F476407

General Info

Members Datasets Scaffolds Average Seq Length
705 525 374 549

Family's Representative Sequence

Representative Sequence 3300027666|Ga0209282_1000222|Ga0209282_10002229
Length 625
Sequence VGRKELRTLPRPTITVQLQISDRTQTIPNHRHAVKDYFPIFMIFILMTAFAPFPAPYYTRAASGGQKGQVKLVKQWVERLFAGLSATGIVFGTVLFCASLTPSLLPRTWLMQGVLCGFSFAIGYMIGVALHAIWAYLELPEPSRHNVRGVRFLIALAAAITAIAFLWQAKDWQNSIRVLMELDPLPSAHPTKTGGLAVLVAALLIGAGRLFQVIRRFFAARSRHFLPRRLANVLGIAAAIVLSWMLLNGLIFDIGLKFADSSLKQVDSLIEPDVPRPADPLKTGSSASLMTWESLGRRGREFVAEGPAGTQISAFTHRPAKEPLRVYAGLNSAATPEERAALALQELKRVGGFERKVLLVVIPTGTGWIDPEALDTVEYLHDGDIASVAVQYSYLSSWIALLTEPDYGVETARALFEAVYGYWTTLPKETRPKLYLHGLSLGSLNSQKSSDLYDVLSDPFQGALWSGPPFSSPTWRMATNGRVEGTPEWLPRFRDSSVIRFANQYTTAHMPGVDWGPMRIVYLQYASDPITFFEAASLYRRPQWMVHHGPDVSTSFRWFPVVTLLQLGLDVAAATTAPMGYGHVYAPEHYIDAWMEVTQPQGWNAEDIQRLKMLFKARRGSTDPA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
16 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
17 2516143018 Ensifer sp. BR816 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
20 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
21 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
24 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
25 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
26 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
27 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
28 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
29 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
30 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
33 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
34 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
35 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
36 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
37 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
38 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
39 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
40 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
41 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
42 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
43 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
44 2643221557 Ensifer sp. Root558 Isolate Unclassified
45 2643221568 Rhizobium sp. Root564 Isolate Unclassified
46 2643221580 Devosia sp. Root635 Isolate Unclassified
47 2643221582 Rhizobium sp. Root651 Isolate Unclassified
48 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
49 2643221607 Rhizobium sp. Root73 Isolate Unclassified
50 2643221610 Ensifer sp. Root74 Isolate Unclassified
51 2643221618 Ensifer sp. Root231 Isolate Unclassified
52 2643221621 Achromobacter sp. Root83 Isolate Unclassified
53 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
54 2643221626 Ensifer sp. Root31 Isolate Unclassified
55 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
56 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
57 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
58 2643221655 Ensifer sp. Root1252 Isolate Unclassified
59 2643221659 Ensifer sp. Root127 Isolate Unclassified
60 2643221668 Ensifer sp. Root423 Isolate Unclassified
61 2643221674 Devosia sp. Root436 Isolate Unclassified
62 2643221675 Ensifer sp. Root1298 Isolate Unclassified
63 2643221680 Ensifer sp. Root1312 Isolate Unclassified
64 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
65 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
66 2643221693 Rhizobium sp. Root491 Isolate Unclassified
67 2643221698 Ensifer sp. Root142 Isolate Unclassified
68 2643221712 Ensifer sp. Root258 Isolate Unclassified
69 2643221718 Rhizobium sp. Root268 Isolate Unclassified
70 2643221723 Ensifer sp. Root278 Isolate Unclassified
71 2643221726 Ensifer sp. Root954 Isolate Unclassified
72 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
73 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
74 2738541293 Rhizobium sp. GV031 Isolate Unclassified
75 2738543024 Aminobacter sp. AP02 Isolate Unclassified
76 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
77 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
78 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
79 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
80 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
81 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
82 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
83 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
84 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
85 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
86 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
87 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
88 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
89 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
90 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
91 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
92 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
93 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
94 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
95 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
96 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
97 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
98 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
99 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
100 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
101 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
102 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
103 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
104 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
105 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
106 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
107 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
108 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
109 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
110 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
111 2844163670 Ensifer sp. 1H6 Isolate Unclassified
112 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
113 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
114 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
115 2854911287 Brucella lupini LUP21 Isolate Unclassified
116 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
117 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
118 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
119 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
120 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
121 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
122 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
123 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
124 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
125 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
126 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
127 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
128 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
129 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
130 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
131 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
132 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
133 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
134 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
135 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
136 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
137 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
138 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
139 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
140 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
141 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
142 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
143 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
144 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
145 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
146 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
147 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
148 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
149 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
150 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
151 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
152 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
153 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
154 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
155 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
156 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
157 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
158 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
159 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
160 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
161 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
162 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
163 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
164 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
165 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
166 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
167 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
168 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
169 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
170 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
171 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
172 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
173 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
174 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
175 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
176 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
177 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
178 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
179 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
180 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
181 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
182 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
183 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
184 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
185 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
186 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
187 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
188 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
189 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
190 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
191 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
192 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
193 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
194 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
195 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
196 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
197 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
198 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
199 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
200 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
201 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
202 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
203 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
204 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
205 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
206 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
207 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
208 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
209 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
210 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
211 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
212 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
213 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
214 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
215 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
216 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
217 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
218 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
219 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
220 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
221 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
222 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
223 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
224 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
225 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
226 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
227 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
228 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
229 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
230 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
231 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
232 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
233 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
234 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
235 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
236 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
237 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
238 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
239 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
240 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
241 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
242 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
243 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
244 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
245 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
246 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
247 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
248 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
249 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
250 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
251 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
252 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
253 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
254 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
255 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
256 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
257 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
258 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
259 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
260 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
261 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
262 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
263 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
264 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
265 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
266 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
267 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
268 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
269 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
270 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
271 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
272 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
273 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
274 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
275 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
276 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
277 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
278 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
279 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
280 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
281 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
282 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
283 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
284 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
285 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
286 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
287 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
288 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
289 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
290 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
291 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
292 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
293 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
294 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
295 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
296 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
297 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
298 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
299 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
300 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
301 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
302 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
303 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
304 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
305 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
306 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
307 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
308 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
309 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
310 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
311 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
312 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
313 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
314 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
315 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
316 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
317 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
318 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
319 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
320 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
321 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
322 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
323 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
324 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
325 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
326 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
327 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
328 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
329 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
330 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
331 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
332 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
333 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
334 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
335 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
336 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
337 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
338 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
339 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
340 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
341 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
342 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
343 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
344 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
345 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
346 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
347 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
348 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
349 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
350 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
351 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
352 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
353 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
354 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
355 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
356 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
357 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
358 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
359 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
360 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
361 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
362 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
363 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
364 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
365 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
366 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
367 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
368 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
369 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
370 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
371 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
372 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
373 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
374 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
375 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
376 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
377 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
378 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
379 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
380 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
381 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
382 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
383 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
384 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
385 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
386 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
387 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
388 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
389 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
390 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
391 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
392 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
393 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
394 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
395 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
396 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
398 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
399 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
400 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
402 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
403 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
418 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
420 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
424 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
425 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
426 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
427 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
428 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
429 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
430 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
431 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
432 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
433 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
434 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
435 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
436 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
437 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
438 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
439 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
440 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
441 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
442 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
443 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
444 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
445 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
446 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
447 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
448 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
449 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
450 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
451 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
452 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
453 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
454 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
455 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
456 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
457 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
458 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
459 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
460 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
461 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
462 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
463 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
464 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
465 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
466 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
467 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
468 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
469 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
470 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
471 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
492 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
493 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
494 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
495 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
496 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
500 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
501 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
502 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
503 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
504 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
505 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
506 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
507 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
508 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
511 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
512 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
513 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
514 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
515 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
516 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
517 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
518 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
519 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
520 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
521 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
522 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
523 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
524 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
525 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.91
Metatranscriptomes 0.14
Isolates 46.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 14.47
Nodule 36.74
Rhizoplane 2.55
Rhizosphere 27.09
Stem 0
Stem Tuber 0
Unclassified 18.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000617 3300002737 Bacteria 25480
2 JGI25158J39367_1000251 3300002739 Bacteria 12351
3 JGI25152J39213_1000727 3300002773 Bacteria 16903
4 JGI25152J39213_1002986 3300002773 Bacteria 6000
5 JGI25152J39213_1005989 3300002773 Bacteria 3410
6 JGI25150J39212_1000160 3300002774 Bacteria 38064
7 JGI25159J45721_1000073 3300002987 Bacteria 48504
8 JGI25151J46595_10000083 3300003187 Bacteria 130658
9 JGI25151J46595_10021626 3300003187 Bacteria 2687
10 JGI25151J46595_10029039 3300003187 Bacteria 2196
11 JGI25406J46586_10002920 3300003203 Bacteria 8060
12 JGI25165J46597_1000416 3300003214 Bacteria 44195
13 JGI25153J46596_10000377 3300003215 Bacteria 30499
14 JGI25153J46596_10001690 3300003215 Bacteria 13087
15 rootH1_10145948 3300003323 Bacteria 2416
16 rootH1_10245112 3300003323 Bacteria 3295
17 JGI25160J50197_1000020 3300003354 Bacteria 232739
18 JGI25160J50197_1000087 3300003354 Bacteria 93379
19 JGI25160J50197_1012767 3300003354 Bacteria 2895
20 JGI25161J50226_1000066 3300003374 Bacteria 94505
21 JGI25161J50226_1000170 3300003374 Bacteria 44244
22 JGI25161J50226_1000856 3300003374 Bacteria 11272
23 Ga0006562J51391_1024319 3300003578 Bacteria 3410
24 Ga0055526_1002182 3300003771 Bacteria 13414
25 Ga0055526_1002581 3300003771 Bacteria 12104
26 Ga0055524_1005926 3300003775 Bacteria 5382
27 Ga0055536_1000618 3300003781 Bacteria 24148
28 Ga0055530_10001081 3300003791 Bacteria 21459
29 Ga0055530_10002197 3300003791 Bacteria 12906
30 Ga0055540_1011849 3300003792 Bacteria 2779
31 Ga0055531_10000338 3300003794 Bacteria 46156
32 Ga0055531_10004558 3300003794 Bacteria 8383
33 Ga0055543_1000068 3300004625 Bacteria 94795
34 Ga0055543_1000163 3300004625 Bacteria 55480
35 Ga0055543_1000342 3300004625 Bacteria 31912
36 Ga0065165_1000013 3300005262 Bacteria 301887
37 Ga0065165_1000839 3300005262 Bacteria 40355
38 Ga0065165_1003220 3300005262 Bacteria 11884
39 Ga0065165_1008693 3300005262 Bacteria 4696
40 Ga0065165_1012858 3300005262 Bacteria 3374
41 Ga0070680_100010201 3300005336 Bacteria 7243
42 Ga0070680_100017091 3300005336 Bacteria 5715
43 Ga0070691_10029764 3300005341 Bacteria 2556
44 Ga0070709_10032591 3300005434 Bacteria 3143
45 Ga0070701_10011473 3300005438 Bacteria 3963
46 Ga0070705_100000771 3300005440 Bacteria 18094
47 Ga0070705_100004354 3300005440 Bacteria 6892
48 Ga0070700_100001946 3300005441 Bacteria 10472
49 Ga0070694_100000473 3300005444 Bacteria 22031
50 Ga0070694_100001936 3300005444 Bacteria 12274
51 Ga0070708_100094484 3300005445 Bacteria 2728
52 Ga0070663_100002012 3300005455 Bacteria 11353
53 Ga0070663_100043414 3300005455 Bacteria 3164
54 Ga0070663_100128437 3300005455 Bacteria 1922
55 Ga0070681_10117168 3300005458 Bacteria 2600
56 Ga0070698_100046693 3300005471 Bacteria 4428
57 Ga0070699_100004529 3300005518 Bacteria 12302
58 Ga0070699_100007119 3300005518 Bacteria 9717
59 Ga0070679_100046589 3300005530 Bacteria 4321
60 Ga0070697_100006390 3300005536 Bacteria 9125
61 Ga0070697_100007929 3300005536 Bacteria 8275
62 Ga0070695_100000316 3300005545 Bacteria 24725
63 Ga0070695_100001732 3300005545 Bacteria 12274
64 Ga0070696_100000295 3300005546 Bacteria 30048
65 Ga0070696_100002462 3300005546 Bacteria 12274
66 Ga0070665_100015391 3300005548 Bacteria 7681
67 Ga0070704_100000136 3300005549 Bacteria 27377
68 Ga0070704_100005198 3300005549 Bacteria 7571
69 Ga0068857_100018215 3300005577 Bacteria 6159
70 Ga0068857_100093549 3300005577 Bacteria 2692
71 Ga0068859_100016079 3300005617 Bacteria 7517
72 Ga0068860_100018500 3300005843 Bacteria 6776
73 Ga0068862_100000584 3300005844 Bacteria 37976
74 Ga0068862_100003537 3300005844 Bacteria 13406
75 Ga0081455_10005789 3300005937 Bacteria 13470
76 Ga0081455_10021295 3300005937 Bacteria 6084
77 Ga0081455_10039598 3300005937 Bacteria 4164
78 Ga0081538_10046156 3300005981 Bacteria 2691
79 Ga0081538_10072829 3300005981 Bacteria 1881
80 Ga0081540_1000433 3300005983 Bacteria 41246
81 Ga0081540_1000747 3300005983 Bacteria 29934
82 Ga0081540_1004020 3300005983 Bacteria 11389
83 Ga0081539_10000501 3300005985 Bacteria 82104
84 Ga0070717_10132317 3300006028 Bacteria 2146
85 Ga0075365_10097095 3300006038 Bacteria 2014
86 Ga0075364_10000091 3300006051 Bacteria 36563
87 Ga0075364_10001796 3300006051 Bacteria 11886
88 Ga0075367_10029046 3300006178 Bacteria 3160
89 Ga0075369_10007129 3300006186 Bacteria 4248
90 Ga0075366_10013926 3300006195 Bacteria 4585
91 Ga0097620_100016079 3300006931 Bacteria 7517
92 Ga0079104_1005814 3300006946 Bacteria 4828
93 Ga0079104_1007489 3300006946 Bacteria 3949
94 Ga0099826_10000030 3300006948 Bacteria 128684
95 Ga0099826_10018729 3300006948 Bacteria 5219
96 Ga0105251_10014590 3300009011 Bacteria 4333
97 Ga0105249_10000560 3300009553 Bacteria 34270
98 Ga0105249_10012793 3300009553 Bacteria 7400
99 Ga0105249_10129164 3300009553 Bacteria 2410
100 Ga0157373_10014167 3300013100 Bacteria 5847
101 Ga0157373_10096508 3300013100 Bacteria 2081
102 Ga0157371_10000307 3300013102 Bacteria 63760
103 Ga0157371_10006146 3300013102 Bacteria 9970
104 Ga0157369_10011799 3300013105 Bacteria 9922
105 Ga0171463_1003 3300013249 Bacteria 695693
106 Ga0183363_1055 3300015690 Bacteria 36103
107 Ga0214544_1000004 3300021320 Bacteria 455869
108 Ga0214544_1000010 3300021320 Bacteria 270164
109 Ga0214542_1000012 3300021321 Bacteria 235800
110 Ga0214542_1000442 3300021321 Bacteria 74244
111 Ga0214545_1000001 3300021324 Bacteria 1092817
112 Ga0214543_1000006 3300021327 Bacteria 443395
113 Ga0214543_1000024 3300021327 Bacteria 235745
114 Ga0214543_1001113 3300021327 Bacteria 50390
115 Ga0213875_10000047 3300021388 Bacteria 148835
116 Ga0228711_1000042 3300022739 Bacteria 85993
117 Ga0228710_1000046 3300022740 Bacteria 86044
118 Ga0209436_100019 3300025208 Bacteria 112688
119 Ga0209436_101086 3300025208 Bacteria 10201
120 Ga0209437_100104 3300025233 Bacteria 220736
121 Ga0207425_1000024 3300025245 Bacteria 328978
122 Ga0207425_1001626 3300025245 Bacteria 9066
123 Ga0209129_1000184 3300025258 Bacteria 87102
124 Ga0209129_1000728 3300025258 Bacteria 21187
125 Ga0209129_1002517 3300025258 Bacteria 8932
126 Ga0209233_1000054 3300025261 Bacteria 439669
127 Ga0209673_1014342 3300025273 Bacteria 3069
128 Ga0209130_1000021 3300025284 Bacteria 374278
129 Ga0209130_1000034 3300025284 Bacteria 302439
130 Ga0209130_1000066 3300025284 Bacteria 192626
131 Ga0209130_1008799 3300025284 Bacteria 2942
132 Ga0209676_1001628 3300025292 Bacteria 19854
133 Ga0209025_1000050 3300025294 Bacteria 331531
134 Ga0209025_1000074 3300025294 Bacteria 277445
135 Ga0209025_1000080 3300025294 Bacteria 267244
136 Ga0209025_1001057 3300025294 Bacteria 40170
137 Ga0209025_1001286 3300025294 Bacteria 34383
138 Ga0209025_1009765 3300025294 Bacteria 6623
139 Ga0209025_1010207 3300025294 Bacteria 6402
140 Ga0209564_1000013 3300025295 Bacteria 775755
141 Ga0209564_1001344 3300025295 Bacteria 26108
142 Ga0209758_1000083 3300025297 Bacteria 257283
143 Ga0209758_1000298 3300025297 Bacteria 97629
144 Ga0209758_1000359 3300025297 Bacteria 81559
145 Ga0209758_1002196 3300025297 Bacteria 20426
146 Ga0209758_1002846 3300025297 Bacteria 16799
147 Ga0209050_1000014 3300025298 Bacteria 774327
148 Ga0209050_1002744 3300025298 Bacteria 14187
149 Ga0209256_1000367 3300025299 Bacteria 72603
150 Ga0209256_1001026 3300025299 Bacteria 32796
151 Ga0209256_1004515 3300025299 Bacteria 8685
152 Ga0209256_1005042 3300025299 Bacteria 7871
153 Ga0207426_1000006 3300025302 Bacteria 1025969
154 Ga0207426_1000008 3300025302 Bacteria 848730
155 Ga0207426_1000010 3300025302 Bacteria 796003
156 Ga0207426_1002621 3300025302 Bacteria 11149
157 Ga0209051_1000575 3300025303 Bacteria 44169
158 Ga0209051_1004210 3300025303 Bacteria 8974
159 Ga0209257_1000019 3300025304 Bacteria 774261
160 Ga0209257_1003075 3300025304 Bacteria 15032
161 Ga0207647_10008212 3300025904 Bacteria 7501
162 Ga0207707_10043971 3300025912 Bacteria 3895
163 Ga0207707_10096833 3300025912 Bacteria 2578
164 Ga0207660_10005487 3300025917 Bacteria 8237
165 Ga0207660_10015895 3300025917 Bacteria 4975
166 Ga0207652_10043786 3300025921 Bacteria 3812
167 Ga0207665_10057570 3300025939 Bacteria 2626
168 Ga0207689_10018681 3300025942 Bacteria 5848
169 Ga0207667_10110278 3300025949 Bacteria 2839
170 Ga0207712_10002123 3300025961 Bacteria 12960
171 Ga0207712_10002767 3300025961 Bacteria 11214
172 Ga0207678_10001625 3300026067 Bacteria 20627
173 Ga0207678_10022357 3300026067 Bacteria 5540
174 Ga0207678_10056422 3300026067 Bacteria 3381
175 Ga0207708_10006489 3300026075 Bacteria 8666
176 Ga0207708_10034417 3300026075 Bacteria 3853
177 Ga0207676_10066144 3300026095 Bacteria 2881
178 Ga0207674_10022082 3300026116 Bacteria 6841
179 Ga0207674_10026736 3300026116 Bacteria 6121
180 Ga0209281_1000246 3300027111 Bacteria 107513
181 Ga0209281_1000620 3300027111 Bacteria 39852
182 Ga0209371_1000009 3300027312 Bacteria 963030
183 Ga0209282_1000062 3300027666 Bacteria 95390
184 Ga0209282_1000222 3300027666 Bacteria 29551
185 Ga0209282_1016609 3300027666 Bacteria 4683
186 Ga0268266_10022020 3300028379 Bacteria 5433
187 Ga0268265_10000551 3300028380 Bacteria 38156
188 Ga0268265_10001728 3300028380 Bacteria 17646
189 Ga0268264_10011226 3300028381 Bacteria 7401
190 Ga0268256_1000010 3300030500 Bacteria 963034
191 Ga0316181_1090707 3300030744 Bacteria 2578
192 Ga0265340_10017886 3300031247 Bacteria 3666
193 Ga0265339_10003416 3300031249 Bacteria 11102
194 Ga0307412_10000790 3300031911 Bacteria 18230
195 Ga0315914_1000015 3300031967 Bacteria 128727
196 Ga0315913_1000021 3300033430 Bacteria 95385
197 Ga0315915_1000020 3300033464 Bacteria 128727
198 Ga0395899_0000030 3300037312 Bacteria 329063
199 Ga0395900_0000023 3300037418 Bacteria 336048
200 Ga0395900_0056005 3300037418 Bacteria 4059
201 Ga0395898_0000038 3300037466 Bacteria 329063
202 Ga0395905_0000021 3300037471 Bacteria 329054
203 Ga0436364_1128732 3300037853 Bacteria 4292
204 Ga0395901_0000018 3300038443 Bacteria 336048
205 Ga0436360_0194844 3300039438 Bacteria 4552
206 Ga0436361_1026313 3300039447 Bacteria 3560
207 Ga0439436_0020476 3300041404 Bacteria 1970
208 Ga0451576_0008596 3300045051 Bacteria 11963
209 Ga0495592_0013730 3300046454 Bacteria 6161
210 Ga0495651_0013305 3300046462 Bacteria 6364
211 Ga0495653_0100073 3300046463 Bacteria 2102
212 Ga0495585_0038650 3300046492 Bacteria 2685
213 Ga0495583_0003907 3300046506 Bacteria 11034
214 Ga0495632_0002130 3300046519 Bacteria 15407
215 Ga0495654_0003939 3300046530 Bacteria 8962
216 Ga0495597_0016358 3300046542 Bacteria 3502
217 Ga0495667_0005052 3300046559 Bacteria 8922
218 Ga0495668_0025525 3300046616 Bacteria 3357
219 Ga0495657_0011788 3300046675 Bacteria 6517
220 Ga0495599_0005809 3300046678 Bacteria 7409
221 Ga0495623_0001850 3300046679 Bacteria 14179
222 Ga0495613_0118356 3300046689 Bacteria 1904
223 Ga0495600_0000403 3300046809 Bacteria 22314
224 Ga0495604_0033751 3300047317 Bacteria 4050
225 Ga0495674_0067704 3300047319 Bacteria 3092
226 Ga0495680_0005382 3300047322 Bacteria 12066
227 Ga0495681_0004400 3300047470 Bacteria 9620
228 Ga0495602_0009085 3300048088 Bacteria 10348
229 Ga0496102_0002456 3300048905 Bacteria 15813
230 Ga0496102_0005213 3300048905 Bacteria 11035
231 Ga0496102_0005565 3300048905 Bacteria 10699
232 Ga0496103_0011349 3300048906 Bacteria 5276
233 Ga0496103_0011407 3300048906 Bacteria 5265
234 Ga0496103_0045650 3300048906 Bacteria 2703
235 Ga0496105_0008863 3300048908 Bacteria 7837
236 Ga0496106_0000115 3300048909 Bacteria 61349
237 Ga0496106_0004960 3300048909 Bacteria 9845
238 Ga0496106_0098734 3300048909 Bacteria 2263
239 Ga0496107_0002608 3300048910 Bacteria 11767
240 Ga0496109_0206616 3300048912 Bacteria 1846
241 Ga0496110_0046246 3300048913 Bacteria 3807
242 Ga0496111_0000859 3300048914 Bacteria 16467
243 Ga0496116_0000036 3300048919 Bacteria 388508
244 Ga0496116_0001253 3300048919 Bacteria 29488
245 Ga0496116_0003264 3300048919 Bacteria 16159
246 Ga0496116_0005563 3300048919 Bacteria 11622
247 Ga0496116_0016958 3300048919 Bacteria 5677
248 Ga0496116_0020883 3300048919 Bacteria 4956
249 Ga0496116_0023111 3300048919 Bacteria 4638
250 Ga0496116_0072316 3300048919 Bacteria 2180
251 Ga0496117_0000002 3300048920 Bacteria 2483758
252 Ga0496117_0001902 3300048920 Bacteria 28009
253 Ga0496117_0003834 3300048920 Bacteria 17102
254 Ga0496117_0004894 3300048920 Bacteria 14430
255 Ga0496117_0013953 3300048920 Bacteria 6961
256 Ga0496118_0000084 3300048921 Bacteria 181733
257 Ga0496118_0037537 3300048921 Bacteria 3897
258 Ga0496118_0040021 3300048921 Bacteria 3732
259 Ga0496118_0049598 3300048921 Bacteria 3231
260 Ga0496120_0000087 3300048923 Bacteria 152857
261 Ga0496120_0007817 3300048923 Bacteria 7890
262 Ga0496121_0000001 3300048924 Bacteria 1830318
263 Ga0496121_0041758 3300048924 Bacteria 4003
264 Ga0496121_0055289 3300048924 Bacteria 3308
265 Ga0496121_0061973 3300048924 Bacteria 3066
266 Ga0496121_0063335 3300048924 Bacteria 3022
267 Ga0496122_0000001 3300048925 Bacteria 1827766
268 Ga0496122_0000047 3300048925 Bacteria 274226
269 Ga0496122_0001509 3300048925 Bacteria 37119
270 Ga0496122_0004312 3300048925 Bacteria 17816
271 Ga0496122_0013093 3300048925 Bacteria 8164
272 Ga0496122_0015896 3300048925 Bacteria 7164
273 Ga0496122_0033054 3300048925 Bacteria 4262
274 Ga0496122_0039895 3300048925 Bacteria 3738
275 Ga0496122_0043762 3300048925 Bacteria 3503
276 Ga0496123_0000001 3300048926 Bacteria 1831497
277 Ga0496123_0000077 3300048926 Bacteria 192607
278 Ga0496123_0000950 3300048926 Bacteria 45086
279 Ga0496123_0002482 3300048926 Bacteria 22770
280 Ga0496123_0005090 3300048926 Bacteria 13427
281 Ga0496123_0031021 3300048926 Bacteria 3899
282 Ga0496123_0047314 3300048926 Bacteria 2908
283 Ga0496124_0001512 3300048927 Bacteria 33884
284 Ga0496124_0001806 3300048927 Bacteria 29682
285 Ga0496124_0002257 3300048927 Bacteria 25595
286 Ga0496124_0007793 3300048927 Bacteria 11310
287 Ga0496124_0015792 3300048927 Bacteria 7215
288 Ga0496124_0017462 3300048927 Bacteria 6761
289 Ga0496124_0064483 3300048927 Bacteria 3057
290 Ga0496124_0064830 3300048927 Bacteria 3048
291 Ga0496125_0000001 3300048928 Bacteria 1766138
292 Ga0496125_0001018 3300048928 Bacteria 43593
293 Ga0496125_0001877 3300048928 Bacteria 28869
294 Ga0496125_0003374 3300048928 Bacteria 19453
295 Ga0496125_0004867 3300048928 Bacteria 15242
296 Ga0496125_0066033 3300048928 Bacteria 2862
297 Ga0496126_0001111 3300048929 Bacteria 45099
298 Ga0496126_0006138 3300048929 Bacteria 13464
299 Ga0496126_0009586 3300048929 Bacteria 10269
300 Ga0496126_0033390 3300048929 Bacteria 4842
301 Ga0496126_0069562 3300048929 Bacteria 3139
302 Ga0501031_0000034 3300049568 Bacteria 75416
303 Ga0501031_0007232 3300049568 Bacteria 7244
304 Ga0501031_0009776 3300049568 Bacteria 6244
305 Ga0501032_0000006 3300049569 Bacteria 261727
306 Ga0501033_0000053 3300049570 Bacteria 109042
307 Ga0501033_0014699 3300049570 Bacteria 5941
308 Ga0501033_0035489 3300049570 Bacteria 3738
309 Ga0501034_0000030 3300049571 Bacteria 248180
310 Ga0501034_0001128 3300049571 Bacteria 37285
311 Ga0501034_0019677 3300049571 Bacteria 6902
312 Ga0501034_0021196 3300049571 Bacteria 6627
313 Ga0501034_0021642 3300049571 Bacteria 6549
314 Ga0501036_0000003 3300049572 Bacteria 261545
315 Ga0501036_0013008 3300049572 Bacteria 6910
316 Ga0501036_0029049 3300049572 Bacteria 4673
317 Ga0501037_0000003 3300049573 Bacteria 261548
318 Ga0501037_0011432 3300049573 Bacteria 6532
319 Ga0501037_0019572 3300049573 Bacteria 4994
320 Ga0501038_0000004 3300049574 Bacteria 261289
321 Ga0501038_0006146 3300049574 Bacteria 11117
322 Ga0501038_0036635 3300049574 Bacteria 4304
323 Ga0501038_0043325 3300049574 Bacteria 3913
324 Ga0501039_0000008 3300049575 Bacteria 274778
325 Ga0501039_0012414 3300049575 Bacteria 6504
326 Ga0501040_0001474 3300049576 Bacteria 14927
327 Ga0501043_0002232 3300049579 Bacteria 16500
328 Ga0501043_0007886 3300049579 Bacteria 8416
329 Ga0501043_0017564 3300049579 Bacteria 5609
330 Ga0501046_0011556 3300049580 Bacteria 7549
331 Ga0501047_0002997 3300049581 Bacteria 16024
332 Ga0501047_0017162 3300049581 Bacteria 6927
333 Ga0501047_0037718 3300049581 Bacteria 4673
334 Ga0501047_0099887 3300049581 Bacteria 2781
335 Ga0501070_0009380 3300049586 Bacteria 8274
336 Ga0501070_0019021 3300049586 Bacteria 5760
337 Ga0501070_0019149 3300049586 Bacteria 5742
338 Ga0501071_0049311 3300049587 Bacteria 3031
339 Ga0501074_0052406 3300049590 Bacteria 2945
340 Ga0501075_0010771 3300049591 Bacteria 6442
341 Ga0501080_0013103 3300049742 Bacteria 7616
342 Ga0501080_0030615 3300049742 Bacteria 5015
343 Ga0501080_0045314 3300049742 Bacteria 4094
344 Ga0501083_0009419 3300049744 Bacteria 6898
345 Ga0501035_0000031 3300049822 Bacteria 175591
346 Ga0501035_0005792 3300049822 Bacteria 11647
347 Ga0501035_0033428 3300049822 Bacteria 4677
348 Ga0501035_0044170 3300049822 Bacteria 4013
349 Ga0501044_0000008 3300049823 Bacteria 274778
350 Ga0501044_0012449 3300049823 Bacteria 9211
351 Ga0501044_0017596 3300049823 Bacteria 7666
352 Ga0501044_0073089 3300049823 Bacteria 3485
353 Ga0501044_0127957 3300049823 Bacteria 2536
354 Ga0501044_0171212 3300049823 Bacteria 2143
355 Ga0501045_0047945 3300049824 Bacteria 3113
356 nmdc:mga00v17_1042_c1 3300050491 Bacteria 14699
357 nmdc:mga00v17_52_c1 3300050491 Bacteria 72738
358 nmdc:mga00v17_84169_c1 3300050491 Bacteria 1990
359 nmdc:mga0yw44_19110_c1 3300050492 Bacteria 3771
360 nmdc:mga06z11_19283_c1 3300050494 Bacteria 3132
361 Ga0500635_0022501 3300053080 Bacteria 1955
362 Ga0500560_004145 3300053107 Bacteria 3041
363 Ga0500560_004674 3300053107 Bacteria 2942
364 Ga0500561_0000638 3300053137 Bacteria 5565
365 Ga0500568_0000203 3300053139 Bacteria 52356
366 Ga0500568_0000487 3300053139 Bacteria 29332
367 Ga0500624_000717 3300053157 Bacteria 8287
368 Ga0500634_0016218 3300053161 Bacteria 3972
369 Ga0500636_0000004 3300053177 Bacteria 202392
370 Ga0500636_0000173 3300053177 Bacteria 34092
371 Ga0500636_0001087 3300053177 Bacteria 14555
372 Ga0500609_003296 3300053731 Bacteria 2279
373 Ga0501082_0023119 3300060353 Bacteria 5361
374 Ga0530510_0139181 3300061734 Bacteria 1788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0019677 Ga0501034_0019677_1670_3385 478
2 3300049574 Ga0501038_0036635 Ga0501038_0036635_880_2595 478
3 3300049822 Ga0501035_0044170 Ga0501035_0044170_923_2638 478
4 3300049823 Ga0501044_0017596 Ga0501044_0017596_2442_4157 478
5 3300025939 Ga0207665_10057570 Ga0207665_100575702 480
6 3300005937 Ga0081455_10005789 Ga0081455_100057892 486
7 3300005262 Ga0065165_1003220 Ga0065165_10032203 490
8 iso_pu_bacteria 2885366525 2885366531 493
9 3300003578 Ga0006562J51391_1024319 Ga0006562J51391_10243193 497
10 3300005455 Ga0070663_100043414 Ga0070663_1000434142 500
11 3300025949 Ga0207667_10110278 Ga0207667_101102782 500
12 3300025297 Ga0209758_1000359 Ga0209758_10003594 501
13 3300003354 JGI25160J50197_1000087 JGI25160J50197_100008790 506
14 3300003374 JGI25161J50226_1000066 JGI25161J50226_10000666 506
15 3300004625 Ga0055543_1000068 Ga0055543_100006890 506
16 3300005262 Ga0065165_1000839 Ga0065165_10008396 506
17 3300025284 Ga0209130_1000021 Ga0209130_1000021268 506
18 3300025302 Ga0207426_1000010 Ga0207426_100001090 506
19 3300039438 Ga0436360_0194844 Ga0436360_0194844_289_2001 506
20 3300039447 Ga0436361_1026313 Ga0436361_1026313_1619_3331 506
21 3300048924 Ga0496121_0061973 Ga0496121_0061973_468_2120 506
22 3300048928 Ga0496125_0066033 Ga0496125_0066033_843_2495 506
23 3300025904 Ga0207647_10008212 Ga0207647_100082122 510
24 3300046542 Ga0495597_0016358 Ga0495597_0016358_741_2384 510
25 3300046616 Ga0495668_0025525 Ga0495668_0025525_1387_3030 510
26 3300048905 Ga0496102_0005213 Ga0496102_0005213_2357_4000 510
27 3300048906 Ga0496103_0011407 Ga0496103_0011407_3008_4651 510
28 3300048912 Ga0496109_0206616 Ga0496109_0206616_25_1668 510
29 3300048921 Ga0496118_0049598 Ga0496118_0049598_184_1827 510
30 3300049591 Ga0501075_0010771 Ga0501075_0010771_3863_5557 511
31 3300003323 rootH1_10245112 rootH1_102451122 512
32 3300046675 Ga0495657_0011788 Ga0495657_0011788_4307_6007 512
33 3300046679 Ga0495623_0001850 Ga0495623_0001850_2375_4075 512
34 3300046689 Ga0495613_0118356 Ga0495613_0118356_172_1872 512
35 3300046809 Ga0495600_0000403 Ga0495600_0000403_641_2341 512
36 3300047319 Ga0495674_0067704 Ga0495674_0067704_1011_2711 512
37 3300048088 Ga0495602_0009085 Ga0495602_0009085_6071_7771 512
38 3300049824 Ga0501045_0047945 Ga0501045_0047945_623_2317 512
39 3300053177 Ga0500636_0001087 Ga0500636_0001087_993_2543 512
40 3300061734 Ga0530510_0139181 Ga0530510_0139181_45_1739 512
41 3300046454 Ga0495592_0013730 Ga0495592_0013730_3794_5494 513
42 3300046462 Ga0495651_0013305 Ga0495651_0013305_1777_3477 513
43 3300046463 Ga0495653_0100073 Ga0495653_0100073_64_1767 513
44 3300046559 Ga0495667_0005052 Ga0495667_0005052_6579_8279 513
45 3300046678 Ga0495599_0005809 Ga0495599_0005809_1185_2885 513
46 3300047317 Ga0495604_0033751 Ga0495604_0033751_1704_3404 513
47 3300047322 Ga0495680_0005382 Ga0495680_0005382_6051_7751 513
48 3300049571 Ga0501034_0001128 Ga0501034_0001128_29721_31421 514
49 3300005983 Ga0081540_1000747 Ga0081540_100074717 515
50 3300006038 Ga0075365_10097095 Ga0075365_100970951 515
51 3300050492 nmdc:mga0yw44_19110_c1 nmdc:mga0yw44_19110_c1_37_1701 515
52 3300005336 Ga0070680_100010201 Ga0070680_1000102016 516
53 3300005341 Ga0070691_10029764 Ga0070691_100297641 516
54 3300005440 Ga0070705_100000771 Ga0070705_1000007714 516
55 3300005441 Ga0070700_100001946 Ga0070700_1000019461 516
56 3300005444 Ga0070694_100000473 Ga0070694_1000004734 516
57 3300005455 Ga0070663_100002012 Ga0070663_1000020123 516
58 3300005518 Ga0070699_100007119 Ga0070699_1000071194 516
59 3300005530 Ga0070679_100046589 Ga0070679_1000465895 516
60 3300005536 Ga0070697_100006390 Ga0070697_1000063905 516
61 3300005545 Ga0070695_100000316 Ga0070695_10000031623 516
62 3300005546 Ga0070696_100000295 Ga0070696_10000029536 516
63 3300005549 Ga0070704_100000136 Ga0070704_10000013628 516
64 3300005577 Ga0068857_100093549 Ga0068857_1000935492 516
65 3300005843 Ga0068860_100018500 Ga0068860_1000185003 516
66 3300005844 Ga0068862_100000584 Ga0068862_1000005842 516
67 3300009553 Ga0105249_10000560 Ga0105249_100005607 516
68 3300025912 Ga0207707_10043971 Ga0207707_100439712 516
69 3300025917 Ga0207660_10005487 Ga0207660_100054873 516
70 3300025921 Ga0207652_10043786 Ga0207652_100437863 516
71 3300025961 Ga0207712_10002123 Ga0207712_100021237 516
72 3300026067 Ga0207678_10001625 Ga0207678_1000162517 516
73 3300026075 Ga0207708_10034417 Ga0207708_100344174 516
74 3300026095 Ga0207676_10066144 Ga0207676_100661441 516
75 3300026116 Ga0207674_10022082 Ga0207674_100220828 516
76 3300028380 Ga0268265_10000551 Ga0268265_1000055140 516
77 3300028381 Ga0268264_10011226 Ga0268264_100112265 516
78 3300048905 Ga0496102_0002456 Ga0496102_0002456_3650_5323 516
79 3300048906 Ga0496103_0045650 Ga0496103_0045650_929_2602 516
80 3300048909 Ga0496106_0004960 Ga0496106_0004960_3736_5409 516
81 3300048910 Ga0496107_0002608 Ga0496107_0002608_6853_8526 516
82 3300049568 Ga0501031_0000034 Ga0501031_0000034_46047_47630 516
83 3300049569 Ga0501032_0000006 Ga0501032_0000006_89835_91418 516
84 3300049570 Ga0501033_0000053 Ga0501033_0000053_102886_104469 516
85 3300049571 Ga0501034_0000030 Ga0501034_0000030_143712_145295 516
86 3300049572 Ga0501036_0000003 Ga0501036_0000003_170310_171893 516
87 3300049573 Ga0501037_0000003 Ga0501037_0000003_170310_171893 516
88 3300049574 Ga0501038_0000004 Ga0501038_0000004_170310_171893 516
89 3300049575 Ga0501039_0000008 Ga0501039_0000008_170310_171893 516
90 3300049576 Ga0501040_0001474 Ga0501040_0001474_13117_14700 516
91 3300049579 Ga0501043_0002232 Ga0501043_0002232_4595_6178 516
92 3300049579 Ga0501043_0017564 Ga0501043_0017564_3761_5407 516
93 3300049581 Ga0501047_0002997 Ga0501047_0002997_4170_5753 516
94 3300049586 Ga0501070_0009380 Ga0501070_0009380_4921_6504 516
95 3300049822 Ga0501035_0000031 Ga0501035_0000031_71123_72706 516
96 3300049822 Ga0501035_0033428 Ga0501035_0033428_3006_4652 516
97 3300049823 Ga0501044_0000008 Ga0501044_0000008_170310_171893 516
98 3300031247 Ga0265340_10017886 Ga0265340_100178862 518
99 3300031249 Ga0265339_10003416 Ga0265339_100034169 518
100 3300048925 Ga0496122_0000047 Ga0496122_0000047_201690_203414 518
101 3300048926 Ga0496123_0000077 Ga0496123_0000077_19288_21012 518
102 3300048928 Ga0496125_0003374 Ga0496125_0003374_872_2596 518
103 3300049581 Ga0501047_0099887 Ga0501047_0099887_31_1602 518
104 3300053177 Ga0500636_0000004 Ga0500636_0000004_145121_146758 518
105 3300053177 Ga0500636_0000173 Ga0500636_0000173_30860_32554 518
106 3300053731 Ga0500609_003296 Ga0500609_003296_339_2039 518
107 iso_pu_bacteria 2551306086 2551690196 518
108 3300031911 Ga0307412_10000790 Ga0307412_100007907 519
109 3300048924 Ga0496121_0063335 Ga0496121_0063335_1205_2863 519
110 3300048927 Ga0496124_0064830 Ga0496124_0064830_1233_2891 519
111 3300053080 Ga0500635_0022501 Ga0500635_0022501_233_1927 519
112 3300025942 Ga0207689_10018681 Ga0207689_100186814 521
113 3300045051 Ga0451576_0008596 Ga0451576_0008596_7108_8697 521
114 3300005983 Ga0081540_1000433 Ga0081540_100043317 522
115 3300037418 Ga0395900_0056005 Ga0395900_0056005_330_2054 524
116 3300050491 nmdc:mga00v17_84169_c1 nmdc:mga00v17_84169_c1_222_1886 525
117 iso_pu_bacteria 2838661181 2838665268 525
118 3300003203 JGI25406J46586_10002920 JGI25406J46586_100029206 526
119 3300005985 Ga0081539_10000501 Ga0081539_1000050153 526
120 3300048919 Ga0496116_0072316 Ga0496116_0072316_166_1890 526
121 3300053139 Ga0500568_0000203 Ga0500568_0000203_42043_43683 526
122 3300006028 Ga0070717_10132317 Ga0070717_101323171 527
123 3300049823 Ga0501044_0171212 Ga0501044_0171212_237_1886 527
124 3300002773 JGI25152J39213_1002986 JGI25152J39213_10029862 528
125 3300003775 Ga0055524_1005926 Ga0055524_10059263 528
126 3300005455 Ga0070663_100128437 Ga0070663_1001284371 528
127 3300041404 Ga0439436_0020476 Ga0439436_0020476_122_1954 528
128 3300049568 Ga0501031_0007232 Ga0501031_0007232_2567_4189 528
129 3300049570 Ga0501033_0014699 Ga0501033_0014699_3058_4680 528
130 3300049571 Ga0501034_0021642 Ga0501034_0021642_1753_3375 528
131 3300049572 Ga0501036_0013008 Ga0501036_0013008_3058_4680 528
132 3300049573 Ga0501037_0011432 Ga0501037_0011432_3175_4797 528
133 3300049574 Ga0501038_0006146 Ga0501038_0006146_4781_6403 528
134 3300049575 Ga0501039_0012414 Ga0501039_0012414_1708_3330 528
135 3300049579 Ga0501043_0007886 Ga0501043_0007886_1753_3375 528
136 3300049581 Ga0501047_0017162 Ga0501047_0017162_1753_3375 528
137 3300049586 Ga0501070_0019149 Ga0501070_0019149_1292_2914 528
138 3300049742 Ga0501080_0045314 Ga0501080_0045314_632_2254 528
139 3300049822 Ga0501035_0005792 Ga0501035_0005792_4189_5811 528
140 3300049823 Ga0501044_0012449 Ga0501044_0012449_1753_3375 528
141 3300003354 JGI25160J50197_1012767 JGI25160J50197_10127672 529
142 3300021321 Ga0214542_1000442 Ga0214542_100044228 529
143 3300021327 Ga0214543_1000006 Ga0214543_100000638 529
144 3300025284 Ga0209130_1008799 Ga0209130_10087992 529
145 3300002739 JGI25158J39367_1000251 JGI25158J39367_100025111 530
146 3300003215 JGI25153J46596_10001690 JGI25153J46596_1000169012 530
147 3300003323 rootH1_10145948 rootH1_101459481 530
148 3300003374 JGI25161J50226_1000170 JGI25161J50226_10001706 530
149 3300003771 Ga0055526_1002182 Ga0055526_10021822 530
150 3300003792 Ga0055540_1011849 Ga0055540_10118492 530
151 3300004625 Ga0055543_1000342 Ga0055543_100034215 530
152 3300005262 Ga0065165_1012858 Ga0065165_10128582 530
153 3300006051 Ga0075364_10001796 Ga0075364_100017963 530
154 3300021320 Ga0214544_1000004 Ga0214544_1000004379 530
155 3300021324 Ga0214545_1000001 Ga0214545_100000141 530
156 3300025208 Ga0209436_100019 Ga0209436_1000193 530
157 3300025258 Ga0209129_1000728 Ga0209129_100072813 530
158 3300025284 Ga0209130_1000066 Ga0209130_1000066135 530
159 3300025295 Ga0209564_1001344 Ga0209564_100134416 530
160 3300025297 Ga0209758_1000298 Ga0209758_100029851 530
161 3300025299 Ga0209256_1004515 Ga0209256_10045152 530
162 3300025302 Ga0207426_1000008 Ga0207426_1000008748 530
163 3300025303 Ga0209051_1000575 Ga0209051_100057532 530
164 3300048914 Ga0496111_0000859 Ga0496111_0000859_9848_11461 530
165 3300048925 Ga0496122_0033054 Ga0496122_0033054_1885_3480 530
166 3300048926 Ga0496123_0047314 Ga0496123_0047314_339_1934 530
167 3300049744 Ga0501083_0009419 Ga0501083_0009419_231_1892 530
168 3300050491 nmdc:mga00v17_1042_c1 nmdc:mga00v17_1042_c1_2072_3727 530
169 3300046530 Ga0495654_0003939 Ga0495654_0003939_2734_4521 531
170 3300049568 Ga0501031_0009776 Ga0501031_0009776_2785_4407 531
171 3300049570 Ga0501033_0035489 Ga0501033_0035489_1085_2707 531
172 3300049571 Ga0501034_0021196 Ga0501034_0021196_3167_4789 531
173 3300049572 Ga0501036_0029049 Ga0501036_0029049_1213_2835 531
174 3300049573 Ga0501037_0019572 Ga0501037_0019572_2160_3782 531
175 3300049574 Ga0501038_0043325 Ga0501038_0043325_2148_3770 531
176 3300049580 Ga0501046_0011556 Ga0501046_0011556_4801_6423 531
177 3300049581 Ga0501047_0037718 Ga0501047_0037718_1213_2835 531
178 3300049586 Ga0501070_0019021 Ga0501070_0019021_821_2443 531
179 3300049742 Ga0501080_0013103 Ga0501080_0013103_4284_5906 531
180 3300049823 Ga0501044_0073089 Ga0501044_0073089_25_1647 531
181 3300021320 Ga0214544_1000010 Ga0214544_10000104 532
182 3300021321 Ga0214542_1000012 Ga0214542_10000128 532
183 3300021327 Ga0214543_1000024 Ga0214543_10000249 532
184 3300037312 Ga0395899_0000030 Ga0395899_0000030_248292_249974 532
185 3300037418 Ga0395900_0000023 Ga0395900_0000023_254698_256380 532
186 3300037466 Ga0395898_0000038 Ga0395898_0000038_248292_249974 532
187 3300037471 Ga0395905_0000021 Ga0395905_0000021_248292_249974 532
188 3300038443 Ga0395901_0000018 Ga0395901_0000018_254698_256380 532
189 3300005434 Ga0070709_10032591 Ga0070709_100325913 533
190 3300005981 Ga0081538_10072829 Ga0081538_100728292 533
191 3300049587 Ga0501071_0049311 Ga0501071_0049311_39_1700 533
192 iso_pu_bacteria 2551306092 2551736702 533
193 3300002773 JGI25152J39213_1005989 JGI25152J39213_10059892 534
194 3300025245 Ga0207425_1001626 Ga0207425_10016268 534
195 3300025258 Ga0209129_1002517 Ga0209129_100251710 534
196 3300025294 Ga0209025_1009765 Ga0209025_10097656 534
197 3300025297 Ga0209758_1002196 Ga0209758_10021965 534
198 3300025297 Ga0209758_1002846 Ga0209758_10028467 534
199 3300048909 Ga0496106_0000115 Ga0496106_0000115_3232_4917 535
200 3300053139 Ga0500568_0000487 Ga0500568_0000487_18035_19720 535
201 3300013100 Ga0157373_10096508 Ga0157373_100965081 536
202 3300021327 Ga0214543_1001113 Ga0214543_10011139 536
203 3300048927 Ga0496124_0015792 Ga0496124_0015792_3837_5450 536
204 3300006946 Ga0079104_1005814 Ga0079104_10058144 537
205 3300006946 Ga0079104_1007489 Ga0079104_10074892 537
206 3300021388 Ga0213875_10000047 Ga0213875_100000471 537
207 3300022739 Ga0228711_1000042 Ga0228711_100004217 537
208 3300022740 Ga0228710_1000046 Ga0228710_100004660 537
209 3300027111 Ga0209281_1000246 Ga0209281_100024617 537
210 3300027111 Ga0209281_1000620 Ga0209281_100062016 537
211 3300027666 Ga0209282_1000062 Ga0209282_100006217 537
212 3300031967 Ga0315914_1000015 Ga0315914_100001543 537
213 3300033430 Ga0315913_1000021 Ga0315913_100002168 537
214 3300033464 Ga0315915_1000020 Ga0315915_100002043 537
215 3300037853 Ga0436364_1128732 Ga0436364_1128732_735_2378 537
216 3300048925 Ga0496122_0001509 Ga0496122_0001509_5448_7067 537
217 3300048926 Ga0496123_0000950 Ga0496123_0000950_5448_7067 537
218 iso_pu_bacteria 2874168670 2874170071 537
219 iso_pu_bacteria 2876363079 2876369027 537
220 iso_pu_bacteria 2903448605 2903449118 537
221 iso_pu_bacteria 2968083720 2968086063 537
222 iso_pu_bacteria 637000159 637078645 537
223 3300005937 Ga0081455_10021295 Ga0081455_100212954 538
224 3300005981 Ga0081538_10046156 Ga0081538_100461561 538
225 3300005983 Ga0081540_1004020 Ga0081540_100402011 538
226 3300046519 Ga0495632_0002130 Ga0495632_0002130_827_2476 538
227 3300048924 Ga0496121_0055289 Ga0496121_0055289_779_2422 538
228 3300048929 Ga0496126_0006138 Ga0496126_0006138_3573_5219 538
229 3300060353 Ga0501082_0023119 Ga0501082_0023119_1478_3124 538
230 iso_pu_bacteria 2513237351 2514586992 538
231 iso_pu_bacteria 2537561587 2537875572 538
232 iso_pu_bacteria 2643221550 2643773983 538
233 iso_pu_bacteria 2889033259 2889037469 538
234 iso_pu_bacteria 650716007 650739389 538
235 iso_pu_bacteria 8056681323 8056685616 538
236 3300005937 Ga0081455_10039598 Ga0081455_100395982 539
237 3300013105 Ga0157369_10011799 Ga0157369_100117998 539
238 iso_pu_bacteria 2513237146 2513929214 539
239 iso_pu_bacteria 2599185170 2599415557 539
240 iso_pu_bacteria 2838035591 2838035675 539
241 iso_pu_bacteria 2889790730 2889795655 539
242 iso_pu_bacteria 2599185236 2599718703 540
243 iso_pu_bacteria 2643221623 2644131222 540
244 iso_pu_bacteria 2738543024 2739310687 540
245 iso_pu_bacteria 8002285264 8002290392 540
246 3300049590 Ga0501074_0052406 Ga0501074_0052406_267_1943 541
247 3300049742 Ga0501080_0030615 Ga0501080_0030615_2110_3786 541
248 3300049823 Ga0501044_0127957 Ga0501044_0127957_621_2297 541
249 iso_pu_bacteria 2643221557 2643802961 541
250 iso_pu_bacteria 2643221610 2644063324 541
251 iso_pu_bacteria 2643221668 2644374606 541
252 iso_pu_bacteria 2643221675 2644414087 541
253 iso_pu_bacteria 2643221680 2644447615 541
254 iso_pu_bacteria 2643221723 2644675957 541
255 iso_pu_bacteria 2643221726 2644690088 541
256 iso_pu_bacteria 2657244999 2657681623 541
257 iso_pu_bacteria 2802429268 2804752812 541
258 iso_pu_bacteria 2916068649 2916070395 541
259 iso_pu_bacteria 2989349275 2989349913 541
260 3300005262 Ga0065165_1008693 Ga0065165_10086932 542
261 iso_pu_bacteria 2551306093 2551742518 542
262 iso_pu_bacteria 2582581283 2585164471 542
263 iso_pu_bacteria 2582581866 2585394772 542
264 iso_pu_bacteria 2643221580 2643909729 542
265 iso_pu_bacteria 2643221607 2644051571 542
266 iso_pu_bacteria 2643221636 2644200069 542
267 iso_pu_bacteria 2643221637 2644207221 542
268 iso_pu_bacteria 2643221674 2644413584 542
269 iso_pu_bacteria 2643221686 2644480440 542
270 iso_pu_bacteria 2643221689 2644498830 542
271 iso_pu_bacteria 2643221718 2644650869 542
272 iso_pu_bacteria 2891373044 2891373461 542
273 iso_pu_bacteria 2898795034 2898798226 542
274 iso_pu_bacteria 3003930520 3003934318 542
275 3300003791 Ga0055530_10001081 Ga0055530_1000108117 543
276 3300003791 Ga0055530_10002197 Ga0055530_100021975 543
277 3300003794 Ga0055531_10000338 Ga0055531_100003389 543
278 3300005336 Ga0070680_100017091 Ga0070680_1000170911 543
279 3300005438 Ga0070701_10011473 Ga0070701_100114732 543
280 3300005440 Ga0070705_100004354 Ga0070705_1000043544 543
281 3300005444 Ga0070694_100001936 Ga0070694_1000019368 543
282 3300005445 Ga0070708_100094484 Ga0070708_1000944841 543
283 3300005458 Ga0070681_10117168 Ga0070681_101171681 543
284 3300005471 Ga0070698_100046693 Ga0070698_1000466931 543
285 3300005518 Ga0070699_100004529 Ga0070699_1000045293 543
286 3300005536 Ga0070697_100007929 Ga0070697_1000079293 543
287 3300005545 Ga0070695_100001732 Ga0070695_1000017328 543
288 3300005546 Ga0070696_100002462 Ga0070696_1000024628 543
289 3300005549 Ga0070704_100005198 Ga0070704_1000051987 543
290 3300005577 Ga0068857_100018215 Ga0068857_1000182152 543
291 3300005617 Ga0068859_100016079 Ga0068859_1000160793 543
292 3300005844 Ga0068862_100003537 Ga0068862_1000035377 543
293 3300006931 Ga0097620_100016079 Ga0097620_1000160793 543
294 3300009553 Ga0105249_10012793 Ga0105249_100127935 543
295 3300025298 Ga0209050_1000014 Ga0209050_1000014596 543
296 3300025304 Ga0209257_1000019 Ga0209257_100001996 543
297 3300025912 Ga0207707_10096833 Ga0207707_100968331 543
298 3300025917 Ga0207660_10015895 Ga0207660_100158954 543
299 3300025961 Ga0207712_10002767 Ga0207712_100027672 543
300 3300026067 Ga0207678_10022357 Ga0207678_100223572 543
301 3300026075 Ga0207708_10006489 Ga0207708_100064891 543
302 3300026116 Ga0207674_10026736 Ga0207674_100267361 543
303 3300028380 Ga0268265_10001728 Ga0268265_100017283 543
304 3300048905 Ga0496102_0005565 Ga0496102_0005565_6385_8160 543
305 3300048906 Ga0496103_0011349 Ga0496103_0011349_701_2476 543
306 3300048925 Ga0496122_0004312 Ga0496122_0004312_1963_3606 543
307 3300003187 JGI25151J46595_10021626 JGI25151J46595_100216262 544
308 3300025294 Ga0209025_1001057 Ga0209025_100105742 544
309 3300048920 Ga0496117_0001902 Ga0496117_0001902_14931_16577 544
310 3300048927 Ga0496124_0007793 Ga0496124_0007793_8501_10147 544
311 3300048928 Ga0496125_0001018 Ga0496125_0001018_18361_20007 544
312 3300048929 Ga0496126_0009586 Ga0496126_0009586_3322_4968 544
313 iso_pu_bacteria 2585427594 2585846806 544
314 iso_pu_bacteria 2738541293 2738804231 544
315 iso_pu_bacteria 2775507049 2776916107 544
316 iso_pu_bacteria 8054563764 8054564642 544
317 3300002987 JGI25159J45721_1000073 JGI25159J45721_100007315 545
318 3300003187 JGI25151J46595_10029039 JGI25151J46595_100290392 545
319 3300003354 JGI25160J50197_1000020 JGI25160J50197_1000020178 545
320 3300003374 JGI25161J50226_1000856 JGI25161J50226_10008562 545
321 3300003771 Ga0055526_1002581 Ga0055526_10025815 545
322 3300003781 Ga0055536_1000618 Ga0055536_100061818 545
323 3300003794 Ga0055531_10004558 Ga0055531_100045582 545
324 3300004625 Ga0055543_1000163 Ga0055543_100016335 545
325 3300005262 Ga0065165_1000013 Ga0065165_100001338 545
326 3300013249 Ga0171463_1003 Ga0171463_100336 545
327 3300015690 Ga0183363_1055 Ga0183363_105511 545
328 3300025208 Ga0209436_101086 Ga0209436_1010864 545
329 3300025284 Ga0209130_1000034 Ga0209130_100003437 545
330 3300025292 Ga0209676_1001628 Ga0209676_100162815 545
331 3300025294 Ga0209025_1001286 Ga0209025_100128630 545
332 3300025295 Ga0209564_1000013 Ga0209564_100001338 545
333 3300025298 Ga0209050_1002744 Ga0209050_10027442 545
334 3300025299 Ga0209256_1000367 Ga0209256_100036742 545
335 3300025299 Ga0209256_1001026 Ga0209256_100102637 545
336 3300025302 Ga0207426_1000006 Ga0207426_1000006411 545
337 3300025303 Ga0209051_1004210 Ga0209051_10042104 545
338 3300025304 Ga0209257_1003075 Ga0209257_10030754 545
339 iso_pu_bacteria 2508501122 2509108302 545
340 iso_pu_bacteria 2509276019 2509376568 545
341 iso_pu_bacteria 2510065057 2510307760 545
342 iso_pu_bacteria 2511231052 2511502339 545
343 iso_pu_bacteria 2512875026 2512970580 545
344 iso_pu_bacteria 2513237086 2513587236 545
345 iso_pu_bacteria 2513237089 2513601642 545
346 iso_pu_bacteria 2513237091 2513619253 545
347 iso_pu_bacteria 2513237140 2513885556 545
348 iso_pu_bacteria 2513237143 2513905972 545
349 iso_pu_bacteria 2513237156 2513984205 545
350 iso_pu_bacteria 2513237160 2514002915 545
351 iso_pu_bacteria 2515154107 2515609126 545
352 iso_pu_bacteria 2516143018 2516204220 545
353 iso_pu_bacteria 2516653046 2516893719 545
354 iso_pu_bacteria 2517487022 2517570449 545
355 iso_pu_bacteria 2524023207 2524448446 545
356 iso_pu_bacteria 2551306084 2551681137 545
357 iso_pu_bacteria 2551306085 2551687573 545
358 iso_pu_bacteria 2551306087 2551698696 545
359 iso_pu_bacteria 2558860100 2558864363 545
360 iso_pu_bacteria 2643221568 2643856013 545
361 iso_pu_bacteria 2643221618 2644107157 545
362 iso_pu_bacteria 2643221626 2644150722 545
363 iso_pu_bacteria 2643221655 2644308553 545
364 iso_pu_bacteria 2643221659 2644335369 545
365 iso_pu_bacteria 2643221698 2644539774 545
366 iso_pu_bacteria 2643221712 2644614493 545
367 iso_pu_bacteria 2690316117 2692315464 545
368 iso_pu_bacteria 2751185821 2753462098 545
369 iso_pu_bacteria 2791355082 2792585055 545
370 iso_pu_bacteria 2791355091 2792620696 545
371 iso_pu_bacteria 2791355092 2792626056 545
372 iso_pu_bacteria 2791355094 2792638997 545
373 iso_pu_bacteria 2802428858 2802716934 545
374 iso_pu_bacteria 2802428859 2802725683 545
375 iso_pu_bacteria 2802428860 2802730228 545
376 iso_pu_bacteria 2802428861 2802737801 545
377 iso_pu_bacteria 2802428862 2802742745 545
378 iso_pu_bacteria 2802428863 2802750233 545
379 iso_pu_bacteria 2838074704 2838076766 545
380 iso_pu_bacteria 2838675328 2838676876 545
381 iso_pu_bacteria 2838714209 2838715761 545
382 iso_pu_bacteria 2838719591 2838720438 545
383 iso_pu_bacteria 2838724970 2838726516 545
384 iso_pu_bacteria 2841846520 2841847369 545
385 iso_pu_bacteria 2841859092 2841860094 545
386 iso_pu_bacteria 2842124991 2842126601 545
387 iso_pu_bacteria 2842130223 2842131769 545
388 iso_pu_bacteria 2842152218 2842153062 545
389 iso_pu_bacteria 2842170452 2842172005 545
390 iso_pu_bacteria 2842175837 2842176681 545
391 iso_pu_bacteria 2842187318 2842188870 545
392 iso_pu_bacteria 2842211629 2842213182 545
393 iso_pu_bacteria 2842224351 2842225200 545
394 iso_pu_bacteria 2842515876 2842516879 545
395 iso_pu_bacteria 2844163670 2844164702 545
396 iso_pu_bacteria 2847417321 2847419476 545
397 iso_pu_bacteria 2848992105 2848994505 545
398 iso_pu_bacteria 2850079185 2850081567 545
399 iso_pu_bacteria 2855825444 2855826443 545
400 iso_pu_bacteria 2855839649 2855841834 545
401 iso_pu_bacteria 2855872281 2855872448 545
402 iso_pu_bacteria 2858800743 2858804473 545
403 iso_pu_bacteria 2896384573 2896392294 545
404 iso_pu_bacteria 2899792073 2899792160 545
405 iso_pu_bacteria 2913295892 2913299233 545
406 iso_pu_bacteria 2915980308 2915983050 545
407 iso_pu_bacteria 2915986958 2915992134 545
408 iso_pu_bacteria 2915993759 2915997866 545
409 iso_pu_bacteria 2916000859 2916006215 545
410 iso_pu_bacteria 2916007675 2916013704 545
411 iso_pu_bacteria 2916014648 2916018431 545
412 iso_pu_bacteria 2916021584 2916023384 545
413 iso_pu_bacteria 2916028427 2916033868 545
414 iso_pu_bacteria 2916035215 2916039145 545
415 iso_pu_bacteria 2916041962 2916047332 545
416 iso_pu_bacteria 2916048683 2916053233 545
417 iso_pu_bacteria 2916055098 2916060267 545
418 iso_pu_bacteria 2916061851 2916064371 545
419 iso_pu_bacteria 2916076590 2916082894 545
420 iso_pu_bacteria 2919114240 2919115964 545
421 iso_pu_bacteria 2919166419 2919167221 545
422 iso_pu_bacteria 2920760137 2920761426 545
423 iso_pu_bacteria 2921201388 2921208221 545
424 iso_pu_bacteria 2921208531 2921213075 545
425 iso_pu_bacteria 2921237296 2921241674 545
426 iso_pu_bacteria 2921244191 2921246113 545
427 iso_pu_bacteria 2921250672 2921253897 545
428 iso_pu_bacteria 2921257292 2921262585 545
429 iso_pu_bacteria 2921263974 2921269382 545
430 iso_pu_bacteria 2921282425 2921288898 545
431 iso_pu_bacteria 2921296804 2921300105 545
432 iso_pu_bacteria 2924144063 2924147238 545
433 iso_pu_bacteria 2924150972 2924157426 545
434 iso_pu_bacteria 2924158325 2924161099 545
435 iso_pu_bacteria 2924165586 2924171876 545
436 iso_pu_bacteria 2924172951 2924178507 545
437 iso_pu_bacteria 2924179722 2924185235 545
438 iso_pu_bacteria 2924186466 2924192567 545
439 iso_pu_bacteria 2924193448 2924196128 545
440 iso_pu_bacteria 2924200457 2924207004 545
441 iso_pu_bacteria 2924207177 2924207963 545
442 iso_pu_bacteria 2924214083 2924221534 545
443 iso_pu_bacteria 2924221636 2924221952 545
444 iso_pu_bacteria 2924228884 2924231619 545
445 iso_pu_bacteria 2926754445 2926756917 545
446 iso_pu_bacteria 2926760298 2926761141 545
447 iso_pu_bacteria 2933006813 2933007705 545
448 iso_pu_bacteria 2933011516 2933012479 545
449 iso_pu_bacteria 2936996657 2936998325 545
450 iso_pu_bacteria 2937002841 2937005621 545
451 iso_pu_bacteria 2937009748 2937011824 545
452 iso_pu_bacteria 2937016420 2937021961 545
453 iso_pu_bacteria 2937023124 2937027799 545
454 iso_pu_bacteria 2937029754 2937031034 545
455 iso_pu_bacteria 2937036028 2937037096 545
456 iso_pu_bacteria 2937042894 2937044342 545
457 iso_pu_bacteria 2937049772 2937053730 545
458 iso_pu_bacteria 2937056579 2937057853 545
459 iso_pu_bacteria 2937063883 2937069988 545
460 iso_pu_bacteria 2937071275 2937076026 545
461 iso_pu_bacteria 2937078374 2937081646 545
462 iso_pu_bacteria 2937084907 2937085322 545
463 iso_pu_bacteria 2937091812 2937094498 545
464 iso_pu_bacteria 2937098957 2937101954 545
465 iso_pu_bacteria 2937106411 2937112033 545
466 iso_pu_bacteria 2937113482 2937118094 545
467 iso_pu_bacteria 2937119839 2937122632 545
468 iso_pu_bacteria 2937126314 2937129712 545
469 iso_pu_bacteria 2941499720 2941502009 545
470 iso_pu_bacteria 2957375807 2957378447 545
471 iso_pu_bacteria 2957382221 2957388443 545
472 iso_pu_bacteria 2957388812 2957393139 545
473 iso_pu_bacteria 2957395598 2957400857 545
474 iso_pu_bacteria 2957402308 2957408478 545
475 iso_pu_bacteria 2957408893 2957414519 545
476 iso_pu_bacteria 2957415311 2957415765 545
477 iso_pu_bacteria 2957422303 2957428872 545
478 iso_pu_bacteria 2957430029 2957432439 545
479 iso_pu_bacteria 2957437181 2957438121 545
480 iso_pu_bacteria 2957443900 2957449744 545
481 iso_pu_bacteria 2957450854 2957454396 545
482 iso_pu_bacteria 2957457609 2957462509 545
483 iso_pu_bacteria 2957464669 2957468943 545
484 iso_pu_bacteria 2957471148 2957475994 545
485 iso_pu_bacteria 2957478035 2957483111 545
486 iso_pu_bacteria 2957484790 2957488933 545
487 iso_pu_bacteria 2957491536 2957497739 545
488 iso_pu_bacteria 2957498199 2957504082 545
489 iso_pu_bacteria 2957505466 2957512362 545
490 iso_pu_bacteria 2960584000 2960585239 545
491 iso_pu_bacteria 2960591022 2960594173 545
492 iso_pu_bacteria 2960597568 2960603712 545
493 iso_pu_bacteria 2960603979 2960607424 545
494 iso_pu_bacteria 2960610863 2960615223 545
495 iso_pu_bacteria 2960617483 2960620318 545
496 iso_pu_bacteria 2960624210 2960624571 545
497 iso_pu_bacteria 2960631154 2960633703 545
498 iso_pu_bacteria 2960637947 2960644389 545
499 iso_pu_bacteria 2960645483 2960652041 545
500 iso_pu_bacteria 2960652885 2960659610 545
501 iso_pu_bacteria 2960660292 2960666277 545
502 iso_pu_bacteria 2960667422 2960671070 545
503 iso_pu_bacteria 2960674078 2960678438 545
504 iso_pu_bacteria 2960680706 2960680963 545
505 iso_pu_bacteria 2960687367 2960693073 545
506 iso_pu_bacteria 2960693952 2960700100 545
507 iso_pu_bacteria 2964607997 2964609450 545
508 iso_pu_bacteria 2964615318 2964621838 545
509 iso_pu_bacteria 2964621998 2964626020 545
510 iso_pu_bacteria 2964636051 2964642739 545
511 iso_pu_bacteria 2964643177 2964643892 545
512 iso_pu_bacteria 2964649959 2964652554 545
513 iso_pu_bacteria 2964656573 2964661063 545
514 iso_pu_bacteria 2964663802 2964665335 545
515 iso_pu_bacteria 2964670856 2964673274 545
516 iso_pu_bacteria 2964678106 2964678527 545
517 iso_pu_bacteria 2964685014 2964687187 545
518 iso_pu_bacteria 2964691889 2964694300 545
519 iso_pu_bacteria 2964698721 2964699437 545
520 iso_pu_bacteria 2964705432 2964707721 545
521 iso_pu_bacteria 2964712639 2964713804 545
522 iso_pu_bacteria 2964719344 2964723862 545
523 iso_pu_bacteria 2967664464 2967669071 545
524 iso_pu_bacteria 2967671571 2967674892 545
525 iso_pu_bacteria 2967678726 2967682026 545
526 iso_pu_bacteria 2967686174 2967692946 545
527 iso_pu_bacteria 2967693043 2967695704 545
528 iso_pu_bacteria 2967699805 2967704876 545
529 iso_pu_bacteria 2967706974 2967714151 545
530 iso_pu_bacteria 2967714385 2967716904 545
531 iso_pu_bacteria 2967721400 2967725547 545
532 iso_pu_bacteria 2967728569 2967730107 545
533 iso_pu_bacteria 2967735183 2967735880 545
534 iso_pu_bacteria 2967742019 2967747930 545
535 iso_pu_bacteria 2967748971 2967752288 545
536 iso_pu_bacteria 2967755722 2967760721 545
537 iso_pu_bacteria 2967762386 2967767961 545
538 iso_pu_bacteria 2967769361 2967775052 545
539 iso_pu_bacteria 2967775926 2967778673 545
540 iso_pu_bacteria 2970019648 2970024154 545
541 iso_pu_bacteria 2970026789 2970031750 545
542 iso_pu_bacteria 2970033650 2970039870 545
543 iso_pu_bacteria 2970040964 2970046320 545
544 iso_pu_bacteria 2970047711 2970053096 545
545 iso_pu_bacteria 2970054988 2970060283 545
546 iso_pu_bacteria 2970061556 2970063219 545
547 iso_pu_bacteria 2970068827 2970070751 545
548 iso_pu_bacteria 2970076120 2970078711 545
549 iso_pu_bacteria 2970082768 2970086805 545
550 iso_pu_bacteria 2970088815 2970091035 545
551 iso_pu_bacteria 2970095765 2970098894 545
552 iso_pu_bacteria 2970102677 2970107260 545
553 iso_pu_bacteria 2970109326 2970115476 545
554 iso_pu_bacteria 2970116247 2970119323 545
555 iso_pu_bacteria 2970122695 2970124837 545
556 iso_pu_bacteria 2970129317 2970132169 545
557 iso_pu_bacteria 2970136068 2970137079 545
558 iso_pu_bacteria 2970143518 2970145203 545
559 iso_pu_bacteria 2970149975 2970152281 545
560 iso_pu_bacteria 2970156795 2970164114 545
561 iso_pu_bacteria 2970164137 2970164533 545
562 iso_pu_bacteria 2970170962 2970172734 545
563 iso_pu_bacteria 2970177841 2970184161 545
564 iso_pu_bacteria 2970184632 2970188909 545
565 iso_pu_bacteria 2970191845 2970198010 545
566 iso_pu_bacteria 2977516862 2977522839 545
567 iso_pu_bacteria 2977523885 2977524864 545
568 iso_pu_bacteria 2977530762 2977531525 545
569 iso_pu_bacteria 2977537788 2977540742 545
570 iso_pu_bacteria 2977544691 2977551211 545
571 iso_pu_bacteria 2977551784 2977555763 545
572 iso_pu_bacteria 2977558990 2977560328 545
573 iso_pu_bacteria 2977565890 2977566574 545
574 iso_pu_bacteria 2977572785 2977575646 545
575 iso_pu_bacteria 2977579622 2977582300 545
576 iso_pu_bacteria 2978969890 2978973647 545
577 iso_pu_bacteria 2984587000 2984591921 545
578 iso_pu_bacteria 643692032 643826381 545
579 iso_pu_bacteria 648276728 648738070 545
580 iso_pu_bacteria 8003992118 8003994267 545
581 iso_pu_bacteria 8003999396 8004001915 545
582 iso_pu_bacteria 8049293176 8049295397 545
583 iso_pu_bacteria 8054460903 8054461739 545
584 3300053161 Ga0500634_0016218 Ga0500634_0016218_1300_2955 546
585 iso_pu_bacteria 2554235003 2554246971 546
586 iso_pu_bacteria 2558860242 2559294197 546
587 iso_pu_bacteria 2582581299 2585229916 546
588 iso_pu_bacteria 2582581316 2585334849 546
589 iso_pu_bacteria 2615840698 2616552846 546
590 iso_pu_bacteria 2643221582 2643918568 546
591 iso_pu_bacteria 2643221634 2644192698 546
592 iso_pu_bacteria 2643221693 2644518887 546
593 iso_pu_bacteria 2775507266 2778174473 546
594 iso_pu_bacteria 2808606387 2808986027 546
595 iso_pu_bacteria 2818991439 2819556148 546
596 iso_pu_bacteria 2842482326 2842485354 546
597 iso_pu_bacteria 2854911287 2854916526 546
598 iso_pu_bacteria 2899845264 2899846263 546
599 iso_pu_bacteria 2979089926 2979093575 546
600 iso_pu_bacteria 2979095461 2979099037 546
601 iso_pu_bacteria 2979100975 2979105555 546
602 iso_pu_bacteria 2984509177 2984512597 546
603 iso_pu_bacteria 2984518228 2984521043 546
604 iso_pu_bacteria 2984537506 2984540337 546
605 iso_pu_bacteria 2984601300 2984602533 546
606 3300005548 Ga0070665_100015391 Ga0070665_1000153917 547
607 3300006178 Ga0075367_10029046 Ga0075367_100290462 547
608 3300006186 Ga0075369_10007129 Ga0075369_100071294 547
609 3300006195 Ga0075366_10013926 Ga0075366_100139263 547
610 3300006948 Ga0099826_10000030 Ga0099826_10000030118 547
611 3300006948 Ga0099826_10018729 Ga0099826_100187294 547
612 3300013100 Ga0157373_10014167 Ga0157373_100141674 547
613 3300013102 Ga0157371_10000307 Ga0157371_1000030716 547
614 3300025294 Ga0209025_1000074 Ga0209025_1000074106 547
615 3300025294 Ga0209025_1000080 Ga0209025_1000080187 547
616 3300027312 Ga0209371_1000009 Ga0209371_100000976 547
617 3300027666 Ga0209282_1000222 Ga0209282_10002229 547
618 3300027666 Ga0209282_1016609 Ga0209282_10166093 547
619 3300028379 Ga0268266_10022020 Ga0268266_100220206 547
620 3300030500 Ga0268256_1000010 Ga0268256_100001076 547
621 3300030744 Ga0316181_1090707 Ga0316181_10907072 547
622 3300047470 Ga0495681_0004400 Ga0495681_0004400_5186_6850 547
623 3300048919 Ga0496116_0020883 Ga0496116_0020883_3132_4829 547
624 3300048920 Ga0496117_0000002 Ga0496117_0000002_1630872_1632569 547
625 3300048921 Ga0496118_0000084 Ga0496118_0000084_70633_72330 547
626 3300048921 Ga0496118_0040021 Ga0496118_0040021_64_1728 547
627 3300048923 Ga0496120_0000087 Ga0496120_0000087_102037_103734 547
628 3300048925 Ga0496122_0000001 Ga0496122_0000001_1001661_1003358 547
629 3300048926 Ga0496123_0000001 Ga0496123_0000001_1005392_1007089 547
630 3300048927 Ga0496124_0001512 Ga0496124_0001512_3972_5636 547
631 3300048927 Ga0496124_0001806 Ga0496124_0001806_2369_4066 547
632 3300048928 Ga0496125_0004867 Ga0496125_0004867_7272_8936 547
633 3300050491 nmdc:mga00v17_52_c1 nmdc:mga00v17_52_c1_55359_57056 547
634 3300050494 nmdc:mga06z11_19283_c1 nmdc:mga06z11_19283_c1_811_2475 547
635 3300053107 Ga0500560_004145 Ga0500560_004145_1067_2731 547
636 3300053107 Ga0500560_004674 Ga0500560_004674_444_2141 547
637 3300053137 Ga0500561_0000638 Ga0500561_0000638_598_2295 547
638 3300053157 Ga0500624_000717 Ga0500624_000717_5289_6986 547
639 iso_pu_bacteria 2510461069 2510842204 547
640 iso_pu_bacteria 2599185210 2599603469 547
641 iso_pu_bacteria 2600255279 2601608820 547
642 iso_pu_bacteria 2600255308 2601745594 547
643 iso_pu_bacteria 2643221588 2643949983 547
644 iso_pu_bacteria 2929138655 2929139309 547
645 iso_pu_bacteria 2933594066 2933594919 547
646 iso_pu_bacteria 2964628898 2964631262 547
647 iso_pu_bacteria 3005445848 3005448070 547
648 iso_pu_bacteria 8003570095 8003570429 547
649 3300002773 JGI25152J39213_1000727 JGI25152J39213_100072715 548
650 3300002774 JGI25150J39212_1000160 JGI25150J39212_10001608 548
651 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008399 548
652 3300003215 JGI25153J46596_10000377 JGI25153J46596_100003778 548
653 3300006051 Ga0075364_10000091 Ga0075364_100000919 548
654 3300013102 Ga0157371_10006146 Ga0157371_1000614611 548
655 3300025245 Ga0207425_1000024 Ga0207425_1000024151 548
656 3300025258 Ga0209129_1000184 Ga0209129_100018439 548
657 3300025273 Ga0209673_1014342 Ga0209673_10143423 548
658 3300025294 Ga0209025_1000050 Ga0209025_1000050176 548
659 3300025297 Ga0209758_1000083 Ga0209758_100008381 548
660 3300048919 Ga0496116_0000036 Ga0496116_0000036_125052_126713 548
661 3300048919 Ga0496116_0001253 Ga0496116_0001253_26561_28219 548
662 3300048919 Ga0496116_0003264 Ga0496116_0003264_3728_5386 548
663 3300048919 Ga0496116_0005563 Ga0496116_0005563_3427_5085 548
664 3300048919 Ga0496116_0023111 Ga0496116_0023111_1561_3222 548
665 3300048920 Ga0496117_0003834 Ga0496117_0003834_2667_4325 548
666 3300048920 Ga0496117_0004894 Ga0496117_0004894_2025_3683 548
667 3300048920 Ga0496117_0013953 Ga0496117_0013953_232_1893 548
668 3300048921 Ga0496118_0037537 Ga0496118_0037537_93_1754 548
669 3300048923 Ga0496120_0007817 Ga0496120_0007817_5122_6783 548
670 3300048924 Ga0496121_0000001 Ga0496121_0000001_767078_768739 548
671 3300048924 Ga0496121_0041758 Ga0496121_0041758_1266_2924 548
672 3300048925 Ga0496122_0013093 Ga0496122_0013093_3829_5487 548
673 3300048925 Ga0496122_0039895 Ga0496122_0039895_823_2484 548
674 3300048925 Ga0496122_0043762 Ga0496122_0043762_1233_2891 548
675 3300048926 Ga0496123_0002482 Ga0496123_0002482_17859_19517 548
676 3300048926 Ga0496123_0005090 Ga0496123_0005090_10741_12399 548
677 3300048926 Ga0496123_0031021 Ga0496123_0031021_509_2170 548
678 3300048927 Ga0496124_0002257 Ga0496124_0002257_21177_22835 548
679 3300048927 Ga0496124_0017462 Ga0496124_0017462_4945_6603 548
680 3300048927 Ga0496124_0064483 Ga0496124_0064483_1242_2900 548
681 3300048928 Ga0496125_0000001 Ga0496125_0000001_881047_882708 548
682 3300048928 Ga0496125_0001877 Ga0496125_0001877_13789_15447 548
683 3300048929 Ga0496126_0001111 Ga0496126_0001111_21244_22905 548
684 3300048929 Ga0496126_0033390 Ga0496126_0033390_698_2356 548
685 3300048929 Ga0496126_0069562 Ga0496126_0069562_679_2340 548
686 iso_pu_bacteria 2617270741 2617372559 548
687 iso_pu_bacteria 2643221621 2644121627 548
688 iso_pu_bacteria 8003014200 8003015809 548
689 3300002737 JGI25162J39368_1000617 JGI25162J39368_100061716 550
690 3300003214 JGI25165J46597_1000416 JGI25165J46597_10004163 550
691 3300009011 Ga0105251_10014590 Ga0105251_100145904 550
692 3300009553 Ga0105249_10129164 Ga0105249_101291642 550
693 3300025233 Ga0209437_100104 Ga0209437_100104132 550
694 3300025261 Ga0209233_1000054 Ga0209233_10000543 550
695 3300025294 Ga0209025_1010207 Ga0209025_10102072 550
696 3300025299 Ga0209256_1005042 Ga0209256_10050425 550
697 3300025302 Ga0207426_1002621 Ga0207426_10026214 550
698 3300026067 Ga0207678_10056422 Ga0207678_100564222 550
699 3300046492 Ga0495585_0038650 Ga0495585_0038650_724_2385 550
700 3300046506 Ga0495583_0003907 Ga0495583_0003907_3181_4842 550
701 3300048908 Ga0496105_0008863 Ga0496105_0008863_1077_2738 550
702 3300048909 Ga0496106_0098734 Ga0496106_0098734_223_1884 550
703 3300048913 Ga0496110_0046246 Ga0496110_0046246_1071_2732 550
704 3300048919 Ga0496116_0016958 Ga0496116_0016958_1077_2738 550
705 3300048925 Ga0496122_0015896 Ga0496122_0015896_1906_3567 550

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15420

Abhydrolase_9_N

Alpha/beta-hydrolase family N-terminus

100

307

1

PF10081

Abhydrolase_9

Alpha/beta-hydrolase family

324

611

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v41-assembly2.cif.gz_B crystal structure of mtb pks13 thioesterase domain in complex with inhibitor tam5 0.6523 282 393
7crn-assembly2.cif.gz_B-2 the functional characterization and crystal structure of the bifunctional thioesterase catalyzing epimerization and cyclization 0.6224 284 393
7r0x-assembly1.cif.gz_A structure of the branching thioesterase from oocydin biosynthesis 0.6113 281 397
3ed1-assembly8.cif.gz_A crystal structure of rice gid1 complexed with ga3 0.5929 281 397
2cb9-assembly1.cif.gz_A crystal structure of the thioesterase domain of the fengycin biosynthesis cluster 0.5919 282 393
ID Description Score Start End Superfamily
af_O53417_287_574_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.933 252 537 3.40.50.1820
af_O53417_287_574_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9236 252 537 3.40.50.1820
af_O53417_63_270_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8154 29 234 1.10.287.1490
af_O53417_63_270_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8048 29 234 1.10.287.1490
af_Q4D3Y4_276_531_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7166 333 397 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Z1BKW4-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9868 215 527
AF-W7Q1M1-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9825 284 545
AF-A0A520ZUR0-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9801 253 542
AF-A0A2G1CCI0-F1-model_v4 deleted 0.9778 231 544
AF-A0A4Z1BKW4-F1-model_v4 Alpha/beta-hydrolase catalytic domain-containing protein 0.9775 215 527

Feature Viewer

pLDDT pTM Quality
87.58 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map