F476732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 710 | 349 | 707 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0062232|Ga0501032_0062232_440_844 |
| Length | 134 |
| Sequence | MQTAHIAGQTGPGRVSAAGRNRSFLMSTVKVTDATFDKDVLQASGPVLVDFWAEWCGPCKQIAPALEQIADELGAKVTIAKLDIEESPTTPSRYGVRGIPTMMLFKDGQMASMKVGAMPKQKILEWLSEAGVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 2 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 3 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 4 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 165 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 166 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 176 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 177 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 196 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 210 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 211 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 212 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 304 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 305 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 306 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 308 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 309 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 315 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 316 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 317 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 319 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 320 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 328 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 333 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 334 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 336 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 338 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 340 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 344 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 346 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.89 |
| Metatranscriptomes | 1.69 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.39 |
| Nodule | 0 |
| Rhizoplane | 3.66 |
| Rhizosphere | 80.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055530_10004751 | 3300003791 | Bacteria | 6832 |
| 2 | Ga0055531_10001345 | 3300003794 | Bacteria | 18361 |
| 3 | Ga0065715_10134927 | 3300005293 | Bacteria | 1946 |
| 4 | Ga0070658_10066333 | 3300005327 | Bacteria | 2948 |
| 5 | Ga0070658_10289389 | 3300005327 | Bacteria | 1396 |
| 6 | Ga0070658_10863680 | 3300005327 | Bacteria | 786 |
| 7 | Ga0070676_10178648 | 3300005328 | Bacteria | 1378 |
| 8 | Ga0070683_101132713 | 3300005329 | Bacteria | 752 |
| 9 | Ga0070690_100291837 | 3300005330 | Bacteria | 1166 |
| 10 | Ga0070670_100000022 | 3300005331 | Bacteria | 199146 |
| 11 | Ga0070670_100000456 | 3300005331 | Bacteria | 33057 |
| 12 | Ga0070670_100042264 | 3300005331 | Bacteria | 3919 |
| 13 | Ga0070670_100133578 | 3300005331 | Bacteria | 2144 |
| 14 | Ga0068869_100068449 | 3300005334 | Bacteria | 2622 |
| 15 | Ga0068869_101050744 | 3300005334 | Bacteria | 711 |
| 16 | Ga0068869_101167203 | 3300005334 | Bacteria | 676 |
| 17 | Ga0068869_101530919 | 3300005334 | Bacteria | 593 |
| 18 | Ga0070666_10021858 | 3300005335 | Bacteria | 4149 |
| 19 | Ga0070666_10362318 | 3300005335 | Bacteria | 1039 |
| 20 | Ga0070680_100532103 | 3300005336 | Bacteria | 1007 |
| 21 | Ga0070682_100089299 | 3300005337 | Bacteria | 2013 |
| 22 | Ga0068868_100100641 | 3300005338 | Bacteria | 2338 |
| 23 | Ga0068868_100620635 | 3300005338 | Bacteria | 960 |
| 24 | Ga0070660_100064715 | 3300005339 | Bacteria | 2845 |
| 25 | Ga0070689_100771642 | 3300005340 | Bacteria | 844 |
| 26 | Ga0070689_101648867 | 3300005340 | Bacteria | 583 |
| 27 | Ga0070661_101077437 | 3300005344 | Bacteria | 669 |
| 28 | Ga0070668_100001157 | 3300005347 | Bacteria | 18611 |
| 29 | Ga0070668_100001210 | 3300005347 | Bacteria | 18336 |
| 30 | Ga0070668_100007207 | 3300005347 | Bacteria | 8246 |
| 31 | Ga0070668_100028982 | 3300005347 | Bacteria | 4203 |
| 32 | Ga0070668_100094897 | 3300005347 | Bacteria | 2355 |
| 33 | Ga0070668_100099959 | 3300005347 | Bacteria | 2297 |
| 34 | Ga0070668_100424745 | 3300005347 | Bacteria | 1138 |
| 35 | Ga0070668_102019917 | 3300005347 | Bacteria | 532 |
| 36 | Ga0070669_100012619 | 3300005353 | Bacteria | 5997 |
| 37 | Ga0070669_100072981 | 3300005353 | Bacteria | 2542 |
| 38 | Ga0070669_100434927 | 3300005353 | Bacteria | 1079 |
| 39 | Ga0070669_100697790 | 3300005353 | Bacteria | 857 |
| 40 | Ga0070675_100137670 | 3300005354 | Bacteria | 2085 |
| 41 | Ga0070675_101144236 | 3300005354 | Bacteria | 716 |
| 42 | Ga0070675_101344275 | 3300005354 | Bacteria | 659 |
| 43 | Ga0070671_100012583 | 3300005355 | Bacteria | 6816 |
| 44 | Ga0070671_100268298 | 3300005355 | Bacteria | 1451 |
| 45 | Ga0070671_100517825 | 3300005355 | Bacteria | 1027 |
| 46 | Ga0070671_100655497 | 3300005355 | Bacteria | 909 |
| 47 | Ga0070673_100125525 | 3300005364 | Bacteria | 2147 |
| 48 | Ga0070688_101028237 | 3300005365 | Bacteria | 656 |
| 49 | Ga0070688_101471346 | 3300005365 | Bacteria | 554 |
| 50 | Ga0070659_100003826 | 3300005366 | Bacteria | 10736 |
| 51 | Ga0070659_102117124 | 3300005366 | Bacteria | 506 |
| 52 | Ga0070667_100000369 | 3300005367 | Bacteria | 49025 |
| 53 | Ga0070667_100003061 | 3300005367 | Bacteria | 14375 |
| 54 | Ga0070667_100018158 | 3300005367 | Bacteria | 5832 |
| 55 | Ga0070667_100020340 | 3300005367 | Bacteria | 5510 |
| 56 | Ga0070667_100153467 | 3300005367 | Bacteria | 2025 |
| 57 | Ga0070667_101281218 | 3300005367 | Bacteria | 686 |
| 58 | Ga0070667_101461340 | 3300005367 | Bacteria | 642 |
| 59 | Ga0070705_100193153 | 3300005440 | Bacteria | 1389 |
| 60 | Ga0070700_100417570 | 3300005441 | Bacteria | 1013 |
| 61 | Ga0070708_100000083 | 3300005445 | Bacteria | 61330 |
| 62 | Ga0070663_100321384 | 3300005455 | Bacteria | 1244 |
| 63 | Ga0070663_102046216 | 3300005455 | Bacteria | 516 |
| 64 | Ga0070678_100388221 | 3300005456 | Bacteria | 1210 |
| 65 | Ga0070662_100036465 | 3300005457 | Bacteria | 3479 |
| 66 | Ga0070662_101066775 | 3300005457 | Bacteria | 693 |
| 67 | Ga0070681_10173842 | 3300005458 | Bacteria | 2075 |
| 68 | Ga0068867_100000391 | 3300005459 | Bacteria | 29282 |
| 69 | Ga0068867_100722910 | 3300005459 | Bacteria | 881 |
| 70 | Ga0070679_100018957 | 3300005530 | Bacteria | 6681 |
| 71 | Ga0068853_100013327 | 3300005539 | Bacteria | 6712 |
| 72 | Ga0068853_100119847 | 3300005539 | Bacteria | 2346 |
| 73 | Ga0068853_100549815 | 3300005539 | Bacteria | 1094 |
| 74 | Ga0068853_101777143 | 3300005539 | Bacteria | 598 |
| 75 | Ga0070672_100071914 | 3300005543 | Bacteria | 2753 |
| 76 | Ga0070672_100869143 | 3300005543 | Bacteria | 796 |
| 77 | Ga0070696_100360652 | 3300005546 | Bacteria | 1128 |
| 78 | Ga0070665_100000744 | 3300005548 | Bacteria | 43397 |
| 79 | Ga0070665_100002444 | 3300005548 | Bacteria | 20483 |
| 80 | Ga0070665_100021958 | 3300005548 | Bacteria | 6420 |
| 81 | Ga0070665_100033955 | 3300005548 | Bacteria | 5131 |
| 82 | Ga0070665_100043150 | 3300005548 | Bacteria | 4533 |
| 83 | Ga0070665_100049119 | 3300005548 | Bacteria | 4234 |
| 84 | Ga0070704_100483662 | 3300005549 | Bacteria | 1072 |
| 85 | Ga0068855_100085443 | 3300005563 | Bacteria | 3650 |
| 86 | Ga0068855_100096809 | 3300005563 | Bacteria | 3399 |
| 87 | Ga0068855_100324870 | 3300005563 | Bacteria | 1700 |
| 88 | Ga0068855_100696335 | 3300005563 | Bacteria | 1088 |
| 89 | Ga0070664_100035738 | 3300005564 | Bacteria | 4172 |
| 90 | Ga0070664_100975742 | 3300005564 | Bacteria | 796 |
| 91 | Ga0068857_100140345 | 3300005577 | Bacteria | 2184 |
| 92 | Ga0068857_101810895 | 3300005577 | Bacteria | 598 |
| 93 | Ga0068854_100089768 | 3300005578 | Bacteria | 2284 |
| 94 | Ga0068854_100528906 | 3300005578 | Bacteria | 997 |
| 95 | Ga0068854_100557438 | 3300005578 | Bacteria | 973 |
| 96 | Ga0068856_100368204 | 3300005614 | Bacteria | 1456 |
| 97 | Ga0068856_100447197 | 3300005614 | Bacteria | 1313 |
| 98 | Ga0068856_100936799 | 3300005614 | Bacteria | 885 |
| 99 | Ga0070702_100600198 | 3300005615 | Bacteria | 825 |
| 100 | Ga0068852_102087501 | 3300005616 | Bacteria | 589 |
| 101 | Ga0068859_100000658 | 3300005617 | Bacteria | 34599 |
| 102 | Ga0068859_100008741 | 3300005617 | Bacteria | 10234 |
| 103 | Ga0068859_100034349 | 3300005617 | Bacteria | 5090 |
| 104 | Ga0068859_100360048 | 3300005617 | Bacteria | 1550 |
| 105 | Ga0068859_100576570 | 3300005617 | Bacteria | 1219 |
| 106 | Ga0068859_101549260 | 3300005617 | Bacteria | 732 |
| 107 | Ga0068859_101777909 | 3300005617 | Bacteria | 681 |
| 108 | Ga0068864_100000125 | 3300005618 | Bacteria | 74686 |
| 109 | Ga0068864_100001114 | 3300005618 | Bacteria | 22461 |
| 110 | Ga0068864_100008551 | 3300005618 | Bacteria | 8448 |
| 111 | Ga0068864_100270715 | 3300005618 | Bacteria | 1583 |
| 112 | Ga0068864_100612293 | 3300005618 | Bacteria | 1058 |
| 113 | Ga0068864_101036376 | 3300005618 | Bacteria | 815 |
| 114 | Ga0068861_100017594 | 3300005719 | Bacteria | 5078 |
| 115 | Ga0068861_100324031 | 3300005719 | Bacteria | 1343 |
| 116 | Ga0068861_100521407 | 3300005719 | Bacteria | 1078 |
| 117 | Ga0068870_10063024 | 3300005840 | Bacteria | 1998 |
| 118 | Ga0068870_11128339 | 3300005840 | Bacteria | 565 |
| 119 | Ga0068870_11415080 | 3300005840 | Bacteria | 510 |
| 120 | Ga0068863_100000066 | 3300005841 | Bacteria | 117816 |
| 121 | Ga0068863_100000119 | 3300005841 | Bacteria | 82539 |
| 122 | Ga0068863_100006603 | 3300005841 | Bacteria | 11386 |
| 123 | Ga0068863_100036368 | 3300005841 | Bacteria | 4690 |
| 124 | Ga0068863_100074860 | 3300005841 | Bacteria | 3203 |
| 125 | Ga0068863_100099103 | 3300005841 | Bacteria | 2768 |
| 126 | Ga0068863_100240404 | 3300005841 | Bacteria | 1748 |
| 127 | Ga0068863_100767573 | 3300005841 | Bacteria | 960 |
| 128 | Ga0068858_100000136 | 3300005842 | Bacteria | 77380 |
| 129 | Ga0068858_100001636 | 3300005842 | Bacteria | 22861 |
| 130 | Ga0068858_100021861 | 3300005842 | Bacteria | 5975 |
| 131 | Ga0068858_100043046 | 3300005842 | Bacteria | 4187 |
| 132 | Ga0068858_100238465 | 3300005842 | Bacteria | 1725 |
| 133 | Ga0068858_100281195 | 3300005842 | Bacteria | 1584 |
| 134 | Ga0068858_100805192 | 3300005842 | Bacteria | 917 |
| 135 | Ga0068858_101830585 | 3300005842 | Bacteria | 600 |
| 136 | Ga0068860_100000507 | 3300005843 | Bacteria | 48348 |
| 137 | Ga0068860_100002642 | 3300005843 | Bacteria | 18640 |
| 138 | Ga0068860_100036580 | 3300005843 | Bacteria | 4703 |
| 139 | Ga0068860_100078297 | 3300005843 | Bacteria | 3143 |
| 140 | Ga0068860_100252610 | 3300005843 | Bacteria | 1717 |
| 141 | Ga0068860_100426902 | 3300005843 | Bacteria | 1315 |
| 142 | Ga0068860_100958106 | 3300005843 | Bacteria | 873 |
| 143 | Ga0068862_100000551 | 3300005844 | Bacteria | 39201 |
| 144 | Ga0068862_100001506 | 3300005844 | Bacteria | 21360 |
| 145 | Ga0068862_100004114 | 3300005844 | Bacteria | 12331 |
| 146 | Ga0068862_100019422 | 3300005844 | Bacteria | 5671 |
| 147 | Ga0068862_100020394 | 3300005844 | Bacteria | 5537 |
| 148 | Ga0068862_100159950 | 3300005844 | Bacteria | 2010 |
| 149 | Ga0068862_100469155 | 3300005844 | Bacteria | 1189 |
| 150 | Ga0068862_100527090 | 3300005844 | Bacteria | 1125 |
| 151 | Ga0081455_10190985 | 3300005937 | Bacteria | 1542 |
| 152 | Ga0070717_10014486 | 3300006028 | Bacteria | 6068 |
| 153 | Ga0075368_10085032 | 3300006042 | Bacteria | 1290 |
| 154 | Ga0075364_10003677 | 3300006051 | Bacteria | 8750 |
| 155 | Ga0075364_11152952 | 3300006051 | Bacteria | 526 |
| 156 | Ga0070712_100311140 | 3300006175 | Bacteria | 1278 |
| 157 | Ga0075367_10014602 | 3300006178 | Bacteria | 4253 |
| 158 | Ga0075369_10005143 | 3300006186 | Bacteria | 4873 |
| 159 | Ga0075366_10019110 | 3300006195 | Bacteria | 3960 |
| 160 | Ga0075366_10040927 | 3300006195 | Bacteria | 2742 |
| 161 | Ga0075366_10210033 | 3300006195 | Bacteria | 1185 |
| 162 | Ga0097621_101603748 | 3300006237 | Bacteria | 619 |
| 163 | Ga0075370_10466454 | 3300006353 | Bacteria | 760 |
| 164 | Ga0068871_100199218 | 3300006358 | Bacteria | 1728 |
| 165 | Ga0068871_100802712 | 3300006358 | Bacteria | 868 |
| 166 | Ga0068871_101324500 | 3300006358 | Bacteria | 678 |
| 167 | Ga0075434_100285818 | 3300006871 | Bacteria | 1669 |
| 168 | Ga0068865_100002000 | 3300006881 | Bacteria | 12032 |
| 169 | Ga0068865_100617916 | 3300006881 | Bacteria | 918 |
| 170 | Ga0097620_100000658 | 3300006931 | Bacteria | 34599 |
| 171 | Ga0097620_100008741 | 3300006931 | Bacteria | 10234 |
| 172 | Ga0097620_100034349 | 3300006931 | Bacteria | 5090 |
| 173 | Ga0097620_100360041 | 3300006931 | Bacteria | 1550 |
| 174 | Ga0097620_100576581 | 3300006931 | Bacteria | 1219 |
| 175 | Ga0097620_101548899 | 3300006931 | Bacteria | 732 |
| 176 | Ga0097620_101778039 | 3300006931 | Bacteria | 681 |
| 177 | Ga0105250_10007609 | 3300009092 | Bacteria | 4644 |
| 178 | Ga0105240_10144540 | 3300009093 | Bacteria | 2839 |
| 179 | Ga0105240_10270228 | 3300009093 | Bacteria | 1958 |
| 180 | Ga0105240_10316167 | 3300009093 | Bacteria | 1781 |
| 181 | Ga0105240_11416047 | 3300009093 | Bacteria | 730 |
| 182 | Ga0111539_10100965 | 3300009094 | Bacteria | 3387 |
| 183 | Ga0111539_12083509 | 3300009094 | Bacteria | 658 |
| 184 | Ga0105245_10044111 | 3300009098 | Bacteria | 3979 |
| 185 | Ga0105245_11175686 | 3300009098 | Bacteria | 815 |
| 186 | Ga0105247_10092384 | 3300009101 | Bacteria | 1922 |
| 187 | Ga0105243_10672565 | 3300009148 | Bacteria | 1006 |
| 188 | Ga0105243_11074835 | 3300009148 | Bacteria | 811 |
| 189 | Ga0105241_10786305 | 3300009174 | Bacteria | 875 |
| 190 | Ga0105248_10002412 | 3300009177 | Bacteria | 20747 |
| 191 | Ga0105248_10005197 | 3300009177 | Bacteria | 14344 |
| 192 | Ga0105248_10092559 | 3300009177 | Bacteria | 3405 |
| 193 | Ga0105248_10281479 | 3300009177 | Bacteria | 1872 |
| 194 | Ga0105248_10348494 | 3300009177 | Bacteria | 1667 |
| 195 | Ga0105248_10446752 | 3300009177 | Bacteria | 1457 |
| 196 | Ga0105248_10541741 | 3300009177 | Bacteria | 1313 |
| 197 | Ga0105248_10780300 | 3300009177 | Bacteria | 1078 |
| 198 | Ga0105248_10817129 | 3300009177 | Bacteria | 1052 |
| 199 | Ga0105248_11056934 | 3300009177 | Bacteria | 917 |
| 200 | Ga0105248_11164959 | 3300009177 | Bacteria | 871 |
| 201 | Ga0105237_10435108 | 3300009545 | Bacteria | 1317 |
| 202 | Ga0105237_10772580 | 3300009545 | Bacteria | 967 |
| 203 | Ga0105238_10047528 | 3300009551 | Bacteria | 4326 |
| 204 | Ga0105238_10537228 | 3300009551 | Bacteria | 1173 |
| 205 | Ga0105238_10905964 | 3300009551 | Bacteria | 900 |
| 206 | Ga0105238_11099049 | 3300009551 | Bacteria | 818 |
| 207 | Ga0105249_10000647 | 3300009553 | Bacteria | 31757 |
| 208 | Ga0105249_10688284 | 3300009553 | Bacteria | 1082 |
| 209 | Ga0105249_10747304 | 3300009553 | Bacteria | 1040 |
| 210 | Ga0105249_10780868 | 3300009553 | Bacteria | 1018 |
| 211 | Ga0105249_11402679 | 3300009553 | Bacteria | 771 |
| 212 | Ga0105249_12838008 | 3300009553 | Bacteria | 556 |
| 213 | Ga0105239_10702040 | 3300010375 | Bacteria | 1157 |
| 214 | Ga0105239_10798067 | 3300010375 | Bacteria | 1082 |
| 215 | Ga0105246_10210578 | 3300011119 | Bacteria | 1517 |
| 216 | Ga0157370_10455023 | 3300013104 | Bacteria | 1177 |
| 217 | Ga0157370_10473849 | 3300013104 | Bacteria | 1150 |
| 218 | Ga0157369_10410770 | 3300013105 | Bacteria | 1404 |
| 219 | Ga0157374_10484561 | 3300013296 | Bacteria | 1240 |
| 220 | Ga0157374_10921955 | 3300013296 | Bacteria | 891 |
| 221 | Ga0163162_10166096 | 3300013306 | Bacteria | 2331 |
| 222 | Ga0163162_10296137 | 3300013306 | Bacteria | 1750 |
| 223 | Ga0163162_11869829 | 3300013306 | Bacteria | 687 |
| 224 | Ga0157375_10059737 | 3300013308 | Bacteria | 3778 |
| 225 | Ga0157375_10088010 | 3300013308 | Bacteria | 3160 |
| 226 | Ga0157375_10672011 | 3300013308 | Bacteria | 1191 |
| 227 | Ga0157375_10976234 | 3300013308 | Bacteria | 988 |
| 228 | Ga0157375_11453498 | 3300013308 | Bacteria | 808 |
| 229 | Ga0157375_11455333 | 3300013308 | Bacteria | 808 |
| 230 | Ga0157375_13039338 | 3300013308 | Bacteria | 560 |
| 231 | Ga0163163_10000747 | 3300014325 | Bacteria | 27697 |
| 232 | Ga0163163_10035635 | 3300014325 | Bacteria | 4828 |
| 233 | Ga0163163_10036040 | 3300014325 | Bacteria | 4803 |
| 234 | Ga0163163_10086268 | 3300014325 | Bacteria | 3148 |
| 235 | Ga0163163_10086973 | 3300014325 | Bacteria | 3135 |
| 236 | Ga0163163_10284725 | 3300014325 | Bacteria | 1705 |
| 237 | Ga0163163_11501748 | 3300014325 | Bacteria | 735 |
| 238 | Ga0157377_10133223 | 3300014745 | Bacteria | 1520 |
| 239 | Ga0157379_10001591 | 3300014968 | Bacteria | 18725 |
| 240 | Ga0157379_10006169 | 3300014968 | Bacteria | 10322 |
| 241 | Ga0157379_10009800 | 3300014968 | Bacteria | 8348 |
| 242 | Ga0157379_10099588 | 3300014968 | Bacteria | 2609 |
| 243 | Ga0157379_10529441 | 3300014968 | Bacteria | 1095 |
| 244 | Ga0157376_11889106 | 3300014969 | Bacteria | 634 |
| 245 | Ga0182007_10066676 | 3300015262 | Bacteria | 1179 |
| 246 | Ga0163161_11617111 | 3300017792 | Bacteria | 572 |
| 247 | Ga0206356_10061775 | 3300020070 | Bacteria | 797 |
| 248 | Ga0213874_10026944 | 3300021377 | Bacteria | 1632 |
| 249 | Ga0213876_10017428 | 3300021384 | Bacteria | 3793 |
| 250 | Ga0209148_1027686 | 3300025254 | Bacteria | 870 |
| 251 | Ga0209676_1000308 | 3300025292 | Bacteria | 95847 |
| 252 | Ga0209676_1000320 | 3300025292 | Bacteria | 93515 |
| 253 | Ga0209051_1006510 | 3300025303 | Bacteria | 6567 |
| 254 | Ga0209257_1000338 | 3300025304 | Bacteria | 97721 |
| 255 | Ga0207697_10230297 | 3300025315 | Bacteria | 818 |
| 256 | Ga0207696_1014612 | 3300025711 | Bacteria | 2686 |
| 257 | Ga0207710_10163347 | 3300025900 | Bacteria | 1086 |
| 258 | Ga0207710_10316804 | 3300025900 | Bacteria | 790 |
| 259 | Ga0207688_10210727 | 3300025901 | Bacteria | 1167 |
| 260 | Ga0207688_10326514 | 3300025901 | Bacteria | 942 |
| 261 | Ga0207688_10353359 | 3300025901 | Bacteria | 906 |
| 262 | Ga0207645_10163495 | 3300025907 | Bacteria | 1457 |
| 263 | Ga0207643_10126958 | 3300025908 | Bacteria | 1515 |
| 264 | Ga0207643_11042518 | 3300025908 | Bacteria | 528 |
| 265 | Ga0207705_10137554 | 3300025909 | Bacteria | 1822 |
| 266 | Ga0207705_10850172 | 3300025909 | Bacteria | 707 |
| 267 | Ga0207707_10519370 | 3300025912 | Bacteria | 1014 |
| 268 | Ga0207695_10002610 | 3300025913 | Bacteria | 26389 |
| 269 | Ga0207695_10007189 | 3300025913 | Bacteria | 14236 |
| 270 | Ga0207695_10009967 | 3300025913 | Bacteria | 11671 |
| 271 | Ga0207695_10106175 | 3300025913 | Bacteria | 2794 |
| 272 | Ga0207695_11588306 | 3300025913 | Bacteria | 535 |
| 273 | Ga0207671_10440852 | 3300025914 | Bacteria | 1037 |
| 274 | Ga0207671_10973424 | 3300025914 | Bacteria | 669 |
| 275 | Ga0207693_10322962 | 3300025915 | Bacteria | 1208 |
| 276 | Ga0207693_11409298 | 3300025915 | Bacteria | 517 |
| 277 | Ga0207660_10363512 | 3300025917 | Bacteria | 1161 |
| 278 | Ga0207657_10206326 | 3300025919 | Bacteria | 1579 |
| 279 | Ga0207649_10593911 | 3300025920 | Bacteria | 851 |
| 280 | Ga0207649_10817524 | 3300025920 | Bacteria | 728 |
| 281 | Ga0207652_10145632 | 3300025921 | Bacteria | 2120 |
| 282 | Ga0207681_10008537 | 3300025923 | Bacteria | 6255 |
| 283 | Ga0207681_10062890 | 3300025923 | Bacteria | 2557 |
| 284 | Ga0207681_10651016 | 3300025923 | Bacteria | 873 |
| 285 | Ga0207681_11008640 | 3300025923 | Bacteria | 698 |
| 286 | Ga0207681_11804041 | 3300025923 | Bacteria | 510 |
| 287 | Ga0207694_10290496 | 3300025924 | Bacteria | 1344 |
| 288 | Ga0207694_10726189 | 3300025924 | Bacteria | 838 |
| 289 | Ga0207694_10752463 | 3300025924 | Bacteria | 823 |
| 290 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 291 | Ga0207650_10021394 | 3300025925 | Bacteria | 4571 |
| 292 | Ga0207650_10106996 | 3300025925 | Bacteria | 2160 |
| 293 | Ga0207650_10170200 | 3300025925 | Bacteria | 1731 |
| 294 | Ga0207650_10382861 | 3300025925 | Bacteria | 1162 |
| 295 | Ga0207650_10611340 | 3300025925 | Bacteria | 917 |
| 296 | Ga0207659_10011417 | 3300025926 | Bacteria | 5611 |
| 297 | Ga0207644_10004412 | 3300025931 | Bacteria | 9129 |
| 298 | Ga0207644_10457928 | 3300025931 | Bacteria | 1048 |
| 299 | Ga0207644_10685221 | 3300025931 | Bacteria | 854 |
| 300 | Ga0207690_10000737 | 3300025932 | Bacteria | 21081 |
| 301 | Ga0207706_10066738 | 3300025933 | Bacteria | 3166 |
| 302 | Ga0207706_10639466 | 3300025933 | Bacteria | 912 |
| 303 | Ga0207670_11026772 | 3300025936 | Bacteria | 694 |
| 304 | Ga0207704_10001149 | 3300025938 | Bacteria | 11769 |
| 305 | Ga0207704_10475201 | 3300025938 | Bacteria | 1002 |
| 306 | Ga0207665_10968757 | 3300025939 | Bacteria | 676 |
| 307 | Ga0207691_10117860 | 3300025940 | Bacteria | 2355 |
| 308 | Ga0207691_10191749 | 3300025940 | Bacteria | 1782 |
| 309 | Ga0207711_10006764 | 3300025941 | Bacteria | 9641 |
| 310 | Ga0207711_10011270 | 3300025941 | Bacteria | 7429 |
| 311 | Ga0207711_10057519 | 3300025941 | Bacteria | 3343 |
| 312 | Ga0207711_10150542 | 3300025941 | Bacteria | 2099 |
| 313 | Ga0207711_10282445 | 3300025941 | Bacteria | 1529 |
| 314 | Ga0207711_10298732 | 3300025941 | Bacteria | 1485 |
| 315 | Ga0207711_10545059 | 3300025941 | Bacteria | 1082 |
| 316 | Ga0207711_10723374 | 3300025941 | Bacteria | 928 |
| 317 | Ga0207711_10888085 | 3300025941 | Bacteria | 829 |
| 318 | Ga0207711_11192252 | 3300025941 | Bacteria | 703 |
| 319 | Ga0207711_11503358 | 3300025941 | Bacteria | 616 |
| 320 | Ga0207689_10000270 | 3300025942 | Bacteria | 46976 |
| 321 | Ga0207689_10234791 | 3300025942 | Bacteria | 1516 |
| 322 | Ga0207689_10404155 | 3300025942 | Bacteria | 1139 |
| 323 | Ga0207661_10365028 | 3300025944 | Bacteria | 1305 |
| 324 | Ga0207679_10042261 | 3300025945 | Bacteria | 3275 |
| 325 | Ga0207679_10113372 | 3300025945 | Bacteria | 2144 |
| 326 | Ga0207679_10518780 | 3300025945 | Bacteria | 1065 |
| 327 | Ga0207667_10129238 | 3300025949 | Bacteria | 2602 |
| 328 | Ga0207667_10142666 | 3300025949 | Bacteria | 2466 |
| 329 | Ga0207667_10291033 | 3300025949 | Bacteria | 1669 |
| 330 | Ga0207667_10597305 | 3300025949 | Bacteria | 1113 |
| 331 | Ga0207667_10641522 | 3300025949 | Bacteria | 1068 |
| 332 | Ga0207667_10928144 | 3300025949 | Bacteria | 861 |
| 333 | Ga0207651_10096418 | 3300025960 | Bacteria | 2181 |
| 334 | Ga0207712_10019237 | 3300025961 | Bacteria | 4457 |
| 335 | Ga0207712_10500857 | 3300025961 | Bacteria | 1038 |
| 336 | Ga0207712_10986534 | 3300025961 | Bacteria | 747 |
| 337 | Ga0207712_11213678 | 3300025961 | Bacteria | 673 |
| 338 | Ga0207712_11552942 | 3300025961 | Bacteria | 593 |
| 339 | Ga0207668_10000019 | 3300025972 | Bacteria | 152108 |
| 340 | Ga0207668_10001481 | 3300025972 | Bacteria | 13761 |
| 341 | Ga0207668_10002967 | 3300025972 | Bacteria | 9948 |
| 342 | Ga0207668_10067315 | 3300025972 | Bacteria | 2542 |
| 343 | Ga0207668_10131840 | 3300025972 | Bacteria | 1909 |
| 344 | Ga0207668_10141984 | 3300025972 | Bacteria | 1848 |
| 345 | Ga0207640_10895196 | 3300025981 | Bacteria | 775 |
| 346 | Ga0207658_10000384 | 3300025986 | Bacteria | 43187 |
| 347 | Ga0207658_10005402 | 3300025986 | Bacteria | 8767 |
| 348 | Ga0207658_10016890 | 3300025986 | Bacteria | 5023 |
| 349 | Ga0207658_10016937 | 3300025986 | Bacteria | 5017 |
| 350 | Ga0207658_10488657 | 3300025986 | Bacteria | 1095 |
| 351 | Ga0207658_10587660 | 3300025986 | Bacteria | 999 |
| 352 | Ga0207658_10983785 | 3300025986 | Bacteria | 769 |
| 353 | Ga0207658_11317083 | 3300025986 | Bacteria | 660 |
| 354 | Ga0207677_10078840 | 3300026023 | Bacteria | 2353 |
| 355 | Ga0207677_11610545 | 3300026023 | Bacteria | 601 |
| 356 | Ga0207703_10000065 | 3300026035 | Bacteria | 126087 |
| 357 | Ga0207703_10000884 | 3300026035 | Bacteria | 29465 |
| 358 | Ga0207703_10004121 | 3300026035 | Bacteria | 12002 |
| 359 | Ga0207703_10010902 | 3300026035 | Bacteria | 7085 |
| 360 | Ga0207703_10175564 | 3300026035 | Bacteria | 1888 |
| 361 | Ga0207703_10495807 | 3300026035 | Bacteria | 1146 |
| 362 | Ga0207639_10009353 | 3300026041 | Bacteria | 6757 |
| 363 | Ga0207639_10095343 | 3300026041 | Bacteria | 2391 |
| 364 | Ga0207639_12287668 | 3300026041 | Bacteria | 502 |
| 365 | Ga0207678_10872845 | 3300026067 | Bacteria | 795 |
| 366 | Ga0207678_11046240 | 3300026067 | Bacteria | 723 |
| 367 | Ga0207678_11552351 | 3300026067 | Bacteria | 584 |
| 368 | Ga0207708_10095437 | 3300026075 | Bacteria | 2297 |
| 369 | Ga0207708_10509353 | 3300026075 | Bacteria | 1010 |
| 370 | Ga0207702_10196376 | 3300026078 | Bacteria | 1868 |
| 371 | Ga0207702_12451541 | 3300026078 | Bacteria | 508 |
| 372 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 373 | Ga0207641_10029739 | 3300026088 | Bacteria | 4518 |
| 374 | Ga0207641_10031038 | 3300026088 | Bacteria | 4430 |
| 375 | Ga0207641_10033654 | 3300026088 | Bacteria | 4257 |
| 376 | Ga0207641_10051707 | 3300026088 | Bacteria | 3479 |
| 377 | Ga0207641_10151392 | 3300026088 | Bacteria | 2101 |
| 378 | Ga0207641_10848983 | 3300026088 | Bacteria | 905 |
| 379 | Ga0207641_11879215 | 3300026088 | Bacteria | 600 |
| 380 | Ga0207641_12069509 | 3300026088 | Bacteria | 570 |
| 381 | Ga0207648_10003469 | 3300026089 | Bacteria | 16532 |
| 382 | Ga0207648_11204150 | 3300026089 | Bacteria | 711 |
| 383 | Ga0207648_11776398 | 3300026089 | Bacteria | 578 |
| 384 | Ga0207676_10000148 | 3300026095 | Bacteria | 61016 |
| 385 | Ga0207676_10001859 | 3300026095 | Bacteria | 15463 |
| 386 | Ga0207676_10002341 | 3300026095 | Bacteria | 13555 |
| 387 | Ga0207676_10212164 | 3300026095 | Bacteria | 1718 |
| 388 | Ga0207676_10244399 | 3300026095 | Bacteria | 1612 |
| 389 | Ga0207676_10245949 | 3300026095 | Bacteria | 1607 |
| 390 | Ga0207674_10010555 | 3300026116 | Bacteria | 10454 |
| 391 | Ga0207674_11324584 | 3300026116 | Bacteria | 689 |
| 392 | Ga0207675_100035652 | 3300026118 | Bacteria | 4640 |
| 393 | Ga0207683_10027153 | 3300026121 | Bacteria | 4947 |
| 394 | Ga0207683_10402481 | 3300026121 | Bacteria | 1259 |
| 395 | Ga0207698_11438426 | 3300026142 | Bacteria | 704 |
| 396 | Ga0209999_1089808 | 3300027543 | Bacteria | 595 |
| 397 | Ga0209813_10048916 | 3300027866 | Bacteria | 1314 |
| 398 | Ga0209974_10411414 | 3300027876 | Bacteria | 532 |
| 399 | Ga0268266_10000611 | 3300028379 | Bacteria | 48682 |
| 400 | Ga0268266_10005978 | 3300028379 | Bacteria | 11242 |
| 401 | Ga0268266_10017036 | 3300028379 | Bacteria | 6205 |
| 402 | Ga0268266_10026093 | 3300028379 | Bacteria | 4971 |
| 403 | Ga0268266_10033212 | 3300028379 | Bacteria | 4388 |
| 404 | Ga0268266_10133005 | 3300028379 | Bacteria | 2226 |
| 405 | Ga0268265_10000798 | 3300028380 | Bacteria | 29969 |
| 406 | Ga0268265_10022102 | 3300028380 | Bacteria | 4465 |
| 407 | Ga0268265_10082303 | 3300028380 | Bacteria | 2545 |
| 408 | Ga0268265_10212745 | 3300028380 | Bacteria | 1686 |
| 409 | Ga0268265_10680907 | 3300028380 | Bacteria | 991 |
| 410 | Ga0268265_12169563 | 3300028380 | Bacteria | 562 |
| 411 | Ga0268264_10000014 | 3300028381 | Bacteria | 509962 |
| 412 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 413 | Ga0268264_10010578 | 3300028381 | Bacteria | 7627 |
| 414 | Ga0268264_10042818 | 3300028381 | Bacteria | 3749 |
| 415 | Ga0268264_10043016 | 3300028381 | Bacteria | 3741 |
| 416 | Ga0268264_10061419 | 3300028381 | Bacteria | 3152 |
| 417 | Ga0268264_11286676 | 3300028381 | Bacteria | 741 |
| 418 | Ga0265334_10008247 | 3300028573 | Bacteria | 4435 |
| 419 | Ga0265334_10095516 | 3300028573 | Bacteria | 1081 |
| 420 | Ga0265334_10273382 | 3300028573 | Bacteria | 580 |
| 421 | Ga0307517_10002922 | 3300028786 | Bacteria | 27037 |
| 422 | Ga0307517_10119287 | 3300028786 | Bacteria | 1959 |
| 423 | Ga0265338_10044452 | 3300028800 | Bacteria | 4101 |
| 424 | Ga0265338_10203015 | 3300028800 | Bacteria | 1493 |
| 425 | Ga0265760_10046378 | 3300031090 | Bacteria | 1304 |
| 426 | Ga0265331_10192190 | 3300031250 | Bacteria | 921 |
| 427 | Ga0265327_10129293 | 3300031251 | Bacteria | 1190 |
| 428 | Ga0307513_10000541 | 3300031456 | Bacteria | 54065 |
| 429 | Ga0307513_10004541 | 3300031456 | Bacteria | 18519 |
| 430 | Ga0307513_10006209 | 3300031456 | Bacteria | 15662 |
| 431 | Ga0307513_10670897 | 3300031456 | Bacteria | 743 |
| 432 | Ga0307508_10744489 | 3300031616 | Bacteria | 593 |
| 433 | Ga0307508_10809242 | 3300031616 | Bacteria | 555 |
| 434 | Ga0316575_10082097 | 3300031665 | Bacteria | 1300 |
| 435 | Ga0316579_10628966 | 3300031691 | Bacteria | 519 |
| 436 | Ga0265314_10204623 | 3300031711 | Bacteria | 1164 |
| 437 | Ga0316576_10203706 | 3300031727 | Bacteria | 1490 |
| 438 | Ga0316578_10306143 | 3300031728 | Bacteria | 949 |
| 439 | Ga0307516_10000030 | 3300031730 | Bacteria | 159694 |
| 440 | Ga0316577_10503502 | 3300031733 | Bacteria | 688 |
| 441 | Ga0307407_10264265 | 3300031903 | Bacteria | 1185 |
| 442 | Ga0307412_10311132 | 3300031911 | Bacteria | 1249 |
| 443 | Ga0307415_100674173 | 3300032126 | Bacteria | 930 |
| 444 | Ga0316583_10052072 | 3300032133 | Bacteria | 1440 |
| 445 | Ga0316585_10006969 | 3300032137 | Bacteria | 3244 |
| 446 | Ga0316593_10026979 | 3300032168 | Bacteria | 1839 |
| 447 | Ga0307510_10010004 | 3300033180 | Bacteria | 11271 |
| 448 | Ga0316592_1053995 | 3300033524 | Bacteria | 899 |
| 449 | Ga0316588_1002162 | 3300033528 | Bacteria | 3385 |
| 450 | Ga0316596_1060058 | 3300033541 | Bacteria | 1014 |
| 451 | Ga0373944_0075747 | 3300035089 | Bacteria | 1103 |
| 452 | Ga0373952_0135334 | 3300035092 | Bacteria | 680 |
| 453 | Ga0373936_0000661 | 3300035113 | Bacteria | 11938 |
| 454 | Ga0373939_0306334 | 3300035114 | Bacteria | 635 |
| 455 | Ga0373945_0228785 | 3300035116 | Bacteria | 780 |
| 456 | Ga0373946_0772685 | 3300035171 | Bacteria | 505 |
| 457 | Ga0373955_0735403 | 3300035172 | Bacteria | 606 |
| 458 | Ga0373955_0880521 | 3300035172 | Bacteria | 551 |
| 459 | Ga0373931_0664428 | 3300035691 | Bacteria | 686 |
| 460 | Ga0373935_0045430 | 3300035692 | Bacteria | 2772 |
| 461 | Ga0373935_0210569 | 3300035692 | Bacteria | 1347 |
| 462 | Ga0373927_0001653 | 3300035695 | Bacteria | 16672 |
| 463 | Ga0373927_0419978 | 3300035695 | Bacteria | 883 |
| 464 | Ga0373933_0929132 | 3300035724 | Bacteria | 573 |
| 465 | Ga0373947_0239020 | 3300035725 | Bacteria | 1198 |
| 466 | Ga0373937_0663710 | 3300036401 | Bacteria | 988 |
| 467 | Ga0373937_0702585 | 3300036401 | Bacteria | 958 |
| 468 | Ga0373937_2029626 | 3300036401 | Bacteria | 521 |
| 469 | Ga0316582_0365070 | 3300036647 | Bacteria | 993 |
| 470 | Ga0316584_0082675 | 3300036712 | Bacteria | 2405 |
| 471 | Ga0373925_0000049 | 3300037068 | Bacteria | 128065 |
| 472 | Ga0373925_1596390 | 3300037068 | Bacteria | 533 |
| 473 | Ga0395899_0003271 | 3300037312 | Bacteria | 12846 |
| 474 | Ga0395899_0106800 | 3300037312 | Bacteria | 2015 |
| 475 | Ga0395899_0167832 | 3300037312 | Bacteria | 1547 |
| 476 | Ga0395900_0013143 | 3300037418 | Bacteria | 8461 |
| 477 | Ga0395900_0237473 | 3300037418 | Bacteria | 1830 |
| 478 | Ga0395900_0362792 | 3300037418 | Bacteria | 1420 |
| 479 | Ga0395900_0448637 | 3300037418 | Bacteria | 1246 |
| 480 | Ga0395900_1854096 | 3300037418 | Bacteria | 513 |
| 481 | Ga0395898_0007710 | 3300037466 | Bacteria | 11430 |
| 482 | Ga0395898_0097502 | 3300037466 | Bacteria | 2823 |
| 483 | Ga0395898_0258051 | 3300037466 | Bacteria | 1662 |
| 484 | Ga0395898_0424126 | 3300037466 | Bacteria | 1267 |
| 485 | Ga0395905_0004961 | 3300037471 | Bacteria | 13716 |
| 486 | Ga0395905_0097470 | 3300037471 | Bacteria | 2761 |
| 487 | Ga0395905_0260774 | 3300037471 | Bacteria | 1618 |
| 488 | Ga0395905_0280129 | 3300037471 | Bacteria | 1553 |
| 489 | Ga0316581_0216814 | 3300037588 | Bacteria | 588 |
| 490 | Ga0395901_0000021 | 3300038443 | Bacteria | 307734 |
| 491 | Ga0395901_0266167 | 3300038443 | Bacteria | 1783 |
| 492 | Ga0395901_0631373 | 3300038443 | Bacteria | 1077 |
| 493 | Ga0436365_1445717 | 3300039437 | Bacteria | 836 |
| 494 | Ga0436360_0053752 | 3300039438 | Bacteria | 809 |
| 495 | Ga0436363_1219245 | 3300039450 | Bacteria | 943 |
| 496 | Ga0436363_1424271 | 3300039450 | Bacteria | 1722 |
| 497 | Ga0451789_0017912 | 3300041443 | Bacteria | 728 |
| 498 | Ga0451807_2521828 | 3300041486 | Bacteria | 678 |
| 499 | Ga0451845_0570884 | 3300041501 | Bacteria | 793 |
| 500 | Ga0451847_0447433 | 3300041503 | Bacteria | 535 |
| 501 | Ga0451843_0800999 | 3300041509 | Bacteria | 535 |
| 502 | Ga0439455_0253308 | 3300042012 | Bacteria | 516 |
| 503 | Ga0466961_0739925 | 3300044693 | Bacteria | 588 |
| 504 | Ga0466959_0140908 | 3300045049 | Bacteria | 1704 |
| 505 | Ga0495590_0001271 | 3300046457 | Bacteria | 10961 |
| 506 | Ga0495638_0000185 | 3300046460 | Bacteria | 95220 |
| 507 | Ga0495638_0001213 | 3300046460 | Bacteria | 24573 |
| 508 | Ga0495638_0513788 | 3300046460 | Bacteria | 601 |
| 509 | Ga0495664_0351076 | 3300046477 | Bacteria | 888 |
| 510 | Ga0495594_0408096 | 3300046499 | Bacteria | 773 |
| 511 | Ga0495583_0090078 | 3300046506 | Bacteria | 1322 |
| 512 | Ga0495606_0242676 | 3300046507 | Bacteria | 1004 |
| 513 | Ga0495606_0534817 | 3300046507 | Bacteria | 586 |
| 514 | Ga0495610_0001542 | 3300046512 | Bacteria | 20292 |
| 515 | Ga0495610_0002504 | 3300046512 | Bacteria | 15353 |
| 516 | Ga0495620_0043942 | 3300046515 | Bacteria | 1944 |
| 517 | Ga0495631_0001061 | 3300046518 | Bacteria | 17065 |
| 518 | Ga0495632_0196110 | 3300046519 | Bacteria | 921 |
| 519 | Ga0495637_0061700 | 3300046520 | Bacteria | 1536 |
| 520 | Ga0495643_0162821 | 3300046522 | Bacteria | 1096 |
| 521 | Ga0495648_0001143 | 3300046524 | Bacteria | 26818 |
| 522 | Ga0495642_0009268 | 3300046528 | Bacteria | 3769 |
| 523 | Ga0495642_0181114 | 3300046528 | Bacteria | 917 |
| 524 | Ga0495654_0041442 | 3300046530 | Bacteria | 2290 |
| 525 | Ga0495654_0092590 | 3300046530 | Bacteria | 1401 |
| 526 | Ga0495587_0313837 | 3300046536 | Bacteria | 876 |
| 527 | Ga0495598_0230819 | 3300046537 | Bacteria | 679 |
| 528 | Ga0495609_0221746 | 3300046538 | Bacteria | 785 |
| 529 | Ga0495597_0000940 | 3300046542 | Bacteria | 22494 |
| 530 | Ga0495597_0016383 | 3300046542 | Bacteria | 3498 |
| 531 | Ga0495622_0000495 | 3300046557 | Bacteria | 24692 |
| 532 | Ga0495668_0000196 | 3300046616 | Bacteria | 89097 |
| 533 | Ga0495668_0032996 | 3300046616 | Bacteria | 2910 |
| 534 | Ga0495668_0560261 | 3300046616 | Bacteria | 631 |
| 535 | Ga0495668_0766457 | 3300046616 | Bacteria | 534 |
| 536 | Ga0495611_0003249 | 3300046648 | Bacteria | 7188 |
| 537 | Ga0495611_0137916 | 3300046648 | Bacteria | 1139 |
| 538 | Ga0495625_0032672 | 3300046660 | Bacteria | 3856 |
| 539 | Ga0495625_0057282 | 3300046660 | Bacteria | 2772 |
| 540 | Ga0495625_0165352 | 3300046660 | Bacteria | 1479 |
| 541 | Ga0495625_0178490 | 3300046660 | Bacteria | 1414 |
| 542 | Ga0495625_0273602 | 3300046660 | Bacteria | 1089 |
| 543 | Ga0495623_0617671 | 3300046679 | Bacteria | 562 |
| 544 | Ga0495669_0000081 | 3300046684 | Bacteria | 63806 |
| 545 | Ga0495669_0335451 | 3300046684 | Bacteria | 730 |
| 546 | Ga0495624_0347427 | 3300046690 | Bacteria | 892 |
| 547 | Ga0495589_0028386 | 3300046794 | Bacteria | 2824 |
| 548 | Ga0495660_0294120 | 3300046810 | Bacteria | 738 |
| 549 | Ga0495660_0396677 | 3300046810 | Bacteria | 605 |
| 550 | Ga0495581_0199504 | 3300047315 | Bacteria | 1170 |
| 551 | Ga0495636_0066666 | 3300047318 | Bacteria | 1531 |
| 552 | Ga0495672_0078397 | 3300047320 | Bacteria | 1848 |
| 553 | Ga0495677_0153499 | 3300047445 | Bacteria | 887 |
| 554 | Ga0495673_0000818 | 3300047469 | Bacteria | 29209 |
| 555 | Ga0495681_0141055 | 3300047470 | Bacteria | 1018 |
| 556 | Ga0495686_0001281 | 3300047472 | Bacteria | 28417 |
| 557 | Ga0495686_0041270 | 3300047472 | Bacteria | 2938 |
| 558 | Ga0495615_0162049 | 3300048090 | Bacteria | 672 |
| 559 | Ga0496100_1077026 | 3300048903 | Bacteria | 633 |
| 560 | Ga0496102_0002509 | 3300048905 | Bacteria | 15658 |
| 561 | Ga0496102_0073352 | 3300048905 | Bacteria | 3146 |
| 562 | Ga0496102_1582765 | 3300048905 | Bacteria | 574 |
| 563 | Ga0496103_0024487 | 3300048906 | Bacteria | 3645 |
| 564 | Ga0496103_0160165 | 3300048906 | Bacteria | 1443 |
| 565 | Ga0496104_0633865 | 3300048907 | Bacteria | 978 |
| 566 | Ga0496106_0252465 | 3300048909 | Bacteria | 1410 |
| 567 | Ga0496106_0534374 | 3300048909 | Bacteria | 941 |
| 568 | Ga0496106_1576793 | 3300048909 | Bacteria | 503 |
| 569 | Ga0496108_0007812 | 3300048911 | Bacteria | 8667 |
| 570 | Ga0496108_0552258 | 3300048911 | Bacteria | 1005 |
| 571 | Ga0496108_0557627 | 3300048911 | Bacteria | 999 |
| 572 | Ga0496109_0050984 | 3300048912 | Bacteria | 3769 |
| 573 | Ga0496109_0072857 | 3300048912 | Bacteria | 3156 |
| 574 | Ga0496109_0950802 | 3300048912 | Bacteria | 797 |
| 575 | Ga0496111_0787805 | 3300048914 | Bacteria | 688 |
| 576 | Ga0496112_0008645 | 3300048915 | Bacteria | 9130 |
| 577 | Ga0496112_0577307 | 3300048915 | Bacteria | 1057 |
| 578 | Ga0496112_1406924 | 3300048915 | Bacteria | 612 |
| 579 | Ga0496113_0024190 | 3300048916 | Bacteria | 4314 |
| 580 | Ga0496114_1569067 | 3300048917 | Bacteria | 546 |
| 581 | Ga0496115_0002000 | 3300048918 | Bacteria | 14571 |
| 582 | Ga0496115_0328711 | 3300048918 | Bacteria | 1249 |
| 583 | Ga0496121_0315459 | 3300048924 | Bacteria | 1055 |
| 584 | Ga0496124_0006584 | 3300048927 | Bacteria | 12614 |
| 585 | Ga0496125_0004898 | 3300048928 | Bacteria | 15174 |
| 586 | Ga0496126_0016290 | 3300048929 | Bacteria | 7439 |
| 587 | Ga0495678_002464 | 3300049459 | Bacteria | 12517 |
| 588 | Ga0501319_033485 | 3300049535 | Bacteria | 502 |
| 589 | Ga0501321_056868 | 3300049537 | Bacteria | 583 |
| 590 | Ga0501323_058899 | 3300049539 | Bacteria | 596 |
| 591 | Ga0501032_0062232 | 3300049569 | Bacteria | 2501 |
| 592 | Ga0501033_0009831 | 3300049570 | Bacteria | 7342 |
| 593 | Ga0501033_0034390 | 3300049570 | Bacteria | 3802 |
| 594 | Ga0501034_0010729 | 3300049571 | Bacteria | 9514 |
| 595 | Ga0501034_0014620 | 3300049571 | Bacteria | 8082 |
| 596 | Ga0501036_0005690 | 3300049572 | Bacteria | 10113 |
| 597 | Ga0501037_0279183 | 3300049573 | Bacteria | 1164 |
| 598 | Ga0501039_0282617 | 3300049575 | Bacteria | 1304 |
| 599 | Ga0501041_0219241 | 3300049577 | Bacteria | 1194 |
| 600 | Ga0501043_0003372 | 3300049579 | Bacteria | 13153 |
| 601 | Ga0501046_0798038 | 3300049580 | Bacteria | 662 |
| 602 | Ga0501047_0006419 | 3300049581 | Bacteria | 11065 |
| 603 | Ga0501047_0023674 | 3300049581 | Bacteria | 5896 |
| 604 | Ga0501047_0041638 | 3300049581 | Bacteria | 4439 |
| 605 | Ga0501047_0233610 | 3300049581 | Bacteria | 1691 |
| 606 | Ga0501047_0917077 | 3300049581 | Bacteria | 689 |
| 607 | Ga0501047_1453281 | 3300049581 | Bacteria | 501 |
| 608 | Ga0501067_0135901 | 3300049583 | Bacteria | 1369 |
| 609 | Ga0501069_0262305 | 3300049585 | Bacteria | 1009 |
| 610 | Ga0501070_0006572 | 3300049586 | Bacteria | 9896 |
| 611 | Ga0501072_0063615 | 3300049588 | Bacteria | 2910 |
| 612 | Ga0501073_0080545 | 3300049589 | Bacteria | 2265 |
| 613 | Ga0501073_1026257 | 3300049589 | Bacteria | 567 |
| 614 | Ga0501074_0015079 | 3300049590 | Bacteria | 5622 |
| 615 | Ga0501074_0160556 | 3300049590 | Bacteria | 1605 |
| 616 | Ga0501076_0379193 | 3300049592 | Bacteria | 1162 |
| 617 | Ga0501257_005509 | 3300049686 | Bacteria | 2793 |
| 618 | Ga0501080_0170167 | 3300049742 | Bacteria | 2010 |
| 619 | Ga0501083_0006235 | 3300049744 | Bacteria | 8459 |
| 620 | Ga0501083_0288143 | 3300049744 | Bacteria | 1068 |
| 621 | Ga0501241_165563 | 3300049758 | Bacteria | 517 |
| 622 | Ga0501035_0000477 | 3300049822 | Bacteria | 44891 |
| 623 | Ga0501035_0158137 | 3300049822 | Bacteria | 1963 |
| 624 | Ga0501035_0957946 | 3300049822 | Bacteria | 675 |
| 625 | Ga0501044_0000960 | 3300049823 | Bacteria | 34653 |
| 626 | Ga0501044_0006907 | 3300049823 | Bacteria | 12498 |
| 627 | Ga0501044_0837799 | 3300049823 | Bacteria | 797 |
| 628 | Ga0501044_0944010 | 3300049823 | Bacteria | 736 |
| 629 | Ga0501045_0711244 | 3300049824 | Bacteria | 741 |
| 630 | nmdc:mga00v17_2978_c1 | 3300050491 | Bacteria | 8691 |
| 631 | nmdc:mga0k408_240195_c1 | 3300050493 | Bacteria | 1082 |
| 632 | nmdc:mga0k408_29733_c1 | 3300050493 | Bacteria | 1604 |
| 633 | nmdc:mga0k408_94172_c1 | 3300050493 | Bacteria | 1761 |
| 634 | nmdc:mga06z11_55883_c1 | 3300050494 | Bacteria | 2040 |
| 635 | nmdc:mga04h51_79017_c1 | 3300050495 | Bacteria | 1164 |
| 636 | nmdc:mga07m45_226460_c1 | 3300050496 | Bacteria | 1088 |
| 637 | nmdc:mga07m45_759303_c1 | 3300050496 | Bacteria | 557 |
| 638 | nmdc:mga0a205_417460_c1 | 3300050515 | Bacteria | 830 |
| 639 | nmdc:mga0sz30_131077_c1 | 3300050516 | Bacteria | 1105 |
| 640 | nmdc:mga0sz30_279806_c1 | 3300050516 | Bacteria | 743 |
| 641 | Ga0495601_0934764 | 3300053077 | Bacteria | 547 |
| 642 | Ga0500635_0000258 | 3300053080 | Bacteria | 21708 |
| 643 | Ga0500578_0001019 | 3300053086 | Bacteria | 30808 |
| 644 | Ga0500578_0177525 | 3300053086 | Bacteria | 1314 |
| 645 | Ga0500643_000903 | 3300053087 | Bacteria | 18807 |
| 646 | Ga0500643_078768 | 3300053087 | Bacteria | 907 |
| 647 | Ga0500644_0000239 | 3300053088 | Bacteria | 31347 |
| 648 | Ga0500644_0492032 | 3300053088 | Bacteria | 539 |
| 649 | Ga0500646_0113682 | 3300053090 | Bacteria | 863 |
| 650 | Ga0500651_0009280 | 3300053093 | Bacteria | 5835 |
| 651 | Ga0500566_0013864 | 3300053094 | Bacteria | 4741 |
| 652 | Ga0500641_0000638 | 3300053096 | Bacteria | 12658 |
| 653 | Ga0500641_0001268 | 3300053096 | Bacteria | 8966 |
| 654 | Ga0500650_0186401 | 3300053098 | Bacteria | 949 |
| 655 | Ga0500555_046364 | 3300053103 | Bacteria | 1198 |
| 656 | Ga0500556_0087657 | 3300053104 | Bacteria | 1185 |
| 657 | Ga0500557_027599 | 3300053105 | Bacteria | 1689 |
| 658 | Ga0500562_000838 | 3300053108 | Bacteria | 7439 |
| 659 | Ga0500562_005366 | 3300053108 | Bacteria | 3219 |
| 660 | Ga0500562_064221 | 3300053108 | Bacteria | 988 |
| 661 | Ga0500569_009105 | 3300053109 | Bacteria | 2297 |
| 662 | Ga0500594_0000224 | 3300053118 | Bacteria | 13802 |
| 663 | Ga0500595_060299 | 3300053119 | Bacteria | 1148 |
| 664 | Ga0500607_029942 | 3300053121 | Bacteria | 3004 |
| 665 | Ga0500608_000202 | 3300053122 | Bacteria | 23754 |
| 666 | Ga0500608_002769 | 3300053122 | Bacteria | 6458 |
| 667 | Ga0500614_013145 | 3300053123 | Bacteria | 1815 |
| 668 | Ga0500642_0356595 | 3300053130 | Bacteria | 648 |
| 669 | Ga0500658_0171311 | 3300053134 | Bacteria | 986 |
| 670 | Ga0500559_0021200 | 3300053136 | Bacteria | 2752 |
| 671 | Ga0500559_0070649 | 3300053136 | Bacteria | 1571 |
| 672 | Ga0500564_000506 | 3300053138 | Bacteria | 11497 |
| 673 | Ga0500564_350826 | 3300053138 | Bacteria | 549 |
| 674 | Ga0500577_0110265 | 3300053142 | Bacteria | 1135 |
| 675 | Ga0500590_016265 | 3300053148 | Bacteria | 3846 |
| 676 | Ga0500603_004385 | 3300053150 | Bacteria | 3024 |
| 677 | Ga0500604_0015784 | 3300053151 | Bacteria | 2073 |
| 678 | Ga0500616_0032840 | 3300053153 | Bacteria | 2836 |
| 679 | Ga0500616_0034126 | 3300053153 | Bacteria | 2773 |
| 680 | Ga0500616_0147160 | 3300053153 | Bacteria | 1094 |
| 681 | Ga0500619_016052 | 3300053154 | Bacteria | 2052 |
| 682 | Ga0500619_101560 | 3300053154 | Bacteria | 976 |
| 683 | Ga0500620_117008 | 3300053155 | Bacteria | 934 |
| 684 | Ga0500622_0001017 | 3300053156 | Bacteria | 23547 |
| 685 | Ga0500622_0007239 | 3300053156 | Bacteria | 6318 |
| 686 | Ga0500622_0007501 | 3300053156 | Bacteria | 6191 |
| 687 | Ga0500622_0035247 | 3300053156 | Bacteria | 2619 |
| 688 | Ga0500622_0180011 | 3300053156 | Bacteria | 977 |
| 689 | Ga0500624_022231 | 3300053157 | Bacteria | 1030 |
| 690 | Ga0500634_0242761 | 3300053161 | Bacteria | 755 |
| 691 | Ga0500638_006452 | 3300053162 | Bacteria | 4803 |
| 692 | Ga0500639_196769 | 3300053163 | Bacteria | 871 |
| 693 | Ga0500636_0030429 | 3300053177 | Bacteria | 3192 |
| 694 | Ga0500637_0011924 | 3300053178 | Bacteria | 4514 |
| 695 | Ga0500637_0069871 | 3300053178 | Bacteria | 2019 |
| 696 | Ga0500576_177844 | 3300053725 | Bacteria | 755 |
| 697 | Ga0500625_040366 | 3300053729 | Bacteria | 2196 |
| 698 | Ga0500645_000199 | 3300053730 | Bacteria | 46484 |
| 699 | Ga0500645_002806 | 3300053730 | Bacteria | 7508 |
| 700 | Ga0500596_007741 | 3300053735 | Bacteria | 1743 |
| 701 | Ga0501084_0006768 | 3300054114 | Bacteria | 9421 |
| 702 | Ga0500661_049846 | 3300055283 | Bacteria | 748 |
| 703 | Ga0500661_068000 | 3300055283 | Bacteria | 649 |
| 704 | Ga0587073_0121262 | 3300059492 | Bacteria | 706 |
| 705 | Ga0587092_113200 | 3300059512 | Bacteria | 572 |
| 706 | Ga0587067_234698 | 3300059640 | Bacteria | 503 |
| 707 | Ga0501082_0047765 | 3300060353 | Bacteria | 3688 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0034390 | Ga0501033_0034390_965_1297 | 104 |
| 2 | 3300049571 | Ga0501034_0010729 | Ga0501034_0010729_1806_2138 | 104 |
| 3 | 3300049572 | Ga0501036_0005690 | Ga0501036_0005690_1235_1567 | 104 |
| 4 | 3300049575 | Ga0501039_0282617 | Ga0501039_0282617_823_1155 | 104 |
| 5 | 3300049579 | Ga0501043_0003372 | Ga0501043_0003372_7409_7741 | 104 |
| 6 | 3300049581 | Ga0501047_1453281 | Ga0501047_1453281_129_461 | 104 |
| 7 | 3300049585 | Ga0501069_0262305 | Ga0501069_0262305_21_353 | 104 |
| 8 | 3300049586 | Ga0501070_0006572 | Ga0501070_0006572_6103_6435 | 104 |
| 9 | 3300049589 | Ga0501073_1026257 | Ga0501073_1026257_15_347 | 104 |
| 10 | 3300049590 | Ga0501074_0015079 | Ga0501074_0015079_3668_4000 | 104 |
| 11 | 3300049822 | Ga0501035_0000477 | Ga0501035_0000477_21752_22084 | 104 |
| 12 | 3300005293 | Ga0065715_10134927 | Ga0065715_101349273 | 106 |
| 13 | 3300005328 | Ga0070676_10178648 | Ga0070676_101786482 | 106 |
| 14 | 3300005330 | Ga0070690_100291837 | Ga0070690_1002918371 | 106 |
| 15 | 3300005331 | Ga0070670_100000456 | Ga0070670_1000004566 | 106 |
| 16 | 3300005331 | Ga0070670_100042264 | Ga0070670_1000422646 | 106 |
| 17 | 3300005334 | Ga0068869_100068449 | Ga0068869_1000684495 | 106 |
| 18 | 3300005334 | Ga0068869_101530919 | Ga0068869_1015309191 | 106 |
| 19 | 3300005338 | Ga0068868_100100641 | Ga0068868_1001006412 | 106 |
| 20 | 3300005340 | Ga0070689_100771642 | Ga0070689_1007716422 | 106 |
| 21 | 3300005347 | Ga0070668_100094897 | Ga0070668_1000948972 | 106 |
| 22 | 3300005347 | Ga0070668_100099959 | Ga0070668_1000999595 | 106 |
| 23 | 3300005347 | Ga0070668_102019917 | Ga0070668_1020199171 | 106 |
| 24 | 3300005353 | Ga0070669_100072981 | Ga0070669_1000729815 | 106 |
| 25 | 3300005353 | Ga0070669_100434927 | Ga0070669_1004349272 | 106 |
| 26 | 3300005354 | Ga0070675_100137670 | Ga0070675_1001376703 | 106 |
| 27 | 3300005354 | Ga0070675_101344275 | Ga0070675_1013442751 | 106 |
| 28 | 3300005355 | Ga0070671_100655497 | Ga0070671_1006554971 | 106 |
| 29 | 3300005365 | Ga0070688_101028237 | Ga0070688_1010282371 | 106 |
| 30 | 3300005365 | Ga0070688_101471346 | Ga0070688_1014713461 | 106 |
| 31 | 3300005367 | Ga0070667_100018158 | Ga0070667_1000181588 | 106 |
| 32 | 3300005367 | Ga0070667_101281218 | Ga0070667_1012812182 | 106 |
| 33 | 3300005440 | Ga0070705_100193153 | Ga0070705_1001931532 | 106 |
| 34 | 3300005441 | Ga0070700_100417570 | Ga0070700_1004175702 | 106 |
| 35 | 3300005455 | Ga0070663_100321384 | Ga0070663_1003213842 | 106 |
| 36 | 3300005455 | Ga0070663_102046216 | Ga0070663_1020462161 | 106 |
| 37 | 3300005459 | Ga0068867_100000391 | Ga0068867_1000003918 | 106 |
| 38 | 3300005543 | Ga0070672_100071914 | Ga0070672_1000719145 | 106 |
| 39 | 3300005543 | Ga0070672_100869143 | Ga0070672_1008691433 | 106 |
| 40 | 3300005546 | Ga0070696_100360652 | Ga0070696_1003606522 | 106 |
| 41 | 3300005548 | Ga0070665_100049119 | Ga0070665_1000491193 | 106 |
| 42 | 3300005549 | Ga0070704_100483662 | Ga0070704_1004836621 | 106 |
| 43 | 3300005563 | Ga0068855_100696335 | Ga0068855_1006963352 | 106 |
| 44 | 3300005564 | Ga0070664_100975742 | Ga0070664_1009757421 | 106 |
| 45 | 3300005577 | Ga0068857_100140345 | Ga0068857_1001403454 | 106 |
| 46 | 3300005578 | Ga0068854_100089768 | Ga0068854_1000897682 | 106 |
| 47 | 3300005578 | Ga0068854_100528906 | Ga0068854_1005289061 | 106 |
| 48 | 3300005615 | Ga0070702_100600198 | Ga0070702_1006001981 | 106 |
| 49 | 3300005617 | Ga0068859_100008741 | Ga0068859_1000087418 | 106 |
| 50 | 3300005617 | Ga0068859_100576570 | Ga0068859_1005765702 | 106 |
| 51 | 3300005617 | Ga0068859_101549260 | Ga0068859_1015492601 | 106 |
| 52 | 3300005618 | Ga0068864_100008551 | Ga0068864_1000085512 | 106 |
| 53 | 3300005719 | Ga0068861_100017594 | Ga0068861_1000175942 | 106 |
| 54 | 3300005719 | Ga0068861_100324031 | Ga0068861_1003240312 | 106 |
| 55 | 3300005840 | Ga0068870_10063024 | Ga0068870_100630243 | 106 |
| 56 | 3300005840 | Ga0068870_11128339 | Ga0068870_111283392 | 106 |
| 57 | 3300005841 | Ga0068863_100036368 | Ga0068863_1000363688 | 106 |
| 58 | 3300005841 | Ga0068863_100074860 | Ga0068863_1000748602 | 106 |
| 59 | 3300005841 | Ga0068863_100099103 | Ga0068863_1000991035 | 106 |
| 60 | 3300005842 | Ga0068858_100001636 | Ga0068858_10000163621 | 106 |
| 61 | 3300005842 | Ga0068858_100281195 | Ga0068858_1002811953 | 106 |
| 62 | 3300005842 | Ga0068858_101830585 | Ga0068858_1018305851 | 106 |
| 63 | 3300005843 | Ga0068860_100002642 | Ga0068860_10000264215 | 106 |
| 64 | 3300005843 | Ga0068860_100078297 | Ga0068860_1000782977 | 106 |
| 65 | 3300005843 | Ga0068860_100426902 | Ga0068860_1004269022 | 106 |
| 66 | 3300005844 | Ga0068862_100001506 | Ga0068862_1000015062 | 106 |
| 67 | 3300005844 | Ga0068862_100020394 | Ga0068862_1000203943 | 106 |
| 68 | 3300005844 | Ga0068862_100469155 | Ga0068862_1004691553 | 106 |
| 69 | 3300005937 | Ga0081455_10190985 | Ga0081455_101909851 | 106 |
| 70 | 3300006871 | Ga0075434_100285818 | Ga0075434_1002858182 | 106 |
| 71 | 3300006931 | Ga0097620_100008741 | Ga0097620_1000087418 | 106 |
| 72 | 3300006931 | Ga0097620_100576581 | Ga0097620_1005765812 | 106 |
| 73 | 3300006931 | Ga0097620_101548899 | Ga0097620_1015488992 | 106 |
| 74 | 3300009094 | Ga0111539_10100965 | Ga0111539_101009654 | 106 |
| 75 | 3300009094 | Ga0111539_12083509 | Ga0111539_120835092 | 106 |
| 76 | 3300009098 | Ga0105245_10044111 | Ga0105245_100441112 | 106 |
| 77 | 3300009101 | Ga0105247_10092384 | Ga0105247_100923843 | 106 |
| 78 | 3300009177 | Ga0105248_10541741 | Ga0105248_105417412 | 106 |
| 79 | 3300009553 | Ga0105249_10688284 | Ga0105249_106882842 | 106 |
| 80 | 3300009553 | Ga0105249_12838008 | Ga0105249_128380081 | 106 |
| 81 | 3300010375 | Ga0105239_10702040 | Ga0105239_107020402 | 106 |
| 82 | 3300013296 | Ga0157374_10484561 | Ga0157374_104845612 | 106 |
| 83 | 3300013306 | Ga0163162_10166096 | Ga0163162_101660962 | 106 |
| 84 | 3300013306 | Ga0163162_11869829 | Ga0163162_118698292 | 106 |
| 85 | 3300013308 | Ga0157375_10059737 | Ga0157375_100597372 | 106 |
| 86 | 3300013308 | Ga0157375_11455333 | Ga0157375_114553332 | 106 |
| 87 | 3300014325 | Ga0163163_10036040 | Ga0163163_100360408 | 106 |
| 88 | 3300014968 | Ga0157379_10006169 | Ga0157379_100061698 | 106 |
| 89 | 3300025315 | Ga0207697_10230297 | Ga0207697_102302971 | 106 |
| 90 | 3300025900 | Ga0207710_10163347 | Ga0207710_101633472 | 106 |
| 91 | 3300025901 | Ga0207688_10210727 | Ga0207688_102107272 | 106 |
| 92 | 3300025901 | Ga0207688_10353359 | Ga0207688_103533591 | 106 |
| 93 | 3300025907 | Ga0207645_10163495 | Ga0207645_101634952 | 106 |
| 94 | 3300025908 | Ga0207643_10126958 | Ga0207643_101269582 | 106 |
| 95 | 3300025923 | Ga0207681_10008537 | Ga0207681_100085378 | 106 |
| 96 | 3300025925 | Ga0207650_10106996 | Ga0207650_101069962 | 106 |
| 97 | 3300025925 | Ga0207650_10170200 | Ga0207650_101702002 | 106 |
| 98 | 3300025926 | Ga0207659_10011417 | Ga0207659_100114174 | 106 |
| 99 | 3300025933 | Ga0207706_10066738 | Ga0207706_100667382 | 106 |
| 100 | 3300025936 | Ga0207670_11026772 | Ga0207670_110267722 | 106 |
| 101 | 3300025938 | Ga0207704_10475201 | Ga0207704_104752012 | 106 |
| 102 | 3300025940 | Ga0207691_10117860 | Ga0207691_101178602 | 106 |
| 103 | 3300025940 | Ga0207691_10191749 | Ga0207691_101917493 | 106 |
| 104 | 3300025941 | Ga0207711_10150542 | Ga0207711_101505422 | 106 |
| 105 | 3300025942 | Ga0207689_10000270 | Ga0207689_100002706 | 106 |
| 106 | 3300025945 | Ga0207679_10113372 | Ga0207679_101133723 | 106 |
| 107 | 3300025949 | Ga0207667_10641522 | Ga0207667_106415222 | 106 |
| 108 | 3300025961 | Ga0207712_11552942 | Ga0207712_115529421 | 106 |
| 109 | 3300025972 | Ga0207668_10067315 | Ga0207668_100673152 | 106 |
| 110 | 3300025981 | Ga0207640_10895196 | Ga0207640_108951962 | 106 |
| 111 | 3300025986 | Ga0207658_10016890 | Ga0207658_100168902 | 106 |
| 112 | 3300025986 | Ga0207658_10488657 | Ga0207658_104886572 | 106 |
| 113 | 3300025986 | Ga0207658_10983785 | Ga0207658_109837853 | 106 |
| 114 | 3300026023 | Ga0207677_10078840 | Ga0207677_100788402 | 106 |
| 115 | 3300026035 | Ga0207703_10000884 | Ga0207703_100008845 | 106 |
| 116 | 3300026067 | Ga0207678_10872845 | Ga0207678_108728452 | 106 |
| 117 | 3300026067 | Ga0207678_11552351 | Ga0207678_115523511 | 106 |
| 118 | 3300026075 | Ga0207708_10095437 | Ga0207708_100954372 | 106 |
| 119 | 3300026075 | Ga0207708_10509353 | Ga0207708_105093533 | 106 |
| 120 | 3300026088 | Ga0207641_10029739 | Ga0207641_100297392 | 106 |
| 121 | 3300026088 | Ga0207641_10031038 | Ga0207641_100310386 | 106 |
| 122 | 3300026088 | Ga0207641_10151392 | Ga0207641_101513921 | 106 |
| 123 | 3300026089 | Ga0207648_10003469 | Ga0207648_1000346914 | 106 |
| 124 | 3300026089 | Ga0207648_11204150 | Ga0207648_112041503 | 106 |
| 125 | 3300026095 | Ga0207676_10002341 | Ga0207676_100023414 | 106 |
| 126 | 3300026095 | Ga0207676_10244399 | Ga0207676_102443991 | 106 |
| 127 | 3300026116 | Ga0207674_10010555 | Ga0207674_100105552 | 106 |
| 128 | 3300026118 | Ga0207675_100035652 | Ga0207675_1000356528 | 106 |
| 129 | 3300028379 | Ga0268266_10133005 | Ga0268266_101330053 | 106 |
| 130 | 3300028380 | Ga0268265_10022102 | Ga0268265_100221022 | 106 |
| 131 | 3300028381 | Ga0268264_10042818 | Ga0268264_100428182 | 106 |
| 132 | 3300028381 | Ga0268264_10061419 | Ga0268264_100614192 | 106 |
| 133 | 3300028381 | Ga0268264_11286676 | Ga0268264_112866762 | 106 |
| 134 | 3300035114 | Ga0373939_0306334 | Ga0373939_0306334_21_347 | 106 |
| 135 | 3300048905 | Ga0496102_0073352 | Ga0496102_0073352_661_987 | 106 |
| 136 | 3300048906 | Ga0496103_0024487 | Ga0496103_0024487_993_1319 | 106 |
| 137 | 3300048907 | Ga0496104_0633865 | Ga0496104_0633865_463_789 | 106 |
| 138 | 3300048909 | Ga0496106_0252465 | Ga0496106_0252465_606_932 | 106 |
| 139 | 3300048911 | Ga0496108_0552258 | Ga0496108_0552258_221_547 | 106 |
| 140 | 3300048911 | Ga0496108_0557627 | Ga0496108_0557627_545_871 | 106 |
| 141 | 3300048912 | Ga0496109_0050984 | Ga0496109_0050984_390_716 | 106 |
| 142 | 3300048914 | Ga0496111_0787805 | Ga0496111_0787805_269_595 | 106 |
| 143 | 3300049577 | Ga0501041_0219241 | Ga0501041_0219241_734_1060 | 106 |
| 144 | 3300049592 | Ga0501076_0379193 | Ga0501076_0379193_418_744 | 106 |
| 145 | 3300049824 | Ga0501045_0711244 | Ga0501045_0711244_108_434 | 106 |
| 146 | 3300050515 | nmdc:mga0a205_417460_c1 | nmdc:mga0a205_417460_c1_429_755 | 106 |
| 147 | 3300059512 | Ga0587092_113200 | Ga0587092_113200_158_484 | 106 |
| 148 | 3300059640 | Ga0587067_234698 | Ga0587067_234698_48_398 | 106 |
| 149 | 3300015262 | Ga0182007_10066676 | Ga0182007_100666762 | 107 |
| 150 | iso_pu_bacteria | 2643221614 | 2644087345 | 107 |
| 151 | iso_pu_bacteria | 2643221661 | 2644344611 | 107 |
| 152 | iso_pu_bacteria | 2643221666 | 2644366705 | 107 |
| 153 | 3300005337 | Ga0070682_100089299 | Ga0070682_1000892992 | 108 |
| 154 | 3300005366 | Ga0070659_100003826 | Ga0070659_10000382610 | 108 |
| 155 | 3300005539 | Ga0068853_100013327 | Ga0068853_1000133273 | 108 |
| 156 | 3300005564 | Ga0070664_100035738 | Ga0070664_1000357382 | 108 |
| 157 | 3300006358 | Ga0068871_100802712 | Ga0068871_1008027122 | 108 |
| 158 | 3300009148 | Ga0105243_11074835 | Ga0105243_110748352 | 108 |
| 159 | 3300009177 | Ga0105248_10348494 | Ga0105248_103484942 | 108 |
| 160 | 3300013104 | Ga0157370_10473849 | Ga0157370_104738492 | 108 |
| 161 | 3300025915 | Ga0207693_11409298 | Ga0207693_114092981 | 108 |
| 162 | 3300025932 | Ga0207690_10000737 | Ga0207690_100007373 | 108 |
| 163 | 3300025941 | Ga0207711_10282445 | Ga0207711_102824452 | 108 |
| 164 | 3300025945 | Ga0207679_10042261 | Ga0207679_100422612 | 108 |
| 165 | 3300026041 | Ga0207639_10009353 | Ga0207639_100093534 | 108 |
| 166 | 3300026121 | Ga0207683_10402481 | Ga0207683_104024811 | 108 |
| 167 | 3300049570 | Ga0501033_0009831 | Ga0501033_0009831_5755_6081 | 108 |
| 168 | 3300049571 | Ga0501034_0014620 | Ga0501034_0014620_4830_5156 | 108 |
| 169 | 3300049573 | Ga0501037_0279183 | Ga0501037_0279183_302_628 | 108 |
| 170 | 3300049822 | Ga0501035_0957946 | Ga0501035_0957946_26_352 | 108 |
| 171 | 3300049823 | Ga0501044_0000960 | Ga0501044_0000960_14016_14342 | 108 |
| 172 | 3300005347 | Ga0070668_100001157 | Ga0070668_1000011572 | 109 |
| 173 | 3300005347 | Ga0070668_100001210 | Ga0070668_10000121017 | 109 |
| 174 | 3300005353 | Ga0070669_100012619 | Ga0070669_1000126193 | 109 |
| 175 | 3300005355 | Ga0070671_100012583 | Ga0070671_1000125832 | 109 |
| 176 | 3300005366 | Ga0070659_102117124 | Ga0070659_1021171241 | 109 |
| 177 | 3300005367 | Ga0070667_100003061 | Ga0070667_10000306112 | 109 |
| 178 | 3300005367 | Ga0070667_100153467 | Ga0070667_1001534672 | 109 |
| 179 | 3300005459 | Ga0068867_100722910 | Ga0068867_1007229101 | 109 |
| 180 | 3300005548 | Ga0070665_100000744 | Ga0070665_10000074425 | 109 |
| 181 | 3300005548 | Ga0070665_100021958 | Ga0070665_1000219582 | 109 |
| 182 | 3300005548 | Ga0070665_100033955 | Ga0070665_1000339553 | 109 |
| 183 | 3300005563 | Ga0068855_100324870 | Ga0068855_1003248701 | 109 |
| 184 | 3300005614 | Ga0068856_100368204 | Ga0068856_1003682042 | 109 |
| 185 | 3300005616 | Ga0068852_102087501 | Ga0068852_1020875011 | 109 |
| 186 | 3300005617 | Ga0068859_100000658 | Ga0068859_10000065819 | 109 |
| 187 | 3300005617 | Ga0068859_101777909 | Ga0068859_1017779092 | 109 |
| 188 | 3300005618 | Ga0068864_100270715 | Ga0068864_1002707152 | 109 |
| 189 | 3300005618 | Ga0068864_101036376 | Ga0068864_1010363762 | 109 |
| 190 | 3300005719 | Ga0068861_100521407 | Ga0068861_1005214072 | 109 |
| 191 | 3300005841 | Ga0068863_100006603 | Ga0068863_1000066034 | 109 |
| 192 | 3300005842 | Ga0068858_100043046 | Ga0068858_1000430464 | 109 |
| 193 | 3300005842 | Ga0068858_100238465 | Ga0068858_1002384652 | 109 |
| 194 | 3300005843 | Ga0068860_100036580 | Ga0068860_1000365802 | 109 |
| 195 | 3300005843 | Ga0068860_100958106 | Ga0068860_1009581062 | 109 |
| 196 | 3300005844 | Ga0068862_100019422 | Ga0068862_1000194225 | 109 |
| 197 | 3300005844 | Ga0068862_100159950 | Ga0068862_1001599502 | 109 |
| 198 | 3300006042 | Ga0075368_10085032 | Ga0075368_100850322 | 109 |
| 199 | 3300006051 | Ga0075364_10003677 | Ga0075364_100036773 | 109 |
| 200 | 3300006051 | Ga0075364_11152952 | Ga0075364_111529521 | 109 |
| 201 | 3300006178 | Ga0075367_10014602 | Ga0075367_100146025 | 109 |
| 202 | 3300006353 | Ga0075370_10466454 | Ga0075370_104664542 | 109 |
| 203 | 3300006881 | Ga0068865_100002000 | Ga0068865_1000020002 | 109 |
| 204 | 3300006931 | Ga0097620_100000658 | Ga0097620_10000065819 | 109 |
| 205 | 3300006931 | Ga0097620_101778039 | Ga0097620_1017780392 | 109 |
| 206 | 3300009093 | Ga0105240_10270228 | Ga0105240_102702283 | 109 |
| 207 | 3300009174 | Ga0105241_10786305 | Ga0105241_107863051 | 109 |
| 208 | 3300009177 | Ga0105248_10002412 | Ga0105248_1000241217 | 109 |
| 209 | 3300009177 | Ga0105248_10780300 | Ga0105248_107803002 | 109 |
| 210 | 3300009177 | Ga0105248_11056934 | Ga0105248_110569342 | 109 |
| 211 | 3300009545 | Ga0105237_10435108 | Ga0105237_104351082 | 109 |
| 212 | 3300009553 | Ga0105249_10747304 | Ga0105249_107473042 | 109 |
| 213 | 3300009553 | Ga0105249_11402679 | Ga0105249_114026792 | 109 |
| 214 | 3300013308 | Ga0157375_11453498 | Ga0157375_114534982 | 109 |
| 215 | 3300014325 | Ga0163163_10000747 | Ga0163163_1000074713 | 109 |
| 216 | 3300014325 | Ga0163163_10086973 | Ga0163163_100869732 | 109 |
| 217 | 3300014968 | Ga0157379_10001591 | Ga0157379_100015919 | 109 |
| 218 | 3300017792 | Ga0163161_11617111 | Ga0163161_116171111 | 109 |
| 219 | 3300025913 | Ga0207695_11588306 | Ga0207695_115883061 | 109 |
| 220 | 3300025914 | Ga0207671_10440852 | Ga0207671_104408522 | 109 |
| 221 | 3300025923 | Ga0207681_10062890 | Ga0207681_100628902 | 109 |
| 222 | 3300025925 | Ga0207650_10382861 | Ga0207650_103828612 | 109 |
| 223 | 3300025931 | Ga0207644_10004412 | Ga0207644_1000441210 | 109 |
| 224 | 3300025938 | Ga0207704_10001149 | Ga0207704_100011499 | 109 |
| 225 | 3300025941 | Ga0207711_10011270 | Ga0207711_100112705 | 109 |
| 226 | 3300025941 | Ga0207711_10545059 | Ga0207711_105450592 | 109 |
| 227 | 3300025941 | Ga0207711_10888085 | Ga0207711_108880851 | 109 |
| 228 | 3300025949 | Ga0207667_10597305 | Ga0207667_105973051 | 109 |
| 229 | 3300025961 | Ga0207712_10500857 | Ga0207712_105008572 | 109 |
| 230 | 3300025972 | Ga0207668_10000019 | Ga0207668_1000001964 | 109 |
| 231 | 3300025972 | Ga0207668_10001481 | Ga0207668_1000148112 | 109 |
| 232 | 3300025986 | Ga0207658_10005402 | Ga0207658_100054023 | 109 |
| 233 | 3300025986 | Ga0207658_10016937 | Ga0207658_100169371 | 109 |
| 234 | 3300026035 | Ga0207703_10004121 | Ga0207703_100041212 | 109 |
| 235 | 3300026067 | Ga0207678_11046240 | Ga0207678_110462402 | 109 |
| 236 | 3300026078 | Ga0207702_12451541 | Ga0207702_124515411 | 109 |
| 237 | 3300026088 | Ga0207641_10051707 | Ga0207641_100517072 | 109 |
| 238 | 3300026088 | Ga0207641_11879215 | Ga0207641_118792152 | 109 |
| 239 | 3300027543 | Ga0209999_1089808 | Ga0209999_10898081 | 109 |
| 240 | 3300027866 | Ga0209813_10048916 | Ga0209813_100489161 | 109 |
| 241 | 3300028379 | Ga0268266_10000611 | Ga0268266_1000061119 | 109 |
| 242 | 3300028379 | Ga0268266_10026093 | Ga0268266_100260933 | 109 |
| 243 | 3300028379 | Ga0268266_10033212 | Ga0268266_100332125 | 109 |
| 244 | 3300028380 | Ga0268265_10082303 | Ga0268265_100823032 | 109 |
| 245 | 3300028381 | Ga0268264_10010578 | Ga0268264_100105783 | 109 |
| 246 | 3300035089 | Ga0373944_0075747 | Ga0373944_0075747_487_816 | 109 |
| 247 | 3300035116 | Ga0373945_0228785 | Ga0373945_0228785_426_755 | 109 |
| 248 | 3300035172 | Ga0373955_0735403 | Ga0373955_0735403_162_503 | 109 |
| 249 | 3300035692 | Ga0373935_0045430 | Ga0373935_0045430_2263_2592 | 109 |
| 250 | 3300035695 | Ga0373927_0001653 | Ga0373927_0001653_7744_8073 | 109 |
| 251 | 3300035725 | Ga0373947_0239020 | Ga0373947_0239020_19_348 | 109 |
| 252 | 3300036401 | Ga0373937_2029626 | Ga0373937_2029626_46_375 | 109 |
| 253 | 3300037068 | Ga0373925_0000049 | Ga0373925_0000049_10015_10344 | 109 |
| 254 | 3300037068 | Ga0373925_1596390 | Ga0373925_1596390_123_452 | 109 |
| 255 | 3300037418 | Ga0395900_0013143 | Ga0395900_0013143_3006_3335 | 109 |
| 256 | 3300037418 | Ga0395900_0362792 | Ga0395900_0362792_742_1071 | 109 |
| 257 | 3300037466 | Ga0395898_0258051 | Ga0395898_0258051_652_981 | 109 |
| 258 | 3300037471 | Ga0395905_0097470 | Ga0395905_0097470_1203_1532 | 109 |
| 259 | 3300037471 | Ga0395905_0260774 | Ga0395905_0260774_797_1126 | 109 |
| 260 | 3300037471 | Ga0395905_0280129 | Ga0395905_0280129_632_961 | 109 |
| 261 | 3300038443 | Ga0395901_0631373 | Ga0395901_0631373_262_591 | 109 |
| 262 | 3300045049 | Ga0466959_0140908 | Ga0466959_0140908_44_385 | 109 |
| 263 | 3300046616 | Ga0495668_0560261 | Ga0495668_0560261_16_345 | 109 |
| 264 | 3300046684 | Ga0495669_0335451 | Ga0495669_0335451_109_438 | 109 |
| 265 | 3300048090 | Ga0495615_0162049 | Ga0495615_0162049_278_655 | 109 |
| 266 | 3300048905 | Ga0496102_1582765 | Ga0496102_1582765_191_520 | 109 |
| 267 | 3300049539 | Ga0501323_058899 | Ga0501323_058899_199_528 | 109 |
| 268 | 3300049569 | Ga0501032_0062232 | Ga0501032_0062232_440_844 | 109 |
| 269 | 3300050491 | nmdc:mga00v17_2978_c1 | nmdc:mga00v17_2978_c1_2340_2669 | 109 |
| 270 | 3300050493 | nmdc:mga0k408_94172_c1 | nmdc:mga0k408_94172_c1_374_703 | 109 |
| 271 | 3300050494 | nmdc:mga06z11_55883_c1 | nmdc:mga06z11_55883_c1_987_1316 | 109 |
| 272 | 3300050495 | nmdc:mga04h51_79017_c1 | nmdc:mga04h51_79017_c1_500_829 | 109 |
| 273 | 3300050496 | nmdc:mga07m45_759303_c1 | nmdc:mga07m45_759303_c1_217_546 | 109 |
| 274 | 3300053087 | Ga0500643_000903 | Ga0500643_000903_18288_18617 | 109 |
| 275 | 3300053096 | Ga0500641_0000638 | Ga0500641_0000638_5048_5377 | 109 |
| 276 | 3300053098 | Ga0500650_0186401 | Ga0500650_0186401_71_400 | 109 |
| 277 | 3300053108 | Ga0500562_064221 | Ga0500562_064221_33_365 | 109 |
| 278 | 3300053130 | Ga0500642_0356595 | Ga0500642_0356595_263_592 | 109 |
| 279 | 3300053151 | Ga0500604_0015784 | Ga0500604_0015784_435_764 | 109 |
| 280 | 3300053153 | Ga0500616_0032840 | Ga0500616_0032840_515_844 | 109 |
| 281 | 3300053153 | Ga0500616_0034126 | Ga0500616_0034126_2061_2390 | 109 |
| 282 | 3300053156 | Ga0500622_0035247 | Ga0500622_0035247_1866_2198 | 109 |
| 283 | 3300053730 | Ga0500645_000199 | Ga0500645_000199_38910_39239 | 109 |
| 284 | 3300053730 | Ga0500645_002806 | Ga0500645_002806_6207_6536 | 109 |
| 285 | 3300059492 | Ga0587073_0121262 | Ga0587073_0121262_258_593 | 109 |
| 286 | 3300003791 | Ga0055530_10004751 | Ga0055530_100047512 | 110 |
| 287 | 3300003794 | Ga0055531_10001345 | Ga0055531_100013456 | 110 |
| 288 | 3300005327 | Ga0070658_10066333 | Ga0070658_100663333 | 110 |
| 289 | 3300005327 | Ga0070658_10289389 | Ga0070658_102893892 | 110 |
| 290 | 3300005327 | Ga0070658_10863680 | Ga0070658_108636801 | 110 |
| 291 | 3300005329 | Ga0070683_101132713 | Ga0070683_1011327132 | 110 |
| 292 | 3300005331 | Ga0070670_100000022 | Ga0070670_10000002256 | 110 |
| 293 | 3300005331 | Ga0070670_100133578 | Ga0070670_1001335783 | 110 |
| 294 | 3300005334 | Ga0068869_101050744 | Ga0068869_1010507441 | 110 |
| 295 | 3300005334 | Ga0068869_101167203 | Ga0068869_1011672031 | 110 |
| 296 | 3300005335 | Ga0070666_10021858 | Ga0070666_100218584 | 110 |
| 297 | 3300005335 | Ga0070666_10362318 | Ga0070666_103623182 | 110 |
| 298 | 3300005336 | Ga0070680_100532103 | Ga0070680_1005321032 | 110 |
| 299 | 3300005338 | Ga0068868_100620635 | Ga0068868_1006206352 | 110 |
| 300 | 3300005339 | Ga0070660_100064715 | Ga0070660_1000647153 | 110 |
| 301 | 3300005340 | Ga0070689_101648867 | Ga0070689_1016488671 | 110 |
| 302 | 3300005344 | Ga0070661_101077437 | Ga0070661_1010774371 | 110 |
| 303 | 3300005347 | Ga0070668_100007207 | Ga0070668_1000072072 | 110 |
| 304 | 3300005347 | Ga0070668_100028982 | Ga0070668_1000289822 | 110 |
| 305 | 3300005347 | Ga0070668_100424745 | Ga0070668_1004247452 | 110 |
| 306 | 3300005353 | Ga0070669_100697790 | Ga0070669_1006977902 | 110 |
| 307 | 3300005354 | Ga0070675_101144236 | Ga0070675_1011442361 | 110 |
| 308 | 3300005355 | Ga0070671_100268298 | Ga0070671_1002682982 | 110 |
| 309 | 3300005355 | Ga0070671_100517825 | Ga0070671_1005178251 | 110 |
| 310 | 3300005364 | Ga0070673_100125525 | Ga0070673_1001255251 | 110 |
| 311 | 3300005367 | Ga0070667_100000369 | Ga0070667_10000036910 | 110 |
| 312 | 3300005367 | Ga0070667_100020340 | Ga0070667_1000203402 | 110 |
| 313 | 3300005367 | Ga0070667_101461340 | Ga0070667_1014613402 | 110 |
| 314 | 3300005445 | Ga0070708_100000083 | Ga0070708_10000008331 | 110 |
| 315 | 3300005456 | Ga0070678_100388221 | Ga0070678_1003882212 | 110 |
| 316 | 3300005457 | Ga0070662_100036465 | Ga0070662_1000364652 | 110 |
| 317 | 3300005457 | Ga0070662_101066775 | Ga0070662_1010667751 | 110 |
| 318 | 3300005458 | Ga0070681_10173842 | Ga0070681_101738422 | 110 |
| 319 | 3300005530 | Ga0070679_100018957 | Ga0070679_1000189573 | 110 |
| 320 | 3300005539 | Ga0068853_100119847 | Ga0068853_1001198472 | 110 |
| 321 | 3300005539 | Ga0068853_100549815 | Ga0068853_1005498152 | 110 |
| 322 | 3300005539 | Ga0068853_101777143 | Ga0068853_1017771431 | 110 |
| 323 | 3300005548 | Ga0070665_100002444 | Ga0070665_10000244410 | 110 |
| 324 | 3300005548 | Ga0070665_100043150 | Ga0070665_1000431504 | 110 |
| 325 | 3300005563 | Ga0068855_100085443 | Ga0068855_1000854432 | 110 |
| 326 | 3300005563 | Ga0068855_100096809 | Ga0068855_1000968092 | 110 |
| 327 | 3300005577 | Ga0068857_101810895 | Ga0068857_1018108951 | 110 |
| 328 | 3300005578 | Ga0068854_100557438 | Ga0068854_1005574382 | 110 |
| 329 | 3300005614 | Ga0068856_100447197 | Ga0068856_1004471972 | 110 |
| 330 | 3300005614 | Ga0068856_100936799 | Ga0068856_1009367992 | 110 |
| 331 | 3300005617 | Ga0068859_100034349 | Ga0068859_1000343494 | 110 |
| 332 | 3300005617 | Ga0068859_100360048 | Ga0068859_1003600482 | 110 |
| 333 | 3300005618 | Ga0068864_100000125 | Ga0068864_10000012514 | 110 |
| 334 | 3300005618 | Ga0068864_100001114 | Ga0068864_10000111410 | 110 |
| 335 | 3300005618 | Ga0068864_100612293 | Ga0068864_1006122931 | 110 |
| 336 | 3300005840 | Ga0068870_11415080 | Ga0068870_114150801 | 110 |
| 337 | 3300005841 | Ga0068863_100000066 | Ga0068863_10000006661 | 110 |
| 338 | 3300005841 | Ga0068863_100000119 | Ga0068863_10000011984 | 110 |
| 339 | 3300005841 | Ga0068863_100240404 | Ga0068863_1002404042 | 110 |
| 340 | 3300005841 | Ga0068863_100767573 | Ga0068863_1007675732 | 110 |
| 341 | 3300005842 | Ga0068858_100000136 | Ga0068858_10000013648 | 110 |
| 342 | 3300005842 | Ga0068858_100021861 | Ga0068858_1000218612 | 110 |
| 343 | 3300005842 | Ga0068858_100805192 | Ga0068858_1008051922 | 110 |
| 344 | 3300005843 | Ga0068860_100000507 | Ga0068860_10000050710 | 110 |
| 345 | 3300005843 | Ga0068860_100252610 | Ga0068860_1002526102 | 110 |
| 346 | 3300005844 | Ga0068862_100000551 | Ga0068862_10000055137 | 110 |
| 347 | 3300005844 | Ga0068862_100004114 | Ga0068862_1000041142 | 110 |
| 348 | 3300005844 | Ga0068862_100527090 | Ga0068862_1005270901 | 110 |
| 349 | 3300006028 | Ga0070717_10014486 | Ga0070717_100144864 | 110 |
| 350 | 3300006175 | Ga0070712_100311140 | Ga0070712_1003111402 | 110 |
| 351 | 3300006186 | Ga0075369_10005143 | Ga0075369_100051432 | 110 |
| 352 | 3300006195 | Ga0075366_10019110 | Ga0075366_100191104 | 110 |
| 353 | 3300006195 | Ga0075366_10040927 | Ga0075366_100409275 | 110 |
| 354 | 3300006195 | Ga0075366_10210033 | Ga0075366_102100332 | 110 |
| 355 | 3300006237 | Ga0097621_101603748 | Ga0097621_1016037481 | 110 |
| 356 | 3300006358 | Ga0068871_100199218 | Ga0068871_1001992182 | 110 |
| 357 | 3300006358 | Ga0068871_101324500 | Ga0068871_1013245002 | 110 |
| 358 | 3300006881 | Ga0068865_100617916 | Ga0068865_1006179162 | 110 |
| 359 | 3300006931 | Ga0097620_100034349 | Ga0097620_1000343494 | 110 |
| 360 | 3300006931 | Ga0097620_100360041 | Ga0097620_1003600412 | 110 |
| 361 | 3300009092 | Ga0105250_10007609 | Ga0105250_100076092 | 110 |
| 362 | 3300009093 | Ga0105240_10144540 | Ga0105240_101445403 | 110 |
| 363 | 3300009093 | Ga0105240_10316167 | Ga0105240_103161672 | 110 |
| 364 | 3300009093 | Ga0105240_11416047 | Ga0105240_114160472 | 110 |
| 365 | 3300009098 | Ga0105245_11175686 | Ga0105245_111756862 | 110 |
| 366 | 3300009148 | Ga0105243_10672565 | Ga0105243_106725652 | 110 |
| 367 | 3300009177 | Ga0105248_10005197 | Ga0105248_100051975 | 110 |
| 368 | 3300009177 | Ga0105248_10092559 | Ga0105248_100925592 | 110 |
| 369 | 3300009177 | Ga0105248_10281479 | Ga0105248_102814792 | 110 |
| 370 | 3300009177 | Ga0105248_10446752 | Ga0105248_104467523 | 110 |
| 371 | 3300009177 | Ga0105248_10817129 | Ga0105248_108171292 | 110 |
| 372 | 3300009177 | Ga0105248_11164959 | Ga0105248_111649591 | 110 |
| 373 | 3300009545 | Ga0105237_10772580 | Ga0105237_107725802 | 110 |
| 374 | 3300009551 | Ga0105238_10047528 | Ga0105238_100475282 | 110 |
| 375 | 3300009551 | Ga0105238_10537228 | Ga0105238_105372282 | 110 |
| 376 | 3300009551 | Ga0105238_10905964 | Ga0105238_109059642 | 110 |
| 377 | 3300009551 | Ga0105238_11099049 | Ga0105238_110990492 | 110 |
| 378 | 3300009553 | Ga0105249_10000647 | Ga0105249_1000064729 | 110 |
| 379 | 3300009553 | Ga0105249_10780868 | Ga0105249_107808682 | 110 |
| 380 | 3300010375 | Ga0105239_10798067 | Ga0105239_107980672 | 110 |
| 381 | 3300011119 | Ga0105246_10210578 | Ga0105246_102105782 | 110 |
| 382 | 3300013104 | Ga0157370_10455023 | Ga0157370_104550232 | 110 |
| 383 | 3300013105 | Ga0157369_10410770 | Ga0157369_104107702 | 110 |
| 384 | 3300013296 | Ga0157374_10921955 | Ga0157374_109219552 | 110 |
| 385 | 3300013306 | Ga0163162_10296137 | Ga0163162_102961373 | 110 |
| 386 | 3300013308 | Ga0157375_10088010 | Ga0157375_100880103 | 110 |
| 387 | 3300013308 | Ga0157375_10672011 | Ga0157375_106720112 | 110 |
| 388 | 3300013308 | Ga0157375_10976234 | Ga0157375_109762341 | 110 |
| 389 | 3300013308 | Ga0157375_13039338 | Ga0157375_130393382 | 110 |
| 390 | 3300014325 | Ga0163163_10035635 | Ga0163163_100356352 | 110 |
| 391 | 3300014325 | Ga0163163_10086268 | Ga0163163_100862683 | 110 |
| 392 | 3300014325 | Ga0163163_10284725 | Ga0163163_102847252 | 110 |
| 393 | 3300014325 | Ga0163163_11501748 | Ga0163163_115017481 | 110 |
| 394 | 3300014745 | Ga0157377_10133223 | Ga0157377_101332232 | 110 |
| 395 | 3300014968 | Ga0157379_10009800 | Ga0157379_1000980010 | 110 |
| 396 | 3300014968 | Ga0157379_10099588 | Ga0157379_100995883 | 110 |
| 397 | 3300014968 | Ga0157379_10529441 | Ga0157379_105294412 | 110 |
| 398 | 3300014969 | Ga0157376_11889106 | Ga0157376_118891062 | 110 |
| 399 | 3300020070 | Ga0206356_10061775 | Ga0206356_100617752 | 110 |
| 400 | 3300021377 | Ga0213874_10026944 | Ga0213874_100269442 | 110 |
| 401 | 3300021384 | Ga0213876_10017428 | Ga0213876_100174282 | 110 |
| 402 | 3300025254 | Ga0209148_1027686 | Ga0209148_10276862 | 110 |
| 403 | 3300025292 | Ga0209676_1000308 | Ga0209676_100030879 | 110 |
| 404 | 3300025292 | Ga0209676_1000320 | Ga0209676_100032081 | 110 |
| 405 | 3300025303 | Ga0209051_1006510 | Ga0209051_10065103 | 110 |
| 406 | 3300025304 | Ga0209257_1000338 | Ga0209257_100033881 | 110 |
| 407 | 3300025711 | Ga0207696_1014612 | Ga0207696_10146122 | 110 |
| 408 | 3300025900 | Ga0207710_10316804 | Ga0207710_103168041 | 110 |
| 409 | 3300025901 | Ga0207688_10326514 | Ga0207688_103265142 | 110 |
| 410 | 3300025908 | Ga0207643_11042518 | Ga0207643_110425182 | 110 |
| 411 | 3300025909 | Ga0207705_10137554 | Ga0207705_101375542 | 110 |
| 412 | 3300025909 | Ga0207705_10850172 | Ga0207705_108501722 | 110 |
| 413 | 3300025912 | Ga0207707_10519370 | Ga0207707_105193702 | 110 |
| 414 | 3300025913 | Ga0207695_10002610 | Ga0207695_1000261024 | 110 |
| 415 | 3300025913 | Ga0207695_10007189 | Ga0207695_1000718912 | 110 |
| 416 | 3300025913 | Ga0207695_10009967 | Ga0207695_100099672 | 110 |
| 417 | 3300025913 | Ga0207695_10106175 | Ga0207695_101061752 | 110 |
| 418 | 3300025914 | Ga0207671_10973424 | Ga0207671_109734242 | 110 |
| 419 | 3300025915 | Ga0207693_10322962 | Ga0207693_103229622 | 110 |
| 420 | 3300025917 | Ga0207660_10363512 | Ga0207660_103635122 | 110 |
| 421 | 3300025919 | Ga0207657_10206326 | Ga0207657_102063261 | 110 |
| 422 | 3300025920 | Ga0207649_10593911 | Ga0207649_105939112 | 110 |
| 423 | 3300025920 | Ga0207649_10817524 | Ga0207649_108175242 | 110 |
| 424 | 3300025921 | Ga0207652_10145632 | Ga0207652_101456322 | 110 |
| 425 | 3300025923 | Ga0207681_10651016 | Ga0207681_106510161 | 110 |
| 426 | 3300025923 | Ga0207681_11008640 | Ga0207681_110086401 | 110 |
| 427 | 3300025923 | Ga0207681_11804041 | Ga0207681_118040411 | 110 |
| 428 | 3300025924 | Ga0207694_10290496 | Ga0207694_102904962 | 110 |
| 429 | 3300025924 | Ga0207694_10726189 | Ga0207694_107261892 | 110 |
| 430 | 3300025924 | Ga0207694_10752463 | Ga0207694_107524631 | 110 |
| 431 | 3300025925 | Ga0207650_10000016 | Ga0207650_1000001691 | 110 |
| 432 | 3300025925 | Ga0207650_10021394 | Ga0207650_100213942 | 110 |
| 433 | 3300025925 | Ga0207650_10611340 | Ga0207650_106113401 | 110 |
| 434 | 3300025931 | Ga0207644_10457928 | Ga0207644_104579282 | 110 |
| 435 | 3300025931 | Ga0207644_10685221 | Ga0207644_106852212 | 110 |
| 436 | 3300025933 | Ga0207706_10639466 | Ga0207706_106394662 | 110 |
| 437 | 3300025939 | Ga0207665_10968757 | Ga0207665_109687571 | 110 |
| 438 | 3300025941 | Ga0207711_10006764 | Ga0207711_100067643 | 110 |
| 439 | 3300025941 | Ga0207711_10057519 | Ga0207711_100575193 | 110 |
| 440 | 3300025941 | Ga0207711_10298732 | Ga0207711_102987322 | 110 |
| 441 | 3300025941 | Ga0207711_10723374 | Ga0207711_107233742 | 110 |
| 442 | 3300025941 | Ga0207711_11192252 | Ga0207711_111922522 | 110 |
| 443 | 3300025941 | Ga0207711_11503358 | Ga0207711_115033582 | 110 |
| 444 | 3300025942 | Ga0207689_10234791 | Ga0207689_102347913 | 110 |
| 445 | 3300025942 | Ga0207689_10404155 | Ga0207689_104041552 | 110 |
| 446 | 3300025944 | Ga0207661_10365028 | Ga0207661_103650281 | 110 |
| 447 | 3300025945 | Ga0207679_10518780 | Ga0207679_105187802 | 110 |
| 448 | 3300025949 | Ga0207667_10129238 | Ga0207667_101292382 | 110 |
| 449 | 3300025949 | Ga0207667_10142666 | Ga0207667_101426662 | 110 |
| 450 | 3300025949 | Ga0207667_10291033 | Ga0207667_102910331 | 110 |
| 451 | 3300025949 | Ga0207667_10928144 | Ga0207667_109281442 | 110 |
| 452 | 3300025960 | Ga0207651_10096418 | Ga0207651_100964182 | 110 |
| 453 | 3300025961 | Ga0207712_10019237 | Ga0207712_100192374 | 110 |
| 454 | 3300025961 | Ga0207712_10986534 | Ga0207712_109865342 | 110 |
| 455 | 3300025961 | Ga0207712_11213678 | Ga0207712_112136781 | 110 |
| 456 | 3300025972 | Ga0207668_10002967 | Ga0207668_100029675 | 110 |
| 457 | 3300025972 | Ga0207668_10131840 | Ga0207668_101318402 | 110 |
| 458 | 3300025972 | Ga0207668_10141984 | Ga0207668_101419842 | 110 |
| 459 | 3300025986 | Ga0207658_10000384 | Ga0207658_1000038414 | 110 |
| 460 | 3300025986 | Ga0207658_10587660 | Ga0207658_105876602 | 110 |
| 461 | 3300025986 | Ga0207658_11317083 | Ga0207658_113170832 | 110 |
| 462 | 3300026023 | Ga0207677_11610545 | Ga0207677_116105451 | 110 |
| 463 | 3300026035 | Ga0207703_10000065 | Ga0207703_1000006541 | 110 |
| 464 | 3300026035 | Ga0207703_10010902 | Ga0207703_100109025 | 110 |
| 465 | 3300026035 | Ga0207703_10175564 | Ga0207703_101755642 | 110 |
| 466 | 3300026035 | Ga0207703_10495807 | Ga0207703_104958072 | 110 |
| 467 | 3300026041 | Ga0207639_10095343 | Ga0207639_100953432 | 110 |
| 468 | 3300026041 | Ga0207639_12287668 | Ga0207639_122876681 | 110 |
| 469 | 3300026078 | Ga0207702_10196376 | Ga0207702_101963762 | 110 |
| 470 | 3300026088 | Ga0207641_10000011 | Ga0207641_10000011328 | 110 |
| 471 | 3300026088 | Ga0207641_10033654 | Ga0207641_100336543 | 110 |
| 472 | 3300026088 | Ga0207641_10848983 | Ga0207641_108489832 | 110 |
| 473 | 3300026088 | Ga0207641_12069509 | Ga0207641_120695092 | 110 |
| 474 | 3300026089 | Ga0207648_11776398 | Ga0207648_117763982 | 110 |
| 475 | 3300026095 | Ga0207676_10000148 | Ga0207676_1000014821 | 110 |
| 476 | 3300026095 | Ga0207676_10001859 | Ga0207676_100018596 | 110 |
| 477 | 3300026095 | Ga0207676_10212164 | Ga0207676_102121642 | 110 |
| 478 | 3300026095 | Ga0207676_10245949 | Ga0207676_102459491 | 110 |
| 479 | 3300026116 | Ga0207674_11324584 | Ga0207674_113245842 | 110 |
| 480 | 3300026121 | Ga0207683_10027153 | Ga0207683_100271532 | 110 |
| 481 | 3300026142 | Ga0207698_11438426 | Ga0207698_114384261 | 110 |
| 482 | 3300027876 | Ga0209974_10411414 | Ga0209974_104114141 | 110 |
| 483 | 3300028379 | Ga0268266_10005978 | Ga0268266_100059784 | 110 |
| 484 | 3300028379 | Ga0268266_10017036 | Ga0268266_100170363 | 110 |
| 485 | 3300028380 | Ga0268265_10000798 | Ga0268265_1000079827 | 110 |
| 486 | 3300028380 | Ga0268265_10212745 | Ga0268265_102127452 | 110 |
| 487 | 3300028380 | Ga0268265_10680907 | Ga0268265_106809071 | 110 |
| 488 | 3300028380 | Ga0268265_12169563 | Ga0268265_121695632 | 110 |
| 489 | 3300028381 | Ga0268264_10000014 | Ga0268264_10000014344 | 110 |
| 490 | 3300028381 | Ga0268264_10000207 | Ga0268264_1000020710 | 110 |
| 491 | 3300028381 | Ga0268264_10043016 | Ga0268264_100430163 | 110 |
| 492 | 3300028573 | Ga0265334_10008247 | Ga0265334_100082471 | 110 |
| 493 | 3300028573 | Ga0265334_10095516 | Ga0265334_100955162 | 110 |
| 494 | 3300028573 | Ga0265334_10273382 | Ga0265334_102733822 | 110 |
| 495 | 3300028786 | Ga0307517_10002922 | Ga0307517_1000292211 | 110 |
| 496 | 3300028786 | Ga0307517_10119287 | Ga0307517_101192871 | 110 |
| 497 | 3300028800 | Ga0265338_10044452 | Ga0265338_100444522 | 110 |
| 498 | 3300028800 | Ga0265338_10203015 | Ga0265338_102030152 | 110 |
| 499 | 3300031090 | Ga0265760_10046378 | Ga0265760_100463782 | 110 |
| 500 | 3300031250 | Ga0265331_10192190 | Ga0265331_101921902 | 110 |
| 501 | 3300031251 | Ga0265327_10129293 | Ga0265327_101292932 | 110 |
| 502 | 3300031456 | Ga0307513_10000541 | Ga0307513_1000054119 | 110 |
| 503 | 3300031456 | Ga0307513_10004541 | Ga0307513_1000454112 | 110 |
| 504 | 3300031456 | Ga0307513_10006209 | Ga0307513_100062094 | 110 |
| 505 | 3300031456 | Ga0307513_10670897 | Ga0307513_106708972 | 110 |
| 506 | 3300031616 | Ga0307508_10744489 | Ga0307508_107444892 | 110 |
| 507 | 3300031616 | Ga0307508_10809242 | Ga0307508_108092422 | 110 |
| 508 | 3300031665 | Ga0316575_10082097 | Ga0316575_100820972 | 110 |
| 509 | 3300031691 | Ga0316579_10628966 | Ga0316579_106289661 | 110 |
| 510 | 3300031711 | Ga0265314_10204623 | Ga0265314_102046232 | 110 |
| 511 | 3300031727 | Ga0316576_10203706 | Ga0316576_102037062 | 110 |
| 512 | 3300031728 | Ga0316578_10306143 | Ga0316578_103061431 | 110 |
| 513 | 3300031730 | Ga0307516_10000030 | Ga0307516_1000003050 | 110 |
| 514 | 3300031733 | Ga0316577_10503502 | Ga0316577_105035022 | 110 |
| 515 | 3300031903 | Ga0307407_10264265 | Ga0307407_102642652 | 110 |
| 516 | 3300031911 | Ga0307412_10311132 | Ga0307412_103111322 | 110 |
| 517 | 3300032126 | Ga0307415_100674173 | Ga0307415_1006741732 | 110 |
| 518 | 3300032133 | Ga0316583_10052072 | Ga0316583_100520722 | 110 |
| 519 | 3300032137 | Ga0316585_10006969 | Ga0316585_100069692 | 110 |
| 520 | 3300032168 | Ga0316593_10026979 | Ga0316593_100269792 | 110 |
| 521 | 3300033180 | Ga0307510_10010004 | Ga0307510_100100047 | 110 |
| 522 | 3300033524 | Ga0316592_1053995 | Ga0316592_10539952 | 110 |
| 523 | 3300033528 | Ga0316588_1002162 | Ga0316588_10021624 | 110 |
| 524 | 3300033541 | Ga0316596_1060058 | Ga0316596_10600582 | 110 |
| 525 | 3300035092 | Ga0373952_0135334 | Ga0373952_0135334_288_629 | 110 |
| 526 | 3300035113 | Ga0373936_0000661 | Ga0373936_0000661_2867_3223 | 110 |
| 527 | 3300035171 | Ga0373946_0772685 | Ga0373946_0772685_53_388 | 110 |
| 528 | 3300035172 | Ga0373955_0880521 | Ga0373955_0880521_80_427 | 110 |
| 529 | 3300035691 | Ga0373931_0664428 | Ga0373931_0664428_286_621 | 110 |
| 530 | 3300035692 | Ga0373935_0210569 | Ga0373935_0210569_46_381 | 110 |
| 531 | 3300035695 | Ga0373927_0419978 | Ga0373927_0419978_351_686 | 110 |
| 532 | 3300035724 | Ga0373933_0929132 | Ga0373933_0929132_34_375 | 110 |
| 533 | 3300036401 | Ga0373937_0663710 | Ga0373937_0663710_249_599 | 110 |
| 534 | 3300036401 | Ga0373937_0702585 | Ga0373937_0702585_481_828 | 110 |
| 535 | 3300036647 | Ga0316582_0365070 | Ga0316582_0365070_133_465 | 110 |
| 536 | 3300036712 | Ga0316584_0082675 | Ga0316584_0082675_173_505 | 110 |
| 537 | 3300037312 | Ga0395899_0003271 | Ga0395899_0003271_5821_6156 | 110 |
| 538 | 3300037312 | Ga0395899_0106800 | Ga0395899_0106800_1259_1594 | 110 |
| 539 | 3300037312 | Ga0395899_0167832 | Ga0395899_0167832_890_1225 | 110 |
| 540 | 3300037418 | Ga0395900_0237473 | Ga0395900_0237473_265_600 | 110 |
| 541 | 3300037418 | Ga0395900_0448637 | Ga0395900_0448637_17_352 | 110 |
| 542 | 3300037418 | Ga0395900_1854096 | Ga0395900_1854096_17_352 | 110 |
| 543 | 3300037466 | Ga0395898_0007710 | Ga0395898_0007710_10362_10697 | 110 |
| 544 | 3300037466 | Ga0395898_0097502 | Ga0395898_0097502_2067_2402 | 110 |
| 545 | 3300037466 | Ga0395898_0424126 | Ga0395898_0424126_771_1106 | 110 |
| 546 | 3300037471 | Ga0395905_0004961 | Ga0395905_0004961_9829_10164 | 110 |
| 547 | 3300037588 | Ga0316581_0216814 | Ga0316581_0216814_224_556 | 110 |
| 548 | 3300038443 | Ga0395901_0000021 | Ga0395901_0000021_302652_302987 | 110 |
| 549 | 3300038443 | Ga0395901_0266167 | Ga0395901_0266167_162_497 | 110 |
| 550 | 3300039437 | Ga0436365_1445717 | Ga0436365_1445717_31_363 | 110 |
| 551 | 3300039438 | Ga0436360_0053752 | Ga0436360_0053752_338_673 | 110 |
| 552 | 3300039450 | Ga0436363_1219245 | Ga0436363_1219245_144_491 | 110 |
| 553 | 3300039450 | Ga0436363_1424271 | Ga0436363_1424271_891_1232 | 110 |
| 554 | 3300041443 | Ga0451789_0017912 | Ga0451789_0017912_234_569 | 110 |
| 555 | 3300041486 | Ga0451807_2521828 | Ga0451807_2521828_125_457 | 110 |
| 556 | 3300041501 | Ga0451845_0570884 | Ga0451845_0570884_249_581 | 110 |
| 557 | 3300041503 | Ga0451847_0447433 | Ga0451847_0447433_101_457 | 110 |
| 558 | 3300041509 | Ga0451843_0800999 | Ga0451843_0800999_115_450 | 110 |
| 559 | 3300042012 | Ga0439455_0253308 | Ga0439455_0253308_30_368 | 110 |
| 560 | 3300044693 | Ga0466961_0739925 | Ga0466961_0739925_227_562 | 110 |
| 561 | 3300046457 | Ga0495590_0001271 | Ga0495590_0001271_10113_10445 | 110 |
| 562 | 3300046460 | Ga0495638_0000185 | Ga0495638_0000185_16996_17328 | 110 |
| 563 | 3300046460 | Ga0495638_0001213 | Ga0495638_0001213_14033_14368 | 110 |
| 564 | 3300046460 | Ga0495638_0513788 | Ga0495638_0513788_123_455 | 110 |
| 565 | 3300046477 | Ga0495664_0351076 | Ga0495664_0351076_204_536 | 110 |
| 566 | 3300046499 | Ga0495594_0408096 | Ga0495594_0408096_308_640 | 110 |
| 567 | 3300046506 | Ga0495583_0090078 | Ga0495583_0090078_677_1009 | 110 |
| 568 | 3300046507 | Ga0495606_0242676 | Ga0495606_0242676_217_549 | 110 |
| 569 | 3300046507 | Ga0495606_0534817 | Ga0495606_0534817_195_530 | 110 |
| 570 | 3300046512 | Ga0495610_0001542 | Ga0495610_0001542_12008_12340 | 110 |
| 571 | 3300046512 | Ga0495610_0002504 | Ga0495610_0002504_10855_11190 | 110 |
| 572 | 3300046515 | Ga0495620_0043942 | Ga0495620_0043942_501_833 | 110 |
| 573 | 3300046518 | Ga0495631_0001061 | Ga0495631_0001061_286_618 | 110 |
| 574 | 3300046519 | Ga0495632_0196110 | Ga0495632_0196110_75_410 | 110 |
| 575 | 3300046520 | Ga0495637_0061700 | Ga0495637_0061700_184_516 | 110 |
| 576 | 3300046522 | Ga0495643_0162821 | Ga0495643_0162821_749_1081 | 110 |
| 577 | 3300046524 | Ga0495648_0001143 | Ga0495648_0001143_7321_7653 | 110 |
| 578 | 3300046528 | Ga0495642_0009268 | Ga0495642_0009268_2430_2765 | 110 |
| 579 | 3300046528 | Ga0495642_0181114 | Ga0495642_0181114_210_548 | 110 |
| 580 | 3300046530 | Ga0495654_0041442 | Ga0495654_0041442_217_549 | 110 |
| 581 | 3300046530 | Ga0495654_0092590 | Ga0495654_0092590_853_1185 | 110 |
| 582 | 3300046536 | Ga0495587_0313837 | Ga0495587_0313837_360_701 | 110 |
| 583 | 3300046537 | Ga0495598_0230819 | Ga0495598_0230819_82_426 | 110 |
| 584 | 3300046538 | Ga0495609_0221746 | Ga0495609_0221746_409_741 | 110 |
| 585 | 3300046542 | Ga0495597_0000940 | Ga0495597_0000940_11408_11740 | 110 |
| 586 | 3300046542 | Ga0495597_0016383 | Ga0495597_0016383_1004_1336 | 110 |
| 587 | 3300046557 | Ga0495622_0000495 | Ga0495622_0000495_24044_24376 | 110 |
| 588 | 3300046616 | Ga0495668_0000196 | Ga0495668_0000196_69348_69680 | 110 |
| 589 | 3300046616 | Ga0495668_0032996 | Ga0495668_0032996_1497_1829 | 110 |
| 590 | 3300046616 | Ga0495668_0766457 | Ga0495668_0766457_150_482 | 110 |
| 591 | 3300046648 | Ga0495611_0003249 | Ga0495611_0003249_233_568 | 110 |
| 592 | 3300046648 | Ga0495611_0137916 | Ga0495611_0137916_564_902 | 110 |
| 593 | 3300046660 | Ga0495625_0032672 | Ga0495625_0032672_2392_2727 | 110 |
| 594 | 3300046660 | Ga0495625_0057282 | Ga0495625_0057282_1029_1364 | 110 |
| 595 | 3300046660 | Ga0495625_0165352 | Ga0495625_0165352_799_1131 | 110 |
| 596 | 3300046660 | Ga0495625_0178490 | Ga0495625_0178490_688_1020 | 110 |
| 597 | 3300046660 | Ga0495625_0273602 | Ga0495625_0273602_534_869 | 110 |
| 598 | 3300046679 | Ga0495623_0617671 | Ga0495623_0617671_31_369 | 110 |
| 599 | 3300046684 | Ga0495669_0000081 | Ga0495669_0000081_23071_23406 | 110 |
| 600 | 3300046690 | Ga0495624_0347427 | Ga0495624_0347427_64_396 | 110 |
| 601 | 3300046794 | Ga0495589_0028386 | Ga0495589_0028386_611_946 | 110 |
| 602 | 3300046810 | Ga0495660_0294120 | Ga0495660_0294120_218_553 | 110 |
| 603 | 3300046810 | Ga0495660_0396677 | Ga0495660_0396677_156_488 | 110 |
| 604 | 3300047315 | Ga0495581_0199504 | Ga0495581_0199504_351_683 | 110 |
| 605 | 3300047318 | Ga0495636_0066666 | Ga0495636_0066666_787_1122 | 110 |
| 606 | 3300047320 | Ga0495672_0078397 | Ga0495672_0078397_769_1101 | 110 |
| 607 | 3300047445 | Ga0495677_0153499 | Ga0495677_0153499_80_415 | 110 |
| 608 | 3300047469 | Ga0495673_0000818 | Ga0495673_0000818_19165_19497 | 110 |
| 609 | 3300047470 | Ga0495681_0141055 | Ga0495681_0141055_455_790 | 110 |
| 610 | 3300047472 | Ga0495686_0001281 | Ga0495686_0001281_10896_11228 | 110 |
| 611 | 3300047472 | Ga0495686_0041270 | Ga0495686_0041270_1858_2193 | 110 |
| 612 | 3300048903 | Ga0496100_1077026 | Ga0496100_1077026_15_350 | 110 |
| 613 | 3300048905 | Ga0496102_0002509 | Ga0496102_0002509_13345_13683 | 110 |
| 614 | 3300048906 | Ga0496103_0160165 | Ga0496103_0160165_209_544 | 110 |
| 615 | 3300048909 | Ga0496106_0534374 | Ga0496106_0534374_50_388 | 110 |
| 616 | 3300048909 | Ga0496106_1576793 | Ga0496106_1576793_72_404 | 110 |
| 617 | 3300048911 | Ga0496108_0007812 | Ga0496108_0007812_5627_5965 | 110 |
| 618 | 3300048912 | Ga0496109_0072857 | Ga0496109_0072857_628_966 | 110 |
| 619 | 3300048912 | Ga0496109_0950802 | Ga0496109_0950802_83_442 | 110 |
| 620 | 3300048915 | Ga0496112_0008645 | Ga0496112_0008645_8203_8541 | 110 |
| 621 | 3300048915 | Ga0496112_0577307 | Ga0496112_0577307_41_379 | 110 |
| 622 | 3300048915 | Ga0496112_1406924 | Ga0496112_1406924_253_591 | 110 |
| 623 | 3300048916 | Ga0496113_0024190 | Ga0496113_0024190_2012_2350 | 110 |
| 624 | 3300048917 | Ga0496114_1569067 | Ga0496114_1569067_112_444 | 110 |
| 625 | 3300048918 | Ga0496115_0002000 | Ga0496115_0002000_11_346 | 110 |
| 626 | 3300048918 | Ga0496115_0328711 | Ga0496115_0328711_784_1116 | 110 |
| 627 | 3300048924 | Ga0496121_0315459 | Ga0496121_0315459_691_1023 | 110 |
| 628 | 3300048927 | Ga0496124_0006584 | Ga0496124_0006584_215_547 | 110 |
| 629 | 3300048928 | Ga0496125_0004898 | Ga0496125_0004898_137_469 | 110 |
| 630 | 3300048929 | Ga0496126_0016290 | Ga0496126_0016290_5554_5886 | 110 |
| 631 | 3300049459 | Ga0495678_002464 | Ga0495678_002464_9957_10289 | 110 |
| 632 | 3300049535 | Ga0501319_033485 | Ga0501319_033485_71_406 | 110 |
| 633 | 3300049537 | Ga0501321_056868 | Ga0501321_056868_210_545 | 110 |
| 634 | 3300049580 | Ga0501046_0798038 | Ga0501046_0798038_252_587 | 110 |
| 635 | 3300049581 | Ga0501047_0006419 | Ga0501047_0006419_6569_6904 | 110 |
| 636 | 3300049581 | Ga0501047_0023674 | Ga0501047_0023674_4540_4878 | 110 |
| 637 | 3300049581 | Ga0501047_0041638 | Ga0501047_0041638_2380_2715 | 110 |
| 638 | 3300049581 | Ga0501047_0233610 | Ga0501047_0233610_130_465 | 110 |
| 639 | 3300049581 | Ga0501047_0917077 | Ga0501047_0917077_85_420 | 110 |
| 640 | 3300049583 | Ga0501067_0135901 | Ga0501067_0135901_302_637 | 110 |
| 641 | 3300049588 | Ga0501072_0063615 | Ga0501072_0063615_2136_2471 | 110 |
| 642 | 3300049589 | Ga0501073_0080545 | Ga0501073_0080545_1218_1553 | 110 |
| 643 | 3300049590 | Ga0501074_0160556 | Ga0501074_0160556_962_1297 | 110 |
| 644 | 3300049686 | Ga0501257_005509 | Ga0501257_005509_1495_1836 | 110 |
| 645 | 3300049742 | Ga0501080_0170167 | Ga0501080_0170167_1193_1528 | 110 |
| 646 | 3300049744 | Ga0501083_0006235 | Ga0501083_0006235_3126_3461 | 110 |
| 647 | 3300049744 | Ga0501083_0288143 | Ga0501083_0288143_561_896 | 110 |
| 648 | 3300049758 | Ga0501241_165563 | Ga0501241_165563_89_421 | 110 |
| 649 | 3300049822 | Ga0501035_0158137 | Ga0501035_0158137_1528_1863 | 110 |
| 650 | 3300049823 | Ga0501044_0006907 | Ga0501044_0006907_9281_9616 | 110 |
| 651 | 3300049823 | Ga0501044_0837799 | Ga0501044_0837799_178_510 | 110 |
| 652 | 3300049823 | Ga0501044_0944010 | Ga0501044_0944010_269_604 | 110 |
| 653 | 3300050493 | nmdc:mga0k408_240195_c1 | nmdc:mga0k408_240195_c1_519_851 | 110 |
| 654 | 3300050493 | nmdc:mga0k408_29733_c1 | nmdc:mga0k408_29733_c1_910_1245 | 110 |
| 655 | 3300050496 | nmdc:mga07m45_226460_c1 | nmdc:mga07m45_226460_c1_471_803 | 110 |
| 656 | 3300050516 | nmdc:mga0sz30_131077_c1 | nmdc:mga0sz30_131077_c1_91_423 | 110 |
| 657 | 3300050516 | nmdc:mga0sz30_279806_c1 | nmdc:mga0sz30_279806_c1_367_699 | 110 |
| 658 | 3300053077 | Ga0495601_0934764 | Ga0495601_0934764_10_351 | 110 |
| 659 | 3300053080 | Ga0500635_0000258 | Ga0500635_0000258_3243_3575 | 110 |
| 660 | 3300053086 | Ga0500578_0001019 | Ga0500578_0001019_19640_19972 | 110 |
| 661 | 3300053086 | Ga0500578_0177525 | Ga0500578_0177525_360_692 | 110 |
| 662 | 3300053087 | Ga0500643_078768 | Ga0500643_078768_100_432 | 110 |
| 663 | 3300053088 | Ga0500644_0000239 | Ga0500644_0000239_15115_15447 | 110 |
| 664 | 3300053088 | Ga0500644_0492032 | Ga0500644_0492032_126_458 | 110 |
| 665 | 3300053090 | Ga0500646_0113682 | Ga0500646_0113682_313_645 | 110 |
| 666 | 3300053093 | Ga0500651_0009280 | Ga0500651_0009280_82_414 | 110 |
| 667 | 3300053094 | Ga0500566_0013864 | Ga0500566_0013864_2974_3306 | 110 |
| 668 | 3300053096 | Ga0500641_0001268 | Ga0500641_0001268_966_1301 | 110 |
| 669 | 3300053103 | Ga0500555_046364 | Ga0500555_046364_76_408 | 110 |
| 670 | 3300053104 | Ga0500556_0087657 | Ga0500556_0087657_175_507 | 110 |
| 671 | 3300053105 | Ga0500557_027599 | Ga0500557_027599_94_426 | 110 |
| 672 | 3300053108 | Ga0500562_000838 | Ga0500562_000838_2751_3083 | 110 |
| 673 | 3300053108 | Ga0500562_005366 | Ga0500562_005366_2296_2628 | 110 |
| 674 | 3300053109 | Ga0500569_009105 | Ga0500569_009105_1823_2155 | 110 |
| 675 | 3300053118 | Ga0500594_0000224 | Ga0500594_0000224_3578_3910 | 110 |
| 676 | 3300053119 | Ga0500595_060299 | Ga0500595_060299_130_462 | 110 |
| 677 | 3300053121 | Ga0500607_029942 | Ga0500607_029942_1230_1562 | 110 |
| 678 | 3300053122 | Ga0500608_000202 | Ga0500608_000202_5341_5673 | 110 |
| 679 | 3300053122 | Ga0500608_002769 | Ga0500608_002769_514_846 | 110 |
| 680 | 3300053123 | Ga0500614_013145 | Ga0500614_013145_310_642 | 110 |
| 681 | 3300053134 | Ga0500658_0171311 | Ga0500658_0171311_186_518 | 110 |
| 682 | 3300053136 | Ga0500559_0021200 | Ga0500559_0021200_1505_1837 | 110 |
| 683 | 3300053136 | Ga0500559_0070649 | Ga0500559_0070649_526_858 | 110 |
| 684 | 3300053138 | Ga0500564_000506 | Ga0500564_000506_7587_7919 | 110 |
| 685 | 3300053138 | Ga0500564_350826 | Ga0500564_350826_17_349 | 110 |
| 686 | 3300053142 | Ga0500577_0110265 | Ga0500577_0110265_556_888 | 110 |
| 687 | 3300053148 | Ga0500590_016265 | Ga0500590_016265_720_1052 | 110 |
| 688 | 3300053150 | Ga0500603_004385 | Ga0500603_004385_2040_2372 | 110 |
| 689 | 3300053153 | Ga0500616_0147160 | Ga0500616_0147160_70_408 | 110 |
| 690 | 3300053154 | Ga0500619_016052 | Ga0500619_016052_833_1165 | 110 |
| 691 | 3300053154 | Ga0500619_101560 | Ga0500619_101560_94_426 | 110 |
| 692 | 3300053155 | Ga0500620_117008 | Ga0500620_117008_548_880 | 110 |
| 693 | 3300053156 | Ga0500622_0001017 | Ga0500622_0001017_3685_4017 | 110 |
| 694 | 3300053156 | Ga0500622_0007239 | Ga0500622_0007239_866_1198 | 110 |
| 695 | 3300053156 | Ga0500622_0007501 | Ga0500622_0007501_3610_3942 | 110 |
| 696 | 3300053156 | Ga0500622_0180011 | Ga0500622_0180011_583_915 | 110 |
| 697 | 3300053157 | Ga0500624_022231 | Ga0500624_022231_424_756 | 110 |
| 698 | 3300053161 | Ga0500634_0242761 | Ga0500634_0242761_160_495 | 110 |
| 699 | 3300053162 | Ga0500638_006452 | Ga0500638_006452_1239_1571 | 110 |
| 700 | 3300053163 | Ga0500639_196769 | Ga0500639_196769_371_703 | 110 |
| 701 | 3300053177 | Ga0500636_0030429 | Ga0500636_0030429_459_791 | 110 |
| 702 | 3300053178 | Ga0500637_0011924 | Ga0500637_0011924_3227_3559 | 110 |
| 703 | 3300053178 | Ga0500637_0069871 | Ga0500637_0069871_453_785 | 110 |
| 704 | 3300053725 | Ga0500576_177844 | Ga0500576_177844_190_522 | 110 |
| 705 | 3300053729 | Ga0500625_040366 | Ga0500625_040366_248_580 | 110 |
| 706 | 3300053735 | Ga0500596_007741 | Ga0500596_007741_1394_1726 | 110 |
| 707 | 3300054114 | Ga0501084_0006768 | Ga0501084_0006768_100_435 | 110 |
| 708 | 3300055283 | Ga0500661_049846 | Ga0500661_049846_12_344 | 110 |
| 709 | 3300055283 | Ga0500661_068000 | Ga0500661_068000_290_622 | 110 |
| 710 | 3300060353 | Ga0501082_0047765 | Ga0501082_0047765_460_795 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hr1-assembly7.cif.gz_G | crystal structure of thioredoxin l107a mutant | 0.9984 | 27 | 102 |
| 2yn1-assembly2.cif.gz_B | crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period | 0.9937 | 2 | 104 |
| 3dxb-assembly2.cif.gz_D | structure of the uhm domain of puf60 fused to thioredoxin | 0.992 | 2 | 104 |
| 2eir-assembly3.cif.gz_C | design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts | 0.9919 | 2 | 105 |
| 6gd1-assembly1.cif.gz_A | structure of hur rrm3 | 0.9917 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hr1G00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9984 | 27 | 102 | 3.40.30.10 |
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9904 | 2 | 104 | 3.40.30.10 |
| 5hr1G00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9854 | 27 | 102 | 3.40.30.10 |
| af_Q8LD49_56_177_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9816 | 3 | 104 | 3.40.30.10 |
| 3dieB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9761 | 31 | 104 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RV69-F1-model_v4 | Thioredoxin | 1.005 | 1 | 110 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A258FSJ4-F1-model_v4 | Thioredoxin | 1.003 | 1 | 108 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A1Y0BWF8-F1-model_v4 | Thioredoxin | 1.003 | 3 | 105 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A2S6UW01-F1-model_v4 | Thioredoxin | 1.002 | 2 | 104 |
GO:0005737
GO:0015035 |
| AF-A0A7C7PYS9-F1-model_v4 | Thioredoxin | 1.002 | 3 | 104 |
GO:0005829
GO:0015035 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar