0209974_10411414 3300027876 Bacteria 532
399 Ga0268266_10000611 3300028379 Bacteria 48682
400 Ga0268266_10005978 3300028379 Bacteria 11242
401 Ga0268266_10017036 3300028379 Bacteria 6205
402 Ga0268266_10026093 3300028379 Bacteria 4971
403 Ga0268266_10033212 3300028379 Bacteria 4388
404 Ga0268266_10133005 3300028379 Bacteria 2226
405 Ga0268265_10000798 3300028380 Bacteria 29969
406 Ga0268265_10022102 3300028380 Bacteria 4465
407 Ga0268265_10082303 3300028380 Bacteria 2545
408 Ga0268265_10212745 3300028380 Bacteria 1686
409 Ga0268265_10680907 3300028380 Bacteria 991
410 Ga0268265_12169563 3300028380 Bacteria 562
411 Ga0268264_10000014 3300028381 Bacteria 509962
412 Ga0268264_10000207 3300028381 Bacteria 120086
413 Ga0268264_10010578 3300028381 Bacteria 7627
414 Ga0268264_10042818 3300028381 Bacteria 3749
415 Ga0268264_10043016 3300028381 Bacteria 3741
416 Ga0268264_10061419 3300028381 Bacteria 3152
417 Ga0268264_11286676 3300028381 Bacteria 741
418 Ga0265334_10008247 3300028573 Bacteria 4435
419 Ga0265334_10095516 3300028573 Bacteria 1081
420 Ga0265334_10273382 3300028573 Bacteria 580
421 Ga0307517_10002922 3300028786 Bacteria 27037
422 Ga0307517_10119287 3300028786 Bacteria 1959
423 Ga0265338_10044452 3300028800 Bacteria 4101
424 Ga0265338_10203015 3300028800 Bacteria 1493
425 Ga0265760_10046378 3300031090 Bacteria 1304
426 Ga0265331_10192190 3300031250 Bacteria 921
427 Ga0265327_10129293 3300031251 Bacteria 1190
428 Ga0307513_10000541 3300031456 Bacteria 54065
429 Ga0307513_10004541 3300031456 Bacteria 18519
430 Ga0307513_10006209 3300031456 Bacteria 15662
431 Ga0307513_10670897 3300031456 Bacteria 743
432 Ga0307508_10744489 3300031616 Bacteria 593
433 Ga0307508_10809242 3300031616 Bacteria 555
434 Ga0316575_10082097 3300031665 Bacteria 1300
435 Ga0316579_10628966 3300031691 Bacteria 519
436 Ga0265314_10204623 3300031711 Bacteria 1164
437 Ga0316576_10203706 3300031727 Bacteria 1490
438 Ga0316578_10306143 3300031728 Bacteria 949
439 Ga0307516_10000030 3300031730 Bacteria 159694
440 Ga0316577_10503502 3300031733 Bacteria 688
441 Ga0307407_10264265 3300031903 Bacteria 1185
442 Ga0307412_10311132 3300031911 Bacteria 1249
443 Ga0307415_100674173 3300032126 Bacteria 930
444 Ga0316583_10052072 3300032133 Bacteria 1440
445 Ga0316585_10006969 3300032137 Bacteria 3244
446 Ga0316593_10026979 3300032168 Bacteria 1839
447 Ga0307510_10010004 3300033180 Bacteria 11271
448 Ga0316592_1053995 3300033524 Bacteria 899
449 Ga0316588_1002162 3300033528 Bacteria 3385
450 Ga0316596_1060058 3300033541 Bacteria 1014
451 Ga0373944_0075747 3300035089 Bacteria 1103
452 Ga0373952_0135334 3300035092 Bacteria 680
453 Ga0373936_0000661 3300035113 Bacteria 11938
454 Ga0373939_0306334 3300035114 Bacteria 635
455 Ga0373945_0228785 3300035116 Bacteria 780
456 Ga0373946_0772685 3300035171 Bacteria 505
457 Ga0373955_0735403 3300035172 Bacteria 606
458 Ga0373955_0880521 3300035172 Bacteria 551
459 Ga0373931_0664428 3300035691 Bacteria 686
460 Ga0373935_0045430 3300035692 Bacteria 2772
461 Ga0373935_0210569 3300035692 Bacteria 1347
462 Ga0373927_0001653 3300035695 Bacteria 16672
463 Ga0373927_0419978 3300035695 Bacteria 883
464 Ga0373933_0929132 3300035724 Bacteria 573
465 Ga0373947_0239020 3300035725 Bacteria 1198
466 Ga0373937_0663710 3300036401 Bacteria 988
467 Ga0373937_0702585 3300036401 Bacteria 958
468 Ga0373937_2029626 3300036401 Bacteria 521
469 Ga0316582_0365070 3300036647 Bacteria 993
470 Ga0316584_0082675 3300036712 Bacteria 2405
471 Ga0373925_0000049 3300037068 Bacteria 128065
472 Ga0373925_1596390 3300037068 Bacteria 533
473 Ga0395899_0003271 3300037312 Bacteria 12846
474 Ga0395899_0106800 3300037312 Bacteria 2015
475 Ga0395899_0167832 3300037312 Bacteria 1547
476 Ga0395900_0013143 3300037418 Bacteria 8461
477 Ga0395900_0237473 3300037418 Bacteria 1830
478 Ga0395900_0362792 3300037418 Bacteria 1420
479 Ga0395900_0448637 3300037418 Bacteria 1246
480 Ga0395900_1854096 3300037418 Bacteria 513
481 Ga0395898_0007710 3300037466 Bacteria 11430
482 Ga0395898_0097502 3300037466 Bacteria 2823
483 Ga0395898_0258051 3300037466 Bacteria 1662
484 Ga0395898_0424126 3300037466 Bacteria 1267
485 Ga0395905_0004961 3300037471 Bacteria 13716
486 Ga0395905_0097470 3300037471 Bacteria 2761
487 Ga0395905_0260774 3300037471 Bacteria 1618
488 Ga0395905_0280129 3300037471 Bacteria 1553
489 Ga0316581_0216814 3300037588 Bacteria 588
490 Ga0395901_0000021 3300038443 Bacteria 307734
491 Ga0395901_0266167 3300038443 Bacteria 1783
492 Ga0395901_0631373 3300038443 Bacteria 1077
493 Ga0436365_1445717 3300039437 Bacteria 836
494 Ga0436360_0053752 3300039438 Bacteria 809
495 Ga0436363_1219245 3300039450 Bacteria 943
496 Ga0436363_1424271 3300039450 Bacteria 1722
497 Ga0451789_0017912 3300041443 Bacteria 728
498 Ga0451807_2521828 3300041486 Bacteria 678
499 Ga0451845_0570884 3300041501 Bacteria 793
500 Ga0451847_0447433 3300041503 Bacteria 535
501 Ga0451843_0800999 3300041509 Bacteria 535
502 Ga0439455_0253308 3300042012 Bacteria 516
503 Ga0466961_0739925 3300044693 Bacteria 588
504 Ga0466959_0140908 3300045049 Bacteria 1704
505 Ga0495590_0001271 3300046457 Bacteria 10961
506 Ga0495638_0000185 3300046460 Bacteria 95220
507 Ga0495638_0001213 3300046460 Bacteria 24573
508 Ga0495638_0513788 3300046460 Bacteria 601
509 Ga0495664_0351076 3300046477 Bacteria 888
510 Ga0495594_0408096 3300046499 Bacteria 773
511 Ga0495583_0090078 3300046506 Bacteria 1322
512 Ga0495606_0242676 3300046507 Bacteria 1004
513 Ga0495606_0534817 3300046507 Bacteria 586
514 Ga0495610_0001542 3300046512 Bacteria 20292
515 Ga0495610_0002504 3300046512 Bacteria 15353
516 Ga0495620_0043942 3300046515 Bacteria 1944
517 Ga0495631_0001061 3300046518 Bacteria 17065
518 Ga0495632_0196110 3300046519 Bacteria 921
519 Ga0495637_0061700 3300046520 Bacteria 1536
520 Ga0495643_0162821 3300046522 Bacteria 1096
521 Ga0495648_0001143 3300046524 Bacteria 26818
522 Ga0495642_0009268 3300046528 Bacteria 3769
523 Ga0495642_0181114 3300046528 Bacteria 917
524 Ga0495654_0041442 3300046530 Bacteria 2290
525 Ga0495654_0092590 3300046530 Bacteria 1401
526 Ga0495587_0313837 3300046536 Bacteria 876
527 Ga0495598_0230819 3300046537 Bacteria 679
528 Ga0495609_0221746 3300046538 Bacteria 785
529 Ga0495597_0000940 3300046542 Bacteria 22494
530 Ga0495597_0016383 3300046542 Bacteria 3498
531 Ga0495622_0000495 3300046557 Bacteria 24692
532 Ga0495668_0000196 3300046616 Bacteria 89097
533 Ga0495668_0032996 3300046616 Bacteria 2910
534 Ga0495668_0560261 3300046616 Bacteria 631
535 Ga0495668_0766457 3300046616 Bacteria 534
536 Ga0495611_0003249 3300046648 Bacteria 7188
537 Ga0495611_0137916 3300046648 Bacteria 1139
538 Ga0495625_0032672 3300046660 Bacteria 3856
539 Ga0495625_0057282 3300046660 Bacteria 2772
540 Ga0495625_0165352 3300046660 Bacteria 1479
541 Ga0495625_0178490 3300046660 Bacteria 1414
542 Ga0495625_0273602 3300046660 Bacteria 1089
543 Ga0495623_0617671 3300046679 Bacteria 562
544 Ga0495669_0000081 3300046684 Bacteria 63806
545 Ga0495669_0335451 3300046684 Bacteria 730
546 Ga0495624_0347427 3300046690 Bacteria 892
547 Ga0495589_0028386 3300046794 Bacteria 2824
548 Ga0495660_0294120 3300046810 Bacteria 738
549 Ga0495660_0396677 3300046810 Bacteria 605
550 Ga0495581_0199504 3300047315 Bacteria 1170
551 Ga0495636_0066666 3300047318 Bacteria 1531
552 Ga0495672_0078397 3300047320 Bacteria 1848
553 Ga0495677_0153499 3300047445 Bacteria 887
554 Ga0495673_0000818 3300047469 Bacteria 29209
555 Ga0495681_0141055 3300047470 Bacteria 1018
556 Ga0495686_0001281 3300047472 Bacteria 28417
557 Ga0495686_0041270 3300047472 Bacteria 2938
558 Ga0495615_0162049 3300048090 Bacteria 672
559 Ga0496100_1077026 3300048903 Bacteria 633
560 Ga0496102_0002509 3300048905 Bacteria 15658
561 Ga0496102_0073352 3300048905 Bacteria 3146
562 Ga0496102_1582765 3300048905 Bacteria 574
563 Ga0496103_0024487 3300048906 Bacteria 3645
564 Ga0496103_0160165 3300048906 Bacteria 1443
565 Ga0496104_0633865 3300048907 Bacteria 978
566 Ga0496106_0252465 3300048909 Bacteria 1410
567 Ga0496106_0534374 3300048909 Bacteria 941
568 Ga0496106_1576793 3300048909 Bacteria 503
569 Ga0496108_0007812 3300048911 Bacteria 8667
570 Ga0496108_0552258 3300048911 Bacteria 1005
571 Ga0496108_0557627 3300048911 Bacteria 999
572 Ga0496109_0050984 3300048912 Bacteria 3769
573 Ga0496109_0072857 3300048912 Bacteria 3156
574 Ga0496109_0950802 3300048912 Bacteria 797
575 Ga0496111_0787805 3300048914 Bacteria 688
576 Ga0496112_0008645 3300048915 Bacteria 9130
577 Ga0496112_0577307 3300048915 Bacteria 1057
578 Ga0496112_1406924 3300048915 Bacteria 612
579 Ga0496113_0024190 3300048916 Bacteria 4314
580 Ga0496114_1569067 3300048917 Bacteria 546
581 Ga0496115_0002000 3300048918 Bacteria 14571
582 Ga0496115_0328711 3300048918 Bacteria 1249
583 Ga0496121_0315459 3300048924 Bacteria 1055
584 Ga0496124_0006584 3300048927 Bacteria 12614
585 Ga0496125_0004898 3300048928 Bacteria 15174
586 Ga0496126_0016290 3300048929 Bacteria 7439
587 Ga0495678_002464 3300049459 Bacteria 12517
588 Ga0501319_033485 3300049535 Bacteria 502
589 Ga0501321_056868 3300049537 Bacteria 583
590 Ga0501323_058899 3300049539 Bacteria 596
591 Ga0501032_0062232 3300049569 Bacteria 2501
592 Ga0501033_0009831 3300049570 Bacteria 7342
593 Ga0501033_0034390 3300049570 Bacteria 3802
594 Ga0501034_0010729 3300049571 Bacteria 9514
595 Ga0501034_0014620 3300049571 Bacteria 8082
596 Ga0501036_0005690 3300049572 Bacteria 10113
597 Ga0501037_0279183 3300049573 Bacteria 1164
598 Ga0501039_0282617 3300049575 Bacteria 1304
599 Ga0501041_0219241 3300049577 Bacteria 1194
600 Ga0501043_0003372 3300049579 Bacteria 13153
601 Ga0501046_0798038 3300049580 Bacteria 662
602 Ga0501047_0006419 3300049581 Bacteria 11065
603 Ga0501047_0023674 3300049581 Bacteria 5896
604 Ga0501047_0041638 3300049581 Bacteria 4439
605 Ga0501047_0233610 3300049581 Bacteria 1691
606 Ga0501047_0917077 3300049581 Bacteria 689
607 Ga0501047_1453281 3300049581 Bacteria 501
608 Ga0501067_0135901 3300049583 Bacteria 1369
609 Ga0501069_0262305 3300049585 Bacteria 1009
610 Ga0501070_0006572 3300049586 Bacteria 9896
611 Ga0501072_0063615 3300049588 Bacteria 2910
612 Ga0501073_0080545 3300049589 Bacteria 2265
613 Ga0501073_1026257 3300049589 Bacteria 567
614 Ga0501074_0015079 3300049590 Bacteria 5622
615 Ga0501074_0160556 3300049590 Bacteria 1605
616 Ga0501076_0379193 3300049592 Bacteria 1162
617 Ga0501257_005509 3300049686 Bacteria 2793
618 Ga0501080_0170167 3300049742 Bacteria 2010
619 Ga0501083_0006235 3300049744 Bacteria 8459
620 Ga0501083_0288143 3300049744 Bacteria 1068
621 Ga0501241_165563 3300049758 Bacteria 517
622 Ga0501035_0000477 3300049822 Bacteria 44891
623 Ga0501035_0158137 3300049822 Bacteria 1963
624 Ga0501035_0957946 3300049822 Bacteria 675
625 Ga0501044_0000960 3300049823 Bacteria 34653
626 Ga0501044_0006907 3300049823 Bacteria 12498
627 Ga0501044_0837799 3300049823 Bacteria 797
628 Ga0501044_0944010 3300049823 Bacteria 736
629 Ga0501045_0711244 3300049824 Bacteria 741
630 nmdc:mga00v17_2978_c1 3300050491 Bacteria 8691
631 nmdc:mga0k408_240195_c1 3300050493 Bacteria 1082
632 nmdc:mga0k408_29733_c1 3300050493 Bacteria 1604
633 nmdc:mga0k408_94172_c1 3300050493 Bacteria 1761
634 nmdc:mga06z11_55883_c1 3300050494 Bacteria 2040
635 nmdc:mga04h51_79017_c1 3300050495 Bacteria 1164
636 nmdc:mga07m45_226460_c1 3300050496 Bacteria 1088
637 nmdc:mga07m45_759303_c1 3300050496 Bacteria 557
638 nmdc:mga0a205_417460_c1 3300050515 Bacteria 830
639 nmdc:mga0sz30_131077_c1 3300050516 Bacteria 1105
640 nmdc:mga0sz30_279806_c1 3300050516 Bacteria 743
641 Ga0495601_0934764 3300053077 Bacteria 547
642 Ga0500635_0000258 3300053080 Bacteria 21708
643 Ga0500578_0001019 3300053086 Bacteria 30808
644 Ga0500578_0177525 3300053086 Bacteria 1314
645 Ga0500643_000903 3300053087 Bacteria 18807
646 Ga0500643_078768 3300053087 Bacteria 907
647 Ga0500644_0000239 3300053088 Bacteria 31347
648 Ga0500644_0492032 3300053088 Bacteria 539
649 Ga0500646_0113682 3300053090 Bacteria 863
650 Ga0500651_0009280 3300053093 Bacteria 5835
651 Ga0500566_0013864 3300053094 Bacteria 4741
652 Ga0500641_0000638 3300053096 Bacteria 12658
653 Ga0500641_0001268 3300053096 Bacteria 8966
654 Ga0500650_0186401 3300053098 Bacteria 949
655 Ga0500555_046364 3300053103 Bacteria 1198
656 Ga0500556_0087657 3300053104 Bacteria 1185
657 Ga0500557_027599 3300053105 Bacteria 1689
658 Ga0500562_000838 3300053108 Bacteria 7439
659 Ga0500562_005366 3300053108 Bacteria 3219
660 Ga0500562_064221 3300053108 Bacteria 988
661 Ga0500569_009105 3300053109 Bacteria 2297
662 Ga0500594_0000224 3300053118 Bacteria 13802
663 Ga0500595_060299 3300053119 Bacteria 1148
664 Ga0500607_029942 3300053121 Bacteria 3004
665 Ga0500608_000202 3300053122 Bacteria 23754
666 Ga0500608_002769 3300053122 Bacteria 6458
667 Ga0500614_013145 3300053123 Bacteria 1815
668 Ga0500642_0356595 3300053130 Bacteria 648
669 Ga0500658_0171311 3300053134 Bacteria 986
670 Ga0500559_0021200 3300053136 Bacteria 2752
671 Ga0500559_0070649 3300053136 Bacteria 1571
672 Ga0500564_000506 3300053138 Bacteria 11497
673 Ga0500564_350826 3300053138 Bacteria 549
674 Ga0500577_0110265 3300053142 Bacteria 1135
675 Ga0500590_016265 3300053148 Bacteria 3846
676 Ga0500603_004385 3300053150 Bacteria 3024
677 Ga0500604_0015784 3300053151 Bacteria 2073
678 Ga0500616_0032840 3300053153 Bacteria 2836
679 Ga0500616_0034126 3300053153 Bacteria 2773
680 Ga0500616_0147160 3300053153 Bacteria 1094
681 Ga0500619_016052 3300053154 Bacteria 2052
682 Ga0500619_101560 3300053154 Bacteria 976
683 Ga0500620_117008 3300053155 Bacteria 934
684 Ga0500622_0001017 3300053156 Bacteria 23547
685 Ga0500622_0007239 3300053156 Bacteria 6318
686 Ga0500622_0007501 3300053156 Bacteria 6191
687 Ga0500622_0035247 3300053156 Bacteria 2619
688 Ga0500622_0180011 3300053156 Bacteria 977
689 Ga0500624_022231 3300053157 Bacteria 1030
690 Ga0500634_0242761 3300053161 Bacteria 755
691 Ga0500638_006452 3300053162 Bacteria 4803
692 Ga0500639_196769 3300053163 Bacteria 871
693 Ga0500636_0030429 3300053177 Bacteria 3192
694 Ga0500637_0011924 3300053178 Bacteria 4514
695 Ga0500637_0069871 3300053178 Bacteria 2019
696 Ga0500576_177844 3300053725 Bacteria 755
697 Ga0500625_040366 3300053729 Bacteria 2196
698 Ga0500645_000199 3300053730 Bacteria 46484
699 Ga0500645_002806 3300053730 Bacteria 7508
700 Ga0500596_007741 3300053735 Bacteria 1743
701 Ga0501084_0006768 3300054114 Bacteria 9421
702 Ga0500661_049846 3300055283 Bacteria 748
703 Ga0500661_068000 3300055283 Bacteria 649
704 Ga0587073_0121262 3300059492 Bacteria 706
705 Ga0587092_113200 3300059512 Bacteria 572
706 Ga0587067_234698 3300059640 Bacteria 503
707 Ga0501082_0047765 3300060353 Bacteria 3688

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0034390 Ga0501033_0034390_965_1297 104
2 3300049571 Ga0501034_0010729 Ga0501034_0010729_1806_2138 104
3 3300049572 Ga0501036_0005690 Ga0501036_0005690_1235_1567 104
4 3300049575 Ga0501039_0282617 Ga0501039_0282617_823_1155 104
5 3300049579 Ga0501043_0003372 Ga0501043_0003372_7409_7741 104
6 3300049581 Ga0501047_1453281 Ga0501047_1453281_129_461 104
7 3300049585 Ga0501069_0262305 Ga0501069_0262305_21_353 104
8 3300049586 Ga0501070_0006572 Ga0501070_0006572_6103_6435 104
9 3300049589 Ga0501073_1026257 Ga0501073_1026257_15_347 104
10 3300049590 Ga0501074_0015079 Ga0501074_0015079_3668_4000 104
11 3300049822 Ga0501035_0000477 Ga0501035_0000477_21752_22084 104
12 3300005293 Ga0065715_10134927 Ga0065715_101349273 106
13 3300005328 Ga0070676_10178648 Ga0070676_101786482 106
14 3300005330 Ga0070690_100291837 Ga0070690_1002918371 106
15 3300005331 Ga0070670_100000456 Ga0070670_1000004566 106
16 3300005331 Ga0070670_100042264 Ga0070670_1000422646 106
17 3300005334 Ga0068869_100068449 Ga0068869_1000684495 106
18 3300005334 Ga0068869_101530919 Ga0068869_1015309191 106
19 3300005338 Ga0068868_100100641 Ga0068868_1001006412 106
20 3300005340 Ga0070689_100771642 Ga0070689_1007716422 106
21 3300005347 Ga0070668_100094897 Ga0070668_1000948972 106
22 3300005347 Ga0070668_100099959 Ga0070668_1000999595 106
23 3300005347 Ga0070668_102019917 Ga0070668_1020199171 106
24 3300005353 Ga0070669_100072981 Ga0070669_1000729815 106
25 3300005353 Ga0070669_100434927 Ga0070669_1004349272 106
26 3300005354 Ga0070675_100137670 Ga0070675_1001376703 106
27 3300005354 Ga0070675_101344275 Ga0070675_1013442751 106
28 3300005355 Ga0070671_100655497 Ga0070671_1006554971 106
29 3300005365 Ga0070688_101028237 Ga0070688_1010282371 106
30 3300005365 Ga0070688_101471346 Ga0070688_1014713461 106
31 3300005367 Ga0070667_100018158 Ga0070667_1000181588 106
32 3300005367 Ga0070667_101281218 Ga0070667_1012812182 106
33 3300005440 Ga0070705_100193153 Ga0070705_1001931532 106
34 3300005441 Ga0070700_100417570 Ga0070700_1004175702 106
35 3300005455 Ga0070663_100321384 Ga0070663_1003213842 106
36 3300005455 Ga0070663_102046216 Ga0070663_1020462161 106
37 3300005459 Ga0068867_100000391 Ga0068867_1000003918 106
38 3300005543 Ga0070672_100071914 Ga0070672_1000719145 106
39 3300005543 Ga0070672_100869143 Ga0070672_1008691433 106
40 3300005546 Ga0070696_100360652 Ga0070696_1003606522 106
41 3300005548 Ga0070665_100049119 Ga0070665_1000491193 106
42 3300005549 Ga0070704_100483662 Ga0070704_1004836621 106
43 3300005563 Ga0068855_100696335 Ga0068855_1006963352 106
44 3300005564 Ga0070664_100975742 Ga0070664_1009757421 106
45 3300005577 Ga0068857_100140345 Ga0068857_1001403454 106
46 3300005578 Ga0068854_100089768 Ga0068854_1000897682 106
47 3300005578 Ga0068854_100528906 Ga0068854_1005289061 106
48 3300005615 Ga0070702_100600198 Ga0070702_1006001981 106
49 3300005617 Ga0068859_100008741 Ga0068859_1000087418 106
50 3300005617 Ga0068859_100576570 Ga0068859_1005765702 106
51 3300005617 Ga0068859_101549260 Ga0068859_1015492601 106
52 3300005618 Ga0068864_100008551 Ga0068864_1000085512 106
53 3300005719 Ga0068861_100017594 Ga0068861_1000175942 106
54 3300005719 Ga0068861_100324031 Ga0068861_1003240312 106
55 3300005840 Ga0068870_10063024 Ga0068870_100630243 106
56 3300005840 Ga0068870_11128339 Ga0068870_111283392 106
57 3300005841 Ga0068863_100036368 Ga0068863_1000363688 106
58 3300005841 Ga0068863_100074860 Ga0068863_1000748602 106
59 3300005841 Ga0068863_100099103 Ga0068863_1000991035 106
60 3300005842 Ga0068858_100001636 Ga0068858_10000163621 106
61 3300005842 Ga0068858_100281195 Ga0068858_1002811953 106
62 3300005842 Ga0068858_101830585 Ga0068858_1018305851 106
63 3300005843 Ga0068860_100002642 Ga0068860_10000264215 106
64 3300005843 Ga0068860_100078297 Ga0068860_1000782977 106
65 3300005843 Ga0068860_100426902 Ga0068860_1004269022 106
66 3300005844 Ga0068862_100001506 Ga0068862_1000015062 106
67 3300005844 Ga0068862_100020394 Ga0068862_1000203943 106
68 3300005844 Ga0068862_100469155 Ga0068862_1004691553 106
69 3300005937 Ga0081455_10190985 Ga0081455_101909851 106
70 3300006871 Ga0075434_100285818 Ga0075434_1002858182 106
71 3300006931 Ga0097620_100008741 Ga0097620_1000087418 106
72 3300006931 Ga0097620_100576581 Ga0097620_1005765812 106
73 3300006931 Ga0097620_101548899 Ga0097620_1015488992 106
74 3300009094 Ga0111539_10100965 Ga0111539_101009654 106
75 3300009094 Ga0111539_12083509 Ga0111539_120835092 106
76 3300009098 Ga0105245_10044111 Ga0105245_100441112 106
77 3300009101 Ga0105247_10092384 Ga0105247_100923843 106
78 3300009177 Ga0105248_10541741 Ga0105248_105417412 106
79 3300009553 Ga0105249_10688284 Ga0105249_106882842 106
80 3300009553 Ga0105249_12838008 Ga0105249_128380081 106
81 3300010375 Ga0105239_10702040 Ga0105239_107020402 106
82 3300013296 Ga0157374_10484561 Ga0157374_104845612 106
83 3300013306 Ga0163162_10166096 Ga0163162_101660962 106
84 3300013306 Ga0163162_11869829 Ga0163162_118698292 106
85 3300013308 Ga0157375_10059737 Ga0157375_100597372 106
86 3300013308 Ga0157375_11455333 Ga0157375_114553332 106
87 3300014325 Ga0163163_10036040 Ga0163163_100360408 106
88 3300014968 Ga0157379_10006169 Ga0157379_100061698 106
89 3300025315 Ga0207697_10230297 Ga0207697_102302971 106
90 3300025900 Ga0207710_10163347 Ga0207710_101633472 106
91 3300025901 Ga0207688_10210727 Ga0207688_102107272 106
92 3300025901 Ga0207688_10353359 Ga0207688_103533591 106
93 3300025907 Ga0207645_10163495 Ga0207645_101634952 106
94 3300025908 Ga0207643_10126958 Ga0207643_101269582 106
95 3300025923 Ga0207681_10008537 Ga0207681_100085378 106
96 3300025925 Ga0207650_10106996 Ga0207650_101069962 106
97 3300025925 Ga0207650_10170200 Ga0207650_101702002 106
98 3300025926 Ga0207659_10011417 Ga0207659_100114174 106
99 3300025933 Ga0207706_10066738 Ga0207706_100667382 106
100 3300025936 Ga0207670_11026772 Ga0207670_110267722 106
101 3300025938 Ga0207704_10475201 Ga0207704_104752012 106
102 3300025940 Ga0207691_10117860 Ga0207691_101178602 106
103 3300025940 Ga0207691_10191749 Ga0207691_101917493 106
104 3300025941 Ga0207711_10150542 Ga0207711_101505422 106
105 3300025942 Ga0207689_10000270 Ga0207689_100002706 106
106 3300025945 Ga0207679_10113372 Ga0207679_101133723 106
107 3300025949 Ga0207667_10641522 Ga0207667_106415222 106
108 3300025961 Ga0207712_11552942 Ga0207712_115529421 106
109 3300025972 Ga0207668_10067315 Ga0207668_100673152 106
110 3300025981 Ga0207640_10895196 Ga0207640_108951962 106
111 3300025986 Ga0207658_10016890 Ga0207658_100168902 106
112 3300025986 Ga0207658_10488657 Ga0207658_104886572 106
113 3300025986 Ga0207658_10983785 Ga0207658_109837853 106
114 3300026023 Ga0207677_10078840 Ga0207677_100788402 106
115 3300026035 Ga0207703_10000884 Ga0207703_100008845 106
116 3300026067 Ga0207678_10872845 Ga0207678_108728452 106
117 3300026067 Ga0207678_11552351 Ga0207678_115523511 106
118 3300026075 Ga0207708_10095437 Ga0207708_100954372 106
119 3300026075 Ga0207708_10509353 Ga0207708_105093533 106
120 3300026088 Ga0207641_10029739 Ga0207641_100297392 106
121 3300026088 Ga0207641_10031038 Ga0207641_100310386 106
122 3300026088 Ga0207641_10151392 Ga0207641_101513921 106
123 3300026089 Ga0207648_10003469 Ga0207648_1000346914 106
124 3300026089 Ga0207648_11204150 Ga0207648_112041503 106
125 3300026095 Ga0207676_10002341 Ga0207676_100023414 106
126 3300026095 Ga0207676_10244399 Ga0207676_102443991 106
127 3300026116 Ga0207674_10010555 Ga0207674_100105552 106
128 3300026118 Ga0207675_100035652 Ga0207675_1000356528 106
129 3300028379 Ga0268266_10133005 Ga0268266_101330053 106
130 3300028380 Ga0268265_10022102 Ga0268265_100221022 106
131 3300028381 Ga0268264_10042818 Ga0268264_100428182 106
132 3300028381 Ga0268264_10061419 Ga0268264_100614192 106
133 3300028381 Ga0268264_11286676 Ga0268264_112866762 106
134 3300035114 Ga0373939_0306334 Ga0373939_0306334_21_347 106
135 3300048905 Ga0496102_0073352 Ga0496102_0073352_661_987 106
136 3300048906 Ga0496103_0024487 Ga0496103_0024487_993_1319 106
137 3300048907 Ga0496104_0633865 Ga0496104_0633865_463_789 106
138 3300048909 Ga0496106_0252465 Ga0496106_0252465_606_932 106
139 3300048911 Ga0496108_0552258 Ga0496108_0552258_221_547 106
140 3300048911 Ga0496108_0557627 Ga0496108_0557627_545_871 106
141 3300048912 Ga0496109_0050984 Ga0496109_0050984_390_716 106
142 3300048914 Ga0496111_0787805 Ga0496111_0787805_269_595 106
143 3300049577 Ga0501041_0219241 Ga0501041_0219241_734_1060 106
144 3300049592 Ga0501076_0379193 Ga0501076_0379193_418_744 106
145 3300049824 Ga0501045_0711244 Ga0501045_0711244_108_434 106
146 3300050515 nmdc:mga0a205_417460_c1 nmdc:mga0a205_417460_c1_429_755 106
147 3300059512 Ga0587092_113200 Ga0587092_113200_158_484 106
148 3300059640 Ga0587067_234698 Ga0587067_234698_48_398 106
149 3300015262 Ga0182007_10066676 Ga0182007_100666762 107
150 iso_pu_bacteria 2643221614 2644087345 107
151 iso_pu_bacteria 2643221661 2644344611 107
152 iso_pu_bacteria 2643221666 2644366705 107
153 3300005337 Ga0070682_100089299 Ga0070682_1000892992 108
154 3300005366 Ga0070659_100003826 Ga0070659_10000382610 108
155 3300005539 Ga0068853_100013327 Ga0068853_1000133273 108
156 3300005564 Ga0070664_100035738 Ga0070664_1000357382 108
157 3300006358 Ga0068871_100802712 Ga0068871_1008027122 108
158 3300009148 Ga0105243_11074835 Ga0105243_110748352 108
159 3300009177 Ga0105248_10348494 Ga0105248_103484942 108
160 3300013104 Ga0157370_10473849 Ga0157370_104738492 108
161 3300025915 Ga0207693_11409298 Ga0207693_114092981 108
162 3300025932 Ga0207690_10000737 Ga0207690_100007373 108
163 3300025941 Ga0207711_10282445 Ga0207711_102824452 108
164 3300025945 Ga0207679_10042261 Ga0207679_100422612 108
165 3300026041 Ga0207639_10009353 Ga0207639_100093534 108
166 3300026121 Ga0207683_10402481 Ga0207683_104024811 108
167 3300049570 Ga0501033_0009831 Ga0501033_0009831_5755_6081 108
168 3300049571 Ga0501034_0014620 Ga0501034_0014620_4830_5156 108
169 3300049573 Ga0501037_0279183 Ga0501037_0279183_302_628 108
170 3300049822 Ga0501035_0957946 Ga0501035_0957946_26_352 108
171 3300049823 Ga0501044_0000960 Ga0501044_0000960_14016_14342 108
172 3300005347 Ga0070668_100001157 Ga0070668_1000011572 109
173 3300005347 Ga0070668_100001210 Ga0070668_10000121017 109
174 3300005353 Ga0070669_100012619 Ga0070669_1000126193 109
175 3300005355 Ga0070671_100012583 Ga0070671_1000125832 109
176 3300005366 Ga0070659_102117124 Ga0070659_1021171241 109
177 3300005367 Ga0070667_100003061 Ga0070667_10000306112 109
178 3300005367 Ga0070667_100153467 Ga0070667_1001534672 109
179 3300005459 Ga0068867_100722910 Ga0068867_1007229101 109
180 3300005548 Ga0070665_100000744 Ga0070665_10000074425 109
181 3300005548 Ga0070665_100021958 Ga0070665_1000219582 109
182 3300005548 Ga0070665_100033955 Ga0070665_1000339553 109
183 3300005563 Ga0068855_100324870 Ga0068855_1003248701 109
184 3300005614 Ga0068856_100368204 Ga0068856_1003682042 109
185 3300005616 Ga0068852_102087501 Ga0068852_1020875011 109
186 3300005617 Ga0068859_100000658 Ga0068859_10000065819 109
187 3300005617 Ga0068859_101777909 Ga0068859_1017779092 109
188 3300005618 Ga0068864_100270715 Ga0068864_1002707152 109
189 3300005618 Ga0068864_101036376 Ga0068864_1010363762 109
190 3300005719 Ga0068861_100521407 Ga0068861_1005214072 109
191 3300005841 Ga0068863_100006603 Ga0068863_1000066034 109
192 3300005842 Ga0068858_100043046 Ga0068858_1000430464 109
193 3300005842 Ga0068858_100238465 Ga0068858_1002384652 109
194 3300005843 Ga0068860_100036580 Ga0068860_1000365802 109
195 3300005843 Ga0068860_100958106 Ga0068860_1009581062 109
196 3300005844 Ga0068862_100019422 Ga0068862_1000194225 109
197 3300005844 Ga0068862_100159950 Ga0068862_1001599502 109
198 3300006042 Ga0075368_10085032 Ga0075368_100850322 109
199 3300006051 Ga0075364_10003677 Ga0075364_100036773 109
200 3300006051 Ga0075364_11152952 Ga0075364_111529521 109
201 3300006178 Ga0075367_10014602 Ga0075367_100146025 109
202 3300006353 Ga0075370_10466454 Ga0075370_104664542 109
203 3300006881 Ga0068865_100002000 Ga0068865_1000020002 109
204 3300006931 Ga0097620_100000658 Ga0097620_10000065819 109
205 3300006931 Ga0097620_101778039 Ga0097620_1017780392 109
206 3300009093 Ga0105240_10270228 Ga0105240_102702283 109
207 3300009174 Ga0105241_10786305 Ga0105241_107863051 109
208 3300009177 Ga0105248_10002412 Ga0105248_1000241217 109
209 3300009177 Ga0105248_10780300 Ga0105248_107803002 109
210 3300009177 Ga0105248_11056934 Ga0105248_110569342 109
211 3300009545 Ga0105237_10435108 Ga0105237_104351082 109
212 3300009553 Ga0105249_10747304 Ga0105249_107473042 109
213 3300009553 Ga0105249_11402679 Ga0105249_114026792 109
214 3300013308 Ga0157375_11453498 Ga0157375_114534982 109
215 3300014325 Ga0163163_10000747 Ga0163163_1000074713 109
216 3300014325 Ga0163163_10086973 Ga0163163_100869732 109
217 3300014968 Ga0157379_10001591 Ga0157379_100015919 109
218 3300017792 Ga0163161_11617111 Ga0163161_116171111 109
219 3300025913 Ga0207695_11588306 Ga0207695_115883061 109
220 3300025914 Ga0207671_10440852 Ga0207671_104408522 109
221 3300025923 Ga0207681_10062890 Ga0207681_100628902 109
222 3300025925 Ga0207650_10382861 Ga0207650_103828612 109
223 3300025931 Ga0207644_10004412 Ga0207644_1000441210 109
224 3300025938 Ga0207704_10001149 Ga0207704_100011499 109
225 3300025941 Ga0207711_10011270 Ga0207711_100112705 109
226 3300025941 Ga0207711_10545059 Ga0207711_105450592 109
227 3300025941 Ga0207711_10888085 Ga0207711_108880851 109
228 3300025949 Ga0207667_10597305 Ga0207667_105973051 109
229 3300025961 Ga0207712_10500857 Ga0207712_105008572 109
230 3300025972 Ga0207668_10000019 Ga0207668_1000001964 109
231 3300025972 Ga0207668_10001481 Ga0207668_1000148112 109
232 3300025986 Ga0207658_10005402 Ga0207658_100054023 109
233 3300025986 Ga0207658_10016937 Ga0207658_100169371 109
234 3300026035 Ga0207703_10004121 Ga0207703_100041212 109
235 3300026067 Ga0207678_11046240 Ga0207678_110462402 109
236 3300026078 Ga0207702_12451541 Ga0207702_124515411 109
237 3300026088 Ga0207641_10051707 Ga0207641_100517072 109
238 3300026088 Ga0207641_11879215 Ga0207641_118792152 109
239 3300027543 Ga0209999_1089808 Ga0209999_10898081 109
240 3300027866 Ga0209813_10048916 Ga0209813_100489161 109
241 3300028379 Ga0268266_10000611 Ga0268266_1000061119 109
242 3300028379 Ga0268266_10026093 Ga0268266_100260933 109
243 3300028379 Ga0268266_10033212 Ga0268266_100332125 109
244 3300028380 Ga0268265_10082303 Ga0268265_100823032 109
245 3300028381 Ga0268264_10010578 Ga0268264_100105783 109
246 3300035089 Ga0373944_0075747 Ga0373944_0075747_487_816 109
247 3300035116 Ga0373945_0228785 Ga0373945_0228785_426_755 109
248 3300035172 Ga0373955_0735403 Ga0373955_0735403_162_503 109
249 3300035692 Ga0373935_0045430 Ga0373935_0045430_2263_2592 109
250 3300035695 Ga0373927_0001653 Ga0373927_0001653_7744_8073 109
251 3300035725 Ga0373947_0239020 Ga0373947_0239020_19_348 109
252 3300036401 Ga0373937_2029626 Ga0373937_2029626_46_375 109
253 3300037068 Ga0373925_0000049 Ga0373925_0000049_10015_10344 109
254 3300037068 Ga0373925_1596390 Ga0373925_1596390_123_452 109
255 3300037418 Ga0395900_0013143 Ga0395900_0013143_3006_3335 109
256 3300037418 Ga0395900_0362792 Ga0395900_0362792_742_1071 109
257 3300037466 Ga0395898_0258051 Ga0395898_0258051_652_981 109
258 3300037471 Ga0395905_0097470 Ga0395905_0097470_1203_1532 109
259 3300037471 Ga0395905_0260774 Ga0395905_0260774_797_1126 109
260 3300037471 Ga0395905_0280129 Ga0395905_0280129_632_961 109
261 3300038443 Ga0395901_0631373 Ga0395901_0631373_262_591 109
262 3300045049 Ga0466959_0140908 Ga0466959_0140908_44_385 109
263 3300046616 Ga0495668_0560261 Ga0495668_0560261_16_345 109
264 3300046684 Ga0495669_0335451 Ga0495669_0335451_109_438 109
265 3300048090 Ga0495615_0162049 Ga0495615_0162049_278_655 109
266 3300048905 Ga0496102_1582765 Ga0496102_1582765_191_520 109
267 3300049539 Ga0501323_058899 Ga0501323_058899_199_528 109
268 3300049569 Ga0501032_0062232 Ga0501032_0062232_440_844 109
269 3300050491 nmdc:mga00v17_2978_c1 nmdc:mga00v17_2978_c1_2340_2669 109
270 3300050493 nmdc:mga0k408_94172_c1 nmdc:mga0k408_94172_c1_374_703 109
271 3300050494 nmdc:mga06z11_55883_c1 nmdc:mga06z11_55883_c1_987_1316 109
272 3300050495 nmdc:mga04h51_79017_c1 nmdc:mga04h51_79017_c1_500_829 109
273 3300050496 nmdc:mga07m45_759303_c1 nmdc:mga07m45_759303_c1_217_546 109
274 3300053087 Ga0500643_000903 Ga0500643_000903_18288_18617 109
275 3300053096 Ga0500641_0000638 Ga0500641_0000638_5048_5377 109
276 3300053098 Ga0500650_0186401 Ga0500650_0186401_71_400 109
277 3300053108 Ga0500562_064221 Ga0500562_064221_33_365 109
278 3300053130 Ga0500642_0356595 Ga0500642_0356595_263_592 109
279 3300053151 Ga0500604_0015784 Ga0500604_0015784_435_764 109
280 3300053153 Ga0500616_0032840 Ga0500616_0032840_515_844 109
281 3300053153 Ga0500616_0034126 Ga0500616_0034126_2061_2390 109
282 3300053156 Ga0500622_0035247 Ga0500622_0035247_1866_2198 109
283 3300053730 Ga0500645_000199 Ga0500645_000199_38910_39239 109
284 3300053730 Ga0500645_002806 Ga0500645_002806_6207_6536 109
285 3300059492 Ga0587073_0121262 Ga0587073_0121262_258_593 109
286 3300003791 Ga0055530_10004751 Ga0055530_100047512 110
287 3300003794 Ga0055531_10001345 Ga0055531_100013456 110
288 3300005327 Ga0070658_10066333 Ga0070658_100663333 110
289 3300005327 Ga0070658_10289389 Ga0070658_102893892 110
290 3300005327 Ga0070658_10863680 Ga0070658_108636801 110
291 3300005329 Ga0070683_101132713 Ga0070683_1011327132 110
292 3300005331 Ga0070670_100000022 Ga0070670_10000002256 110
293 3300005331 Ga0070670_100133578 Ga0070670_1001335783 110
294 3300005334 Ga0068869_101050744 Ga0068869_1010507441 110
295 3300005334 Ga0068869_101167203 Ga0068869_1011672031 110
296 3300005335 Ga0070666_10021858 Ga0070666_100218584 110
297 3300005335 Ga0070666_10362318 Ga0070666_103623182 110
298 3300005336 Ga0070680_100532103 Ga0070680_1005321032 110
299 3300005338 Ga0068868_100620635 Ga0068868_1006206352 110
300 3300005339 Ga0070660_100064715 Ga0070660_1000647153 110
301 3300005340 Ga0070689_101648867 Ga0070689_1016488671 110
302 3300005344 Ga0070661_101077437 Ga0070661_1010774371 110
303 3300005347 Ga0070668_100007207 Ga0070668_1000072072 110
304 3300005347 Ga0070668_100028982 Ga0070668_1000289822 110
305 3300005347 Ga0070668_100424745 Ga0070668_1004247452 110
306 3300005353 Ga0070669_100697790 Ga0070669_1006977902 110
307 3300005354 Ga0070675_101144236 Ga0070675_1011442361 110
308 3300005355 Ga0070671_100268298 Ga0070671_1002682982 110
309 3300005355 Ga0070671_100517825 Ga0070671_1005178251 110
310 3300005364 Ga0070673_100125525 Ga0070673_1001255251 110
311 3300005367 Ga0070667_100000369 Ga0070667_10000036910 110
312 3300005367 Ga0070667_100020340 Ga0070667_1000203402 110
313 3300005367 Ga0070667_101461340 Ga0070667_1014613402 110
314 3300005445 Ga0070708_100000083 Ga0070708_10000008331 110
315 3300005456 Ga0070678_100388221 Ga0070678_1003882212 110
316 3300005457 Ga0070662_100036465 Ga0070662_1000364652 110
317 3300005457 Ga0070662_101066775 Ga0070662_1010667751 110
318 3300005458 Ga0070681_10173842 Ga0070681_101738422 110
319 3300005530 Ga0070679_100018957 Ga0070679_1000189573 110
320 3300005539 Ga0068853_100119847 Ga0068853_1001198472 110
321 3300005539 Ga0068853_100549815 Ga0068853_1005498152 110
322 3300005539 Ga0068853_101777143 Ga0068853_1017771431 110
323 3300005548 Ga0070665_100002444 Ga0070665_10000244410 110
324 3300005548 Ga0070665_100043150 Ga0070665_1000431504 110
325 3300005563 Ga0068855_100085443 Ga0068855_1000854432 110
326 3300005563 Ga0068855_100096809 Ga0068855_1000968092 110
327 3300005577 Ga0068857_101810895 Ga0068857_1018108951 110
328 3300005578 Ga0068854_100557438 Ga0068854_1005574382 110
329 3300005614 Ga0068856_100447197 Ga0068856_1004471972 110
330 3300005614 Ga0068856_100936799 Ga0068856_1009367992 110
331 3300005617 Ga0068859_100034349 Ga0068859_1000343494 110
332 3300005617 Ga0068859_100360048 Ga0068859_1003600482 110
333 3300005618 Ga0068864_100000125 Ga0068864_10000012514 110
334 3300005618 Ga0068864_100001114 Ga0068864_10000111410 110
335 3300005618 Ga0068864_100612293 Ga0068864_1006122931 110
336 3300005840 Ga0068870_11415080 Ga0068870_114150801 110
337 3300005841 Ga0068863_100000066 Ga0068863_10000006661 110
338 3300005841 Ga0068863_100000119 Ga0068863_10000011984 110
339 3300005841 Ga0068863_100240404 Ga0068863_1002404042 110
340 3300005841 Ga0068863_100767573 Ga0068863_1007675732 110
341 3300005842 Ga0068858_100000136 Ga0068858_10000013648 110
342 3300005842 Ga0068858_100021861 Ga0068858_1000218612 110
343 3300005842 Ga0068858_100805192 Ga0068858_1008051922 110
344 3300005843 Ga0068860_100000507 Ga0068860_10000050710 110
345 3300005843 Ga0068860_100252610 Ga0068860_1002526102 110
346 3300005844 Ga0068862_100000551 Ga0068862_10000055137 110
347 3300005844 Ga0068862_100004114 Ga0068862_1000041142 110
348 3300005844 Ga0068862_100527090 Ga0068862_1005270901 110
349 3300006028 Ga0070717_10014486 Ga0070717_100144864 110
350 3300006175 Ga0070712_100311140 Ga0070712_1003111402 110
351 3300006186 Ga0075369_10005143 Ga0075369_100051432 110
352 3300006195 Ga0075366_10019110 Ga0075366_100191104 110
353 3300006195 Ga0075366_10040927 Ga0075366_100409275 110
354 3300006195 Ga0075366_10210033 Ga0075366_102100332 110
355 3300006237 Ga0097621_101603748 Ga0097621_1016037481 110
356 3300006358 Ga0068871_100199218 Ga0068871_1001992182 110
357 3300006358 Ga0068871_101324500 Ga0068871_1013245002 110
358 3300006881 Ga0068865_100617916 Ga0068865_1006179162 110
359 3300006931 Ga0097620_100034349 Ga0097620_1000343494 110
360 3300006931 Ga0097620_100360041 Ga0097620_1003600412 110
361 3300009092 Ga0105250_10007609 Ga0105250_100076092 110
362 3300009093 Ga0105240_10144540 Ga0105240_101445403 110
363 3300009093 Ga0105240_10316167 Ga0105240_103161672 110
364 3300009093 Ga0105240_11416047 Ga0105240_114160472 110
365 3300009098 Ga0105245_11175686 Ga0105245_111756862 110
366 3300009148 Ga0105243_10672565 Ga0105243_106725652 110
367 3300009177 Ga0105248_10005197 Ga0105248_100051975 110
368 3300009177 Ga0105248_10092559 Ga0105248_100925592 110
369 3300009177 Ga0105248_10281479 Ga0105248_102814792 110
370 3300009177 Ga0105248_10446752 Ga0105248_104467523 110
371 3300009177 Ga0105248_10817129 Ga0105248_108171292 110
372 3300009177 Ga0105248_11164959 Ga0105248_111649591 110
373 3300009545 Ga0105237_10772580 Ga0105237_107725802 110
374 3300009551 Ga0105238_10047528 Ga0105238_100475282 110
375 3300009551 Ga0105238_10537228 Ga0105238_105372282 110
376 3300009551 Ga0105238_10905964 Ga0105238_109059642 110
377 3300009551 Ga0105238_11099049 Ga0105238_110990492 110
378 3300009553 Ga0105249_10000647 Ga0105249_1000064729 110
379 3300009553 Ga0105249_10780868 Ga0105249_107808682 110
380 3300010375 Ga0105239_10798067 Ga0105239_107980672 110
381 3300011119 Ga0105246_10210578 Ga0105246_102105782 110
382 3300013104 Ga0157370_10455023 Ga0157370_104550232 110
383 3300013105 Ga0157369_10410770 Ga0157369_104107702 110
384 3300013296 Ga0157374_10921955 Ga0157374_109219552 110
385 3300013306 Ga0163162_10296137 Ga0163162_102961373 110
386 3300013308 Ga0157375_10088010 Ga0157375_100880103 110
387 3300013308 Ga0157375_10672011 Ga0157375_106720112 110
388 3300013308 Ga0157375_10976234 Ga0157375_109762341 110
389 3300013308 Ga0157375_13039338 Ga0157375_130393382 110
390 3300014325 Ga0163163_10035635 Ga0163163_100356352 110
391 3300014325 Ga0163163_10086268 Ga0163163_100862683 110
392 3300014325 Ga0163163_10284725 Ga0163163_102847252 110
393 3300014325 Ga0163163_11501748 Ga0163163_115017481 110
394 3300014745 Ga0157377_10133223 Ga0157377_101332232 110
395 3300014968 Ga0157379_10009800 Ga0157379_1000980010 110
396 3300014968 Ga0157379_10099588 Ga0157379_100995883 110
397 3300014968 Ga0157379_10529441 Ga0157379_105294412 110
398 3300014969 Ga0157376_11889106 Ga0157376_118891062 110
399 3300020070 Ga0206356_10061775 Ga0206356_100617752 110
400 3300021377 Ga0213874_10026944 Ga0213874_100269442 110
401 3300021384 Ga0213876_10017428 Ga0213876_100174282 110
402 3300025254 Ga0209148_1027686 Ga0209148_10276862 110
403 3300025292 Ga0209676_1000308 Ga0209676_100030879 110
404 3300025292 Ga0209676_1000320 Ga0209676_100032081 110
405 3300025303 Ga0209051_1006510 Ga0209051_10065103 110
406 3300025304 Ga0209257_1000338 Ga0209257_100033881 110
407 3300025711 Ga0207696_1014612 Ga0207696_10146122 110
408 3300025900 Ga0207710_10316804 Ga0207710_103168041 110
409 3300025901 Ga0207688_10326514 Ga0207688_103265142 110
410 3300025908 Ga0207643_11042518 Ga0207643_110425182 110
411 3300025909 Ga0207705_10137554 Ga0207705_101375542 110
412 3300025909 Ga0207705_10850172 Ga0207705_108501722 110
413 3300025912 Ga0207707_10519370 Ga0207707_105193702 110
414 3300025913 Ga0207695_10002610 Ga0207695_1000261024 110
415 3300025913 Ga0207695_10007189 Ga0207695_1000718912 110
416 3300025913 Ga0207695_10009967 Ga0207695_100099672 110
417 3300025913 Ga0207695_10106175 Ga0207695_101061752 110
418 3300025914 Ga0207671_10973424 Ga0207671_109734242 110
419 3300025915 Ga0207693_10322962 Ga0207693_103229622 110
420 3300025917 Ga0207660_10363512 Ga0207660_103635122 110
421 3300025919 Ga0207657_10206326 Ga0207657_102063261 110
422 3300025920 Ga0207649_10593911 Ga0207649_105939112 110
423 3300025920 Ga0207649_10817524 Ga0207649_108175242 110
424 3300025921 Ga0207652_10145632 Ga0207652_101456322 110
425 3300025923 Ga0207681_10651016 Ga0207681_106510161 110
426 3300025923 Ga0207681_11008640 Ga0207681_110086401 110
427 3300025923 Ga0207681_11804041 Ga0207681_118040411 110
428 3300025924 Ga0207694_10290496 Ga0207694_102904962 110
429 3300025924 Ga0207694_10726189 Ga0207694_107261892 110
430 3300025924 Ga0207694_10752463 Ga0207694_107524631 110
431 3300025925 Ga0207650_10000016 Ga0207650_1000001691 110
432 3300025925 Ga0207650_10021394 Ga0207650_100213942 110
433 3300025925 Ga0207650_10611340 Ga0207650_106113401 110
434 3300025931 Ga0207644_10457928 Ga0207644_104579282 110
435 3300025931 Ga0207644_10685221 Ga0207644_106852212 110
436 3300025933 Ga0207706_10639466 Ga0207706_106394662 110
437 3300025939 Ga0207665_10968757 Ga0207665_109687571 110
438 3300025941 Ga0207711_10006764 Ga0207711_100067643 110
439 3300025941 Ga0207711_10057519 Ga0207711_100575193 110
440 3300025941 Ga0207711_10298732 Ga0207711_102987322 110
441 3300025941 Ga0207711_10723374 Ga0207711_107233742 110
442 3300025941 Ga0207711_11192252 Ga0207711_111922522 110
443 3300025941 Ga0207711_11503358 Ga0207711_115033582 110
444 3300025942 Ga0207689_10234791 Ga0207689_102347913 110
445 3300025942 Ga0207689_10404155 Ga0207689_104041552 110
446 3300025944 Ga0207661_10365028 Ga0207661_103650281 110
447 3300025945 Ga0207679_10518780 Ga0207679_105187802 110
448 3300025949 Ga0207667_10129238 Ga0207667_101292382 110
449 3300025949 Ga0207667_10142666 Ga0207667_101426662 110
450 3300025949 Ga0207667_10291033 Ga0207667_102910331 110
451 3300025949 Ga0207667_10928144 Ga0207667_109281442 110
452 3300025960 Ga0207651_10096418 Ga0207651_100964182 110
453 3300025961 Ga0207712_10019237 Ga0207712_100192374 110
454 3300025961 Ga0207712_10986534 Ga0207712_109865342 110
455 3300025961 Ga0207712_11213678 Ga0207712_112136781 110
456 3300025972 Ga0207668_10002967 Ga0207668_100029675 110
457 3300025972 Ga0207668_10131840 Ga0207668_101318402 110
458 3300025972 Ga0207668_10141984 Ga0207668_101419842 110
459 3300025986 Ga0207658_10000384 Ga0207658_1000038414 110
460 3300025986 Ga0207658_10587660 Ga0207658_105876602 110
461 3300025986 Ga0207658_11317083 Ga0207658_113170832 110
462 3300026023 Ga0207677_11610545 Ga0207677_116105451 110
463 3300026035 Ga0207703_10000065 Ga0207703_1000006541 110
464 3300026035 Ga0207703_10010902 Ga0207703_100109025 110
465 3300026035 Ga0207703_10175564 Ga0207703_101755642 110
466 3300026035 Ga0207703_10495807 Ga0207703_104958072 110
467 3300026041 Ga0207639_10095343 Ga0207639_100953432 110
468 3300026041 Ga0207639_12287668 Ga0207639_122876681 110
469 3300026078 Ga0207702_10196376 Ga0207702_101963762 110
470 3300026088 Ga0207641_10000011 Ga0207641_10000011328 110
471 3300026088 Ga0207641_10033654 Ga0207641_100336543 110
472 3300026088 Ga0207641_10848983 Ga0207641_108489832 110
473 3300026088 Ga0207641_12069509 Ga0207641_120695092 110
474 3300026089 Ga0207648_11776398 Ga0207648_117763982 110
475 3300026095 Ga0207676_10000148 Ga0207676_1000014821 110
476 3300026095 Ga0207676_10001859 Ga0207676_100018596 110
477 3300026095 Ga0207676_10212164 Ga0207676_102121642 110
478 3300026095 Ga0207676_10245949 Ga0207676_102459491 110
479 3300026116 Ga0207674_11324584 Ga0207674_113245842 110
480 3300026121 Ga0207683_10027153 Ga0207683_100271532 110
481 3300026142 Ga0207698_11438426 Ga0207698_114384261 110
482 3300027876 Ga0209974_10411414 Ga0209974_104114141 110
483 3300028379 Ga0268266_10005978 Ga0268266_100059784 110
484 3300028379 Ga0268266_10017036 Ga0268266_100170363 110
485 3300028380 Ga0268265_10000798 Ga0268265_1000079827 110
486 3300028380 Ga0268265_10212745 Ga0268265_102127452 110
487 3300028380 Ga0268265_10680907 Ga0268265_106809071 110
488 3300028380 Ga0268265_12169563 Ga0268265_121695632 110
489 3300028381 Ga0268264_10000014 Ga0268264_10000014344 110
490 3300028381 Ga0268264_10000207 Ga0268264_1000020710 110
491 3300028381 Ga0268264_10043016 Ga0268264_100430163 110
492 3300028573 Ga0265334_10008247 Ga0265334_100082471 110
493 3300028573 Ga0265334_10095516 Ga0265334_100955162 110
494 3300028573 Ga0265334_10273382 Ga0265334_102733822 110
495 3300028786 Ga0307517_10002922 Ga0307517_1000292211 110
496 3300028786 Ga0307517_10119287 Ga0307517_101192871 110
497 3300028800 Ga0265338_10044452 Ga0265338_100444522 110
498 3300028800 Ga0265338_10203015 Ga0265338_102030152 110
499 3300031090 Ga0265760_10046378 Ga0265760_100463782 110
500 3300031250 Ga0265331_10192190 Ga0265331_101921902 110
501 3300031251 Ga0265327_10129293 Ga0265327_101292932 110
502 3300031456 Ga0307513_10000541 Ga0307513_1000054119 110
503 3300031456 Ga0307513_10004541 Ga0307513_1000454112 110
504 3300031456 Ga0307513_10006209 Ga0307513_100062094 110
505 3300031456 Ga0307513_10670897 Ga0307513_106708972 110
506 3300031616 Ga0307508_10744489 Ga0307508_107444892 110
507 3300031616 Ga0307508_10809242 Ga0307508_108092422 110
508 3300031665 Ga0316575_10082097 Ga0316575_100820972 110
509 3300031691 Ga0316579_10628966 Ga0316579_106289661 110
510 3300031711 Ga0265314_10204623 Ga0265314_102046232 110
511 3300031727 Ga0316576_10203706 Ga0316576_102037062 110
512 3300031728 Ga0316578_10306143 Ga0316578_103061431 110
513 3300031730 Ga0307516_10000030 Ga0307516_1000003050 110
514 3300031733 Ga0316577_10503502 Ga0316577_105035022 110
515 3300031903 Ga0307407_10264265 Ga0307407_102642652 110
516 3300031911 Ga0307412_10311132 Ga0307412_103111322 110
517 3300032126 Ga0307415_100674173 Ga0307415_1006741732 110
518 3300032133 Ga0316583_10052072 Ga0316583_100520722 110
519 3300032137 Ga0316585_10006969 Ga0316585_100069692 110
520 3300032168 Ga0316593_10026979 Ga0316593_100269792 110
521 3300033180 Ga0307510_10010004 Ga0307510_100100047 110
522 3300033524 Ga0316592_1053995 Ga0316592_10539952 110
523 3300033528 Ga0316588_1002162 Ga0316588_10021624 110
524 3300033541 Ga0316596_1060058 Ga0316596_10600582 110
525 3300035092 Ga0373952_0135334 Ga0373952_0135334_288_629 110
526 3300035113 Ga0373936_0000661 Ga0373936_0000661_2867_3223 110
527 3300035171 Ga0373946_0772685 Ga0373946_0772685_53_388 110
528 3300035172 Ga0373955_0880521 Ga0373955_0880521_80_427 110
529 3300035691 Ga0373931_0664428 Ga0373931_0664428_286_621 110
530 3300035692 Ga0373935_0210569 Ga0373935_0210569_46_381 110
531 3300035695 Ga0373927_0419978 Ga0373927_0419978_351_686 110
532 3300035724 Ga0373933_0929132 Ga0373933_0929132_34_375 110
533 3300036401 Ga0373937_0663710 Ga0373937_0663710_249_599 110
534 3300036401 Ga0373937_0702585 Ga0373937_0702585_481_828 110
535 3300036647 Ga0316582_0365070 Ga0316582_0365070_133_465 110
536 3300036712 Ga0316584_0082675 Ga0316584_0082675_173_505 110
537 3300037312 Ga0395899_0003271 Ga0395899_0003271_5821_6156 110
538 3300037312 Ga0395899_0106800 Ga0395899_0106800_1259_1594 110
539 3300037312 Ga0395899_0167832 Ga0395899_0167832_890_1225 110
540 3300037418 Ga0395900_0237473 Ga0395900_0237473_265_600 110
541 3300037418 Ga0395900_0448637 Ga0395900_0448637_17_352 110
542 3300037418 Ga0395900_1854096 Ga0395900_1854096_17_352 110
543 3300037466 Ga0395898_0007710 Ga0395898_0007710_10362_10697 110
544 3300037466 Ga0395898_0097502 Ga0395898_0097502_2067_2402 110
545 3300037466 Ga0395898_0424126 Ga0395898_0424126_771_1106 110
546 3300037471 Ga0395905_0004961 Ga0395905_0004961_9829_10164 110
547 3300037588 Ga0316581_0216814 Ga0316581_0216814_224_556 110
548 3300038443 Ga0395901_0000021 Ga0395901_0000021_302652_302987 110
549 3300038443 Ga0395901_0266167 Ga0395901_0266167_162_497 110
550 3300039437 Ga0436365_1445717 Ga0436365_1445717_31_363 110
551 3300039438 Ga0436360_0053752 Ga0436360_0053752_338_673 110
552 3300039450 Ga0436363_1219245 Ga0436363_1219245_144_491 110
553 3300039450 Ga0436363_1424271 Ga0436363_1424271_891_1232 110
554 3300041443 Ga0451789_0017912 Ga0451789_0017912_234_569 110
555 3300041486 Ga0451807_2521828 Ga0451807_2521828_125_457 110
556 3300041501 Ga0451845_0570884 Ga0451845_0570884_249_581 110
557 3300041503 Ga0451847_0447433 Ga0451847_0447433_101_457 110
558 3300041509 Ga0451843_0800999 Ga0451843_0800999_115_450 110
559 3300042012 Ga0439455_0253308 Ga0439455_0253308_30_368 110
560 3300044693 Ga0466961_0739925 Ga0466961_0739925_227_562 110
561 3300046457 Ga0495590_0001271 Ga0495590_0001271_10113_10445 110
562 3300046460 Ga0495638_0000185 Ga0495638_0000185_16996_17328 110
563 3300046460 Ga0495638_0001213 Ga0495638_0001213_14033_14368 110
564 3300046460 Ga0495638_0513788 Ga0495638_0513788_123_455 110
565 3300046477 Ga0495664_0351076 Ga0495664_0351076_204_536 110
566 3300046499 Ga0495594_0408096 Ga0495594_0408096_308_640 110
567 3300046506 Ga0495583_0090078 Ga0495583_0090078_677_1009 110
568 3300046507 Ga0495606_0242676 Ga0495606_0242676_217_549 110
569 3300046507 Ga0495606_0534817 Ga0495606_0534817_195_530 110
570 3300046512 Ga0495610_0001542 Ga0495610_0001542_12008_12340 110
571 3300046512 Ga0495610_0002504 Ga0495610_0002504_10855_11190 110
572 3300046515 Ga0495620_0043942 Ga0495620_0043942_501_833 110
573 3300046518 Ga0495631_0001061 Ga0495631_0001061_286_618 110
574 3300046519 Ga0495632_0196110 Ga0495632_0196110_75_410 110
575 3300046520 Ga0495637_0061700 Ga0495637_0061700_184_516 110
576 3300046522 Ga0495643_0162821 Ga0495643_0162821_749_1081 110
577 3300046524 Ga0495648_0001143 Ga0495648_0001143_7321_7653 110
578 3300046528 Ga0495642_0009268 Ga0495642_0009268_2430_2765 110
579 3300046528 Ga0495642_0181114 Ga0495642_0181114_210_548 110
580 3300046530 Ga0495654_0041442 Ga0495654_0041442_217_549 110
581 3300046530 Ga0495654_0092590 Ga0495654_0092590_853_1185 110
582 3300046536 Ga0495587_0313837 Ga0495587_0313837_360_701 110
583 3300046537 Ga0495598_0230819 Ga0495598_0230819_82_426 110
584 3300046538 Ga0495609_0221746 Ga0495609_0221746_409_741 110
585 3300046542 Ga0495597_0000940 Ga0495597_0000940_11408_11740 110
586 3300046542 Ga0495597_0016383 Ga0495597_0016383_1004_1336 110
587 3300046557 Ga0495622_0000495 Ga0495622_0000495_24044_24376 110
588 3300046616 Ga0495668_0000196 Ga0495668_0000196_69348_69680 110
589 3300046616 Ga0495668_0032996 Ga0495668_0032996_1497_1829 110
590 3300046616 Ga0495668_0766457 Ga0495668_0766457_150_482 110
591 3300046648 Ga0495611_0003249 Ga0495611_0003249_233_568 110
592 3300046648 Ga0495611_0137916 Ga0495611_0137916_564_902 110
593 3300046660 Ga0495625_0032672 Ga0495625_0032672_2392_2727 110
594 3300046660 Ga0495625_0057282 Ga0495625_0057282_1029_1364 110
595 3300046660 Ga0495625_0165352 Ga0495625_0165352_799_1131 110
596 3300046660 Ga0495625_0178490 Ga0495625_0178490_688_1020 110
597 3300046660 Ga0495625_0273602 Ga0495625_0273602_534_869 110
598 3300046679 Ga0495623_0617671 Ga0495623_0617671_31_369 110
599 3300046684 Ga0495669_0000081 Ga0495669_0000081_23071_23406 110
600 3300046690 Ga0495624_0347427 Ga0495624_0347427_64_396 110
601 3300046794 Ga0495589_0028386 Ga0495589_0028386_611_946 110
602 3300046810 Ga0495660_0294120 Ga0495660_0294120_218_553 110
603 3300046810 Ga0495660_0396677 Ga0495660_0396677_156_488 110
604 3300047315 Ga0495581_0199504 Ga0495581_0199504_351_683 110
605 3300047318 Ga0495636_0066666 Ga0495636_0066666_787_1122 110
606 3300047320 Ga0495672_0078397 Ga0495672_0078397_769_1101 110
607 3300047445 Ga0495677_0153499 Ga0495677_0153499_80_415 110
608 3300047469 Ga0495673_0000818 Ga0495673_0000818_19165_19497 110
609 3300047470 Ga0495681_0141055 Ga0495681_0141055_455_790 110
610 3300047472 Ga0495686_0001281 Ga0495686_0001281_10896_11228 110
611 3300047472 Ga0495686_0041270 Ga0495686_0041270_1858_2193 110
612 3300048903 Ga0496100_1077026 Ga0496100_1077026_15_350 110
613 3300048905 Ga0496102_0002509 Ga0496102_0002509_13345_13683 110
614 3300048906 Ga0496103_0160165 Ga0496103_0160165_209_544 110
615 3300048909 Ga0496106_0534374 Ga0496106_0534374_50_388 110
616 3300048909 Ga0496106_1576793 Ga0496106_1576793_72_404 110
617 3300048911 Ga0496108_0007812 Ga0496108_0007812_5627_5965 110
618 3300048912 Ga0496109_0072857 Ga0496109_0072857_628_966 110
619 3300048912 Ga0496109_0950802 Ga0496109_0950802_83_442 110
620 3300048915 Ga0496112_0008645 Ga0496112_0008645_8203_8541 110
621 3300048915 Ga0496112_0577307 Ga0496112_0577307_41_379 110
622 3300048915 Ga0496112_1406924 Ga0496112_1406924_253_591 110
623 3300048916 Ga0496113_0024190 Ga0496113_0024190_2012_2350 110
624 3300048917 Ga0496114_1569067 Ga0496114_1569067_112_444 110
625 3300048918 Ga0496115_0002000 Ga0496115_0002000_11_346 110
626 3300048918 Ga0496115_0328711 Ga0496115_0328711_784_1116 110
627 3300048924 Ga0496121_0315459 Ga0496121_0315459_691_1023 110
628 3300048927 Ga0496124_0006584 Ga0496124_0006584_215_547 110
629 3300048928 Ga0496125_0004898 Ga0496125_0004898_137_469 110
630 3300048929 Ga0496126_0016290 Ga0496126_0016290_5554_5886 110
631 3300049459 Ga0495678_002464 Ga0495678_002464_9957_10289 110
632 3300049535 Ga0501319_033485 Ga0501319_033485_71_406 110
633 3300049537 Ga0501321_056868 Ga0501321_056868_210_545 110
634 3300049580 Ga0501046_0798038 Ga0501046_0798038_252_587 110
635 3300049581 Ga0501047_0006419 Ga0501047_0006419_6569_6904 110
636 3300049581 Ga0501047_0023674 Ga0501047_0023674_4540_4878 110
637 3300049581 Ga0501047_0041638 Ga0501047_0041638_2380_2715 110
638 3300049581 Ga0501047_0233610 Ga0501047_0233610_130_465 110
639 3300049581 Ga0501047_0917077 Ga0501047_0917077_85_420 110
640 3300049583 Ga0501067_0135901 Ga0501067_0135901_302_637 110
641 3300049588 Ga0501072_0063615 Ga0501072_0063615_2136_2471 110
642 3300049589 Ga0501073_0080545 Ga0501073_0080545_1218_1553 110
643 3300049590 Ga0501074_0160556 Ga0501074_0160556_962_1297 110
644 3300049686 Ga0501257_005509 Ga0501257_005509_1495_1836 110
645 3300049742 Ga0501080_0170167 Ga0501080_0170167_1193_1528 110
646 3300049744 Ga0501083_0006235 Ga0501083_0006235_3126_3461 110
647 3300049744 Ga0501083_0288143 Ga0501083_0288143_561_896 110
648 3300049758 Ga0501241_165563 Ga0501241_165563_89_421 110
649 3300049822 Ga0501035_0158137 Ga0501035_0158137_1528_1863 110
650 3300049823 Ga0501044_0006907 Ga0501044_0006907_9281_9616 110
651 3300049823 Ga0501044_0837799 Ga0501044_0837799_178_510 110
652 3300049823 Ga0501044_0944010 Ga0501044_0944010_269_604 110
653 3300050493 nmdc:mga0k408_240195_c1 nmdc:mga0k408_240195_c1_519_851 110
654 3300050493 nmdc:mga0k408_29733_c1 nmdc:mga0k408_29733_c1_910_1245 110
655 3300050496 nmdc:mga07m45_226460_c1 nmdc:mga07m45_226460_c1_471_803 110
656 3300050516 nmdc:mga0sz30_131077_c1 nmdc:mga0sz30_131077_c1_91_423 110
657 3300050516 nmdc:mga0sz30_279806_c1 nmdc:mga0sz30_279806_c1_367_699 110
658 3300053077 Ga0495601_0934764 Ga0495601_0934764_10_351 110
659 3300053080 Ga0500635_0000258 Ga0500635_0000258_3243_3575 110
660 3300053086 Ga0500578_0001019 Ga0500578_0001019_19640_19972 110
661 3300053086 Ga0500578_0177525 Ga0500578_0177525_360_692 110
662 3300053087 Ga0500643_078768 Ga0500643_078768_100_432 110
663 3300053088 Ga0500644_0000239 Ga0500644_0000239_15115_15447 110
664 3300053088 Ga0500644_0492032 Ga0500644_0492032_126_458 110
665 3300053090 Ga0500646_0113682 Ga0500646_0113682_313_645 110
666 3300053093 Ga0500651_0009280 Ga0500651_0009280_82_414 110
667 3300053094 Ga0500566_0013864 Ga0500566_0013864_2974_3306 110
668 3300053096 Ga0500641_0001268 Ga0500641_0001268_966_1301 110
669 3300053103 Ga0500555_046364 Ga0500555_046364_76_408 110
670 3300053104 Ga0500556_0087657 Ga0500556_0087657_175_507 110
671 3300053105 Ga0500557_027599 Ga0500557_027599_94_426 110
672 3300053108 Ga0500562_000838 Ga0500562_000838_2751_3083 110
673 3300053108 Ga0500562_005366 Ga0500562_005366_2296_2628 110
674 3300053109 Ga0500569_009105 Ga0500569_009105_1823_2155 110
675 3300053118 Ga0500594_0000224 Ga0500594_0000224_3578_3910 110
676 3300053119 Ga0500595_060299 Ga0500595_060299_130_462 110
677 3300053121 Ga0500607_029942 Ga0500607_029942_1230_1562 110
678 3300053122 Ga0500608_000202 Ga0500608_000202_5341_5673 110
679 3300053122 Ga0500608_002769 Ga0500608_002769_514_846 110
680 3300053123 Ga0500614_013145 Ga0500614_013145_310_642 110
681 3300053134 Ga0500658_0171311 Ga0500658_0171311_186_518 110
682 3300053136 Ga0500559_0021200 Ga0500559_0021200_1505_1837 110
683 3300053136 Ga0500559_0070649 Ga0500559_0070649_526_858 110
684 3300053138 Ga0500564_000506 Ga0500564_000506_7587_7919 110
685 3300053138 Ga0500564_350826 Ga0500564_350826_17_349 110
686 3300053142 Ga0500577_0110265 Ga0500577_0110265_556_888 110
687 3300053148 Ga0500590_016265 Ga0500590_016265_720_1052 110
688 3300053150 Ga0500603_004385 Ga0500603_004385_2040_2372 110
689 3300053153 Ga0500616_0147160 Ga0500616_0147160_70_408 110
690 3300053154 Ga0500619_016052 Ga0500619_016052_833_1165 110
691 3300053154 Ga0500619_101560 Ga0500619_101560_94_426 110
692 3300053155 Ga0500620_117008 Ga0500620_117008_548_880 110
693 3300053156 Ga0500622_0001017 Ga0500622_0001017_3685_4017 110
694 3300053156 Ga0500622_0007239 Ga0500622_0007239_866_1198 110
695 3300053156 Ga0500622_0007501 Ga0500622_0007501_3610_3942 110
696 3300053156 Ga0500622_0180011 Ga0500622_0180011_583_915 110
697 3300053157 Ga0500624_022231 Ga0500624_022231_424_756 110
698 3300053161 Ga0500634_0242761 Ga0500634_0242761_160_495 110
699 3300053162 Ga0500638_006452 Ga0500638_006452_1239_1571 110
700 3300053163 Ga0500639_196769 Ga0500639_196769_371_703 110
701 3300053177 Ga0500636_0030429 Ga0500636_0030429_459_791 110
702 3300053178 Ga0500637_0011924 Ga0500637_0011924_3227_3559 110
703 3300053178 Ga0500637_0069871 Ga0500637_0069871_453_785 110
704 3300053725 Ga0500576_177844 Ga0500576_177844_190_522 110
705 3300053729 Ga0500625_040366 Ga0500625_040366_248_580 110
706 3300053735 Ga0500596_007741 Ga0500596_007741_1394_1726 110
707 3300054114 Ga0501084_0006768 Ga0501084_0006768_100_435 110
708 3300055283 Ga0500661_049846 Ga0500661_049846_12_344 110
709 3300055283 Ga0500661_068000 Ga0500661_068000_290_622 110
710 3300060353 Ga0501082_0047765 Ga0501082_0047765_460_795 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

27

129

0.97

PF13098

Thioredoxin_2

Thioredoxin-like domain

40

127

0.91

PF13728

TraF

F plasmid transfer operon protein

43

126

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9984 27 102
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9937 2 104
3dxb-assembly2.cif.gz_D structure of the uhm domain of puf60 fused to thioredoxin 0.992 2 104
2eir-assembly3.cif.gz_C design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts 0.9919 2 105
6gd1-assembly1.cif.gz_A structure of hur rrm3 0.9917 2 104
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9984 27 102 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9904 2 104 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9854 27 102 3.40.30.10
af_Q8LD49_56_177_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9816 3 104 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9761 31 104 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q3RV69-F1-model_v4 Thioredoxin 1.005 1 110 GO:0005829
GO:0015035
GO:0045454
AF-A0A258FSJ4-F1-model_v4 Thioredoxin 1.003 1 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A1Y0BWF8-F1-model_v4 Thioredoxin 1.003 3 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A2S6UW01-F1-model_v4 Thioredoxin 1.002 2 104 GO:0005737
GO:0015035
AF-A0A7C7PYS9-F1-model_v4 Thioredoxin 1.002 3 104 GO:0005829
GO:0015035
GO:0045454

Feature Viewer

pLDDT pTM Quality
96.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map