F475983

General Info

Members Datasets Scaffolds Average Seq Length
698 289 687 470

Family's Representative Sequence

Representative Sequence 3300049521|Ga0501298_000451|Ga0501298_000451_3512_5158
Length 548
Sequence LELKTLAIVKGQLQTKKYFYSVRRNKSIVLEKVLVEDYAAEGKSLARWEGKVIFIENVVPGDIVDIRLRKNKKDWAEGYPIQFHSYSKQRVQPFCQHFGVCGGCQWQMLPYNLQLVYKQQQVYDNLKRIGKIPLPQFLPIAGAHETKFYRNKLEYTFSTKEYTPEKPNSTTHYNLPIEPIQTQKQVPTQFSPITEVTTRQNQFKQETFNNNNEAGISAPFIAGQTRSPQGDLREAVLGFHAKGFFDKVVNIQKCWLQHEPTNELRNSLRDFAKKNEISFYDIRAHKGLLRNMQVRVCTTGEIMVNVIFGEDKKKEITKILEFIAQQFPQITTLLYTINLKMNDSLQDQQPIVYKGKGHIIEKLENFEFKIGPKSFFQTNTRQAEKLYQITRDFAELNGSQVVYDLYCGTGSIGIFCSKRAKKIIGVEAIEEAVSDAKENAVLNKIDHAQFFKGDVVEICNDVFFAEHGQPDVLITDPPRAGMHEKLVKKILEIEAPLVVYVSCNPATQARDLNLLDEKYMVTKVQPVDMFPHTHHIENVVQLKLKRKD

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
4 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
5 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
6 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
9 2914759650 Rhizosphaericola mali Isolate Rhizosphere
10 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
238 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
254 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
255 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
256 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
257 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
258 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
259 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
260 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
261 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
262 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
265 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
269 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
282 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 0.29
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010521 3300002987 Bacteria 2348
2 JGI25406J46586_10000886 3300003203 Bacteria 14114
3 rootH1_10076736 3300003316 Unclassified 2059
4 rootH2_10006463 3300003320 Bacteria 45674
5 rootH2_10012033 3300003320 Bacteria 19273
6 rootH2_10026278 3300003320 Bacteria 14769
7 rootH2_10203242 3300003320 Bacteria 4509
8 rootH1_10004992 3300003323 Bacteria 2005
9 rootH1_10007795 3300003323 Bacteria 36145
10 rootH1_10020501 3300003323 Bacteria 26877
11 rootH1_10116615 3300003323 Bacteria 10973
12 rootH1_10211012 3300003323 Bacteria 7229
13 JGI25160J50197_1017419 3300003354 Bacteria 2276
14 Ga0055531_10000401 3300003794 Bacteria 41633
15 Ga0065704_10072259 3300005289 Bacteria 8833
16 Ga0065704_10130134 3300005289 Bacteria 1640
17 Ga0065712_10005130 3300005290 Bacteria 3778
18 Ga0070658_10008208 3300005327 Bacteria 8395
19 Ga0070658_10019578 3300005327 Bacteria 5419
20 Ga0070658_10185855 3300005327 Bacteria 1750
21 Ga0070676_10000167 3300005328 Bacteria 26643
22 Ga0070676_10017619 3300005328 Bacteria 3952
23 Ga0070683_100002896 3300005329 Bacteria 13742
24 Ga0070683_100008183 3300005329 Bacteria 8884
25 Ga0070683_100050048 3300005329 Unclassified 3866
26 Ga0070683_100210155 3300005329 Bacteria 1849
27 Ga0070690_100045473 3300005330 Bacteria 2788
28 Ga0070670_100018086 3300005331 Bacteria 6050
29 Ga0070670_100085435 3300005331 Unclassified 2711
30 Ga0070670_100119985 3300005331 Bacteria 2268
31 Ga0068869_100040043 3300005334 Bacteria 3349
32 Ga0068869_100061094 3300005334 Bacteria 2763
33 Ga0068869_100067524 3300005334 Bacteria 2638
34 Ga0068869_100130571 3300005334 Bacteria 1931
35 Ga0070666_10000064 3300005335 Bacteria 79823
36 Ga0070666_10000512 3300005335 Bacteria 23407
37 Ga0070666_10037855 3300005335 Bacteria 3209
38 Ga0070666_10118142 3300005335 Bacteria 1837
39 Ga0070680_100004861 3300005336 Bacteria 10113
40 Ga0070680_100062841 3300005336 Bacteria 3041
41 Ga0070682_100000012 3300005337 Bacteria 265658
42 Ga0070682_100020387 3300005337 Bacteria 3899
43 Ga0068868_100004051 3300005338 Bacteria 10214
44 Ga0068868_100032460 3300005338 Bacteria 4017
45 Ga0068868_100160173 3300005338 Bacteria 1858
46 Ga0070660_100013009 3300005339 Bacteria 5955
47 Ga0070689_100011333 3300005340 Bacteria 6382
48 Ga0070691_10004449 3300005341 Bacteria 6366
49 Ga0070687_100005317 3300005343 Bacteria 5204
50 Ga0070687_100020594 3300005343 Bacteria 3086
51 Ga0070661_100005273 3300005344 Bacteria 8906
52 Ga0070661_100022229 3300005344 Bacteria 4540
53 Ga0070661_100124342 3300005344 Bacteria 1934
54 Ga0070668_100012112 3300005347 Bacteria 6423
55 Ga0070669_100001547 3300005353 Bacteria 16634
56 Ga0070669_100059023 3300005353 Bacteria 2817
57 Ga0070675_100002115 3300005354 Bacteria 14665
58 Ga0070675_100011337 3300005354 Bacteria 6977
59 Ga0070675_100035094 3300005354 Bacteria 4074
60 Ga0070675_100145471 3300005354 Bacteria 2029
61 Ga0070671_100003764 3300005355 Bacteria 11909
62 Ga0070671_100033340 3300005355 Unclassified 4258
63 Ga0070671_100036570 3300005355 Unclassified 4072
64 Ga0070671_100095081 3300005355 Bacteria 2498
65 Ga0070671_100176340 3300005355 Bacteria 1809
66 Ga0070674_100014555 3300005356 Bacteria 4893
67 Ga0070673_100003256 3300005364 Bacteria 10073
68 Ga0070673_100014566 3300005364 Bacteria 5483
69 Ga0070673_100017552 3300005364 Bacteria 5094
70 Ga0070673_100027220 3300005364 Bacteria 4236
71 Ga0070673_100045099 3300005364 Bacteria 3417
72 Ga0070673_100064542 3300005364 Bacteria 2918
73 Ga0070673_100089652 3300005364 Bacteria 2511
74 Ga0070688_100008797 3300005365 Bacteria 5495
75 Ga0070688_100013517 3300005365 Bacteria 4606
76 Ga0070659_100002166 3300005366 Bacteria 13998
77 Ga0070659_100007353 3300005366 Bacteria 8002
78 Ga0070659_100015031 3300005366 Bacteria 5791
79 Ga0070667_100023384 3300005367 Bacteria 5126
80 Ga0070667_100028206 3300005367 Bacteria 4673
81 Ga0070667_100029961 3300005367 Bacteria 4538
82 Ga0070667_100046048 3300005367 Bacteria 3668
83 Ga0070667_100114295 3300005367 Bacteria 2343
84 Ga0070667_100140172 3300005367 Bacteria 2117
85 Ga0070667_100213037 3300005367 Bacteria 1718
86 Ga0070714_100000081 3300005435 Bacteria 82594
87 Ga0070663_100065626 3300005455 Bacteria 2628
88 Ga0070663_100077147 3300005455 Bacteria 2438
89 Ga0070678_100008332 3300005456 Bacteria 6207
90 Ga0070662_100003263 3300005457 Bacteria 10092
91 Ga0070662_100006273 3300005457 Bacteria 7660
92 Ga0070662_100034440 3300005457 Bacteria 3571
93 Ga0070662_100067894 3300005457 Bacteria 2619
94 Ga0070662_100140022 3300005457 Bacteria 1874
95 Ga0070681_10011816 3300005458 Bacteria 8656
96 Ga0068867_100000714 3300005459 Bacteria 22153
97 Ga0068867_100037807 3300005459 Bacteria 3511
98 Ga0068867_100042475 3300005459 Bacteria 3326
99 Ga0068867_100121304 3300005459 Bacteria 2021
100 Ga0070685_10052342 3300005466 Bacteria 2362
101 Ga0070707_100263899 3300005468 Unclassified 1675
102 Ga0070698_100004403 3300005471 Bacteria 15475
103 Ga0070698_100077619 3300005471 Unclassified 3320
104 Ga0070679_100042529 3300005530 Bacteria 4525
105 Ga0070679_100187122 3300005530 Bacteria 2040
106 Ga0070684_100000042 3300005535 Bacteria 89896
107 Ga0070684_100009042 3300005535 Bacteria 7830
108 Ga0070684_100015194 3300005535 Bacteria 6261
109 Ga0068853_100004615 3300005539 Bacteria 10690
110 Ga0068853_100017476 3300005539 Bacteria 5918
111 Ga0068853_100025049 3300005539 Bacteria 5006
112 Ga0070672_100010987 3300005543 Bacteria 6300
113 Ga0070672_100100565 3300005543 Bacteria 2345
114 Ga0070672_100145047 3300005543 Bacteria 1961
115 Ga0070686_100035991 3300005544 Bacteria 3061
116 Ga0068855_100002019 3300005563 Bacteria 25173
117 Ga0068855_100002248 3300005563 Bacteria 23863
118 Ga0068855_100004845 3300005563 Bacteria 16427
119 Ga0068855_100007429 3300005563 Bacteria 13268
120 Ga0068855_100015455 3300005563 Bacteria 9189
121 Ga0070664_100000341 3300005564 Bacteria 34094
122 Ga0070664_100002301 3300005564 Bacteria 15347
123 Ga0070664_100054863 3300005564 Bacteria 3383
124 Ga0070664_100063257 3300005564 Unclassified 3155
125 Ga0070664_100203742 3300005564 Bacteria 1766
126 Ga0070664_100257117 3300005564 Bacteria 1571
127 Ga0068857_100000652 3300005577 Bacteria 25600
128 Ga0068857_100002017 3300005577 Bacteria 16457
129 Ga0068857_100011464 3300005577 Bacteria 7716
130 Ga0068857_100032358 3300005577 Bacteria 4624
131 Ga0068854_100041746 3300005578 Bacteria 3243
132 Ga0068854_100155596 3300005578 Unclassified 1766
133 Ga0068856_100069438 3300005614 Unclassified 3484
134 Ga0068852_100000391 3300005616 Bacteria 29415
135 Ga0068852_100000706 3300005616 Bacteria 21835
136 Ga0068852_100025764 3300005616 Bacteria 4770
137 Ga0068852_100069937 3300005616 Bacteria 3078
138 Ga0068852_100085278 3300005616 Bacteria 2813
139 Ga0068859_100000003 3300005617 Bacteria 479218
140 Ga0068859_100010235 3300005617 Bacteria 9439
141 Ga0068859_100026078 3300005617 Bacteria 5863
142 Ga0068859_100033423 3300005617 Bacteria 5164
143 Ga0068859_100172480 3300005617 Bacteria 2244
144 Ga0068859_100204940 3300005617 Bacteria 2057
145 Ga0068859_100228100 3300005617 Bacteria 1950
146 Ga0068859_100299453 3300005617 Bacteria 1701
147 Ga0068864_100003504 3300005618 Bacteria 12970
148 Ga0068864_100004147 3300005618 Bacteria 11896
149 Ga0068861_100117666 3300005719 Bacteria 2139
150 Ga0068851_10002509 3300005834 Bacteria 8069
151 Ga0068870_10007082 3300005840 Bacteria 4983
152 Ga0068863_100003550 3300005841 Bacteria 15382
153 Ga0068863_100045682 3300005841 Bacteria 4157
154 Ga0068863_100114740 3300005841 Bacteria 2566
155 Ga0068858_100027838 3300005842 Bacteria 5251
156 Ga0068858_100032949 3300005842 Bacteria 4811
157 Ga0068858_100035990 3300005842 Bacteria 4590
158 Ga0068858_100056199 3300005842 Bacteria 3638
159 Ga0068858_100088996 3300005842 Bacteria 2873
160 Ga0068860_100000003 3300005843 Bacteria 575741
161 Ga0068860_100023659 3300005843 Bacteria 5937
162 Ga0068860_100069929 3300005843 Bacteria 3337
163 Ga0068860_100113495 3300005843 Bacteria 2591
164 Ga0068862_100080167 3300005844 Bacteria 2831
165 Ga0081540_1020250 3300005983 Bacteria 4009
166 Ga0081539_10000284 3300005985 Bacteria 114545
167 Ga0070715_10046519 3300006163 Unclassified 1845
168 Ga0075366_10011536 3300006195 Bacteria 4989
169 Ga0097621_100003397 3300006237 Bacteria 10963
170 Ga0097621_100003853 3300006237 Bacteria 10388
171 Ga0097621_100006293 3300006237 Bacteria 8423
172 Ga0097621_100026494 3300006237 Bacteria 4548
173 Ga0097621_100058022 3300006237 Bacteria 3167
174 Ga0097621_100129324 3300006237 Bacteria 2148
175 Ga0097621_100151103 3300006237 Bacteria 1991
176 Ga0068871_100002146 3300006358 Bacteria 13383
177 Ga0068871_100016497 3300006358 Bacteria 5564
178 Ga0068871_100020339 3300006358 Bacteria 5084
179 Ga0068871_100029438 3300006358 Bacteria 4313
180 Ga0068871_100138060 3300006358 Bacteria 2071
181 Ga0075428_100014704 3300006844 Bacteria 8692
182 Ga0075428_100039130 3300006844 Bacteria 5219
183 Ga0075430_100086919 3300006846 Bacteria 2616
184 Ga0075431_100011173 3300006847 Bacteria 9040
185 Ga0075431_100011553 3300006847 Bacteria 8907
186 Ga0075429_100001064 3300006880 Bacteria 21975
187 Ga0075429_100014498 3300006880 Bacteria 6831
188 Ga0075429_100147448 3300006880 Unclassified 2060
189 Ga0068865_100008145 3300006881 Bacteria 6467
190 Ga0097620_100000003 3300006931 Bacteria 479218
191 Ga0097620_100010233 3300006931 Bacteria 9439
192 Ga0097620_100026077 3300006931 Bacteria 5863
193 Ga0097620_100033422 3300006931 Bacteria 5164
194 Ga0097620_100172496 3300006931 Bacteria 2244
195 Ga0097620_100204949 3300006931 Bacteria 2057
196 Ga0097620_100228106 3300006931 Bacteria 1950
197 Ga0097620_100299472 3300006931 Bacteria 1701
198 Ga0105240_10000131 3300009093 Bacteria 154386
199 Ga0105240_10000664 3300009093 Bacteria 63206
200 Ga0105240_10006894 3300009093 Bacteria 16604
201 Ga0105240_10012199 3300009093 Bacteria 11885
202 Ga0105240_10015806 3300009093 Bacteria 10241
203 Ga0105240_10024869 3300009093 Bacteria 7884
204 Ga0105240_10088628 3300009093 Bacteria 3786
205 Ga0105240_10090171 3300009093 Bacteria 3748
206 Ga0111539_10002241 3300009094 Bacteria 25812
207 Ga0111539_10014643 3300009094 Bacteria 9785
208 Ga0111539_10032512 3300009094 Bacteria 6334
209 Ga0111539_10201269 3300009094 Bacteria 2322
210 Ga0105245_10033821 3300009098 Bacteria 4531
211 Ga0105247_10004604 3300009101 Bacteria 8792
212 Ga0114129_10001630 3300009147 Bacteria 30480
213 Ga0114129_10011797 3300009147 Bacteria 12432
214 Ga0114129_10076888 3300009147 Bacteria 4645
215 Ga0105241_10000543 3300009174 Bacteria 28453
216 Ga0105241_10002666 3300009174 Bacteria 13368
217 Ga0105241_10154480 3300009174 Bacteria 1880
218 Ga0105242_10009360 3300009176 Bacteria 7519
219 Ga0105242_10021494 3300009176 Bacteria 5068
220 Ga0105242_10035315 3300009176 Bacteria 4009
221 Ga0105242_10062251 3300009176 Bacteria 3070
222 Ga0105248_10033429 3300009177 Bacteria 5745
223 Ga0105248_10112813 3300009177 Bacteria 3066
224 Ga0105237_10000144 3300009545 Bacteria 100105
225 Ga0105237_10006055 3300009545 Bacteria 13528
226 Ga0105237_10009698 3300009545 Bacteria 10300
227 Ga0105237_10014604 3300009545 Bacteria 8205
228 Ga0105237_10018668 3300009545 Bacteria 7170
229 Ga0105237_10057297 3300009545 Bacteria 3900
230 Ga0105237_10107217 3300009545 Bacteria 2785
231 Ga0105238_10001637 3300009551 Bacteria 22439
232 Ga0105238_10031735 3300009551 Bacteria 5376
233 Ga0105238_10149535 3300009551 Bacteria 2311
234 Ga0105238_10158299 3300009551 Bacteria 2240
235 Ga0105249_10011067 3300009553 Bacteria 7927
236 Ga0105249_10019335 3300009553 Bacteria 6075
237 Ga0105249_10063526 3300009553 Bacteria 3392
238 Ga0105249_10075831 3300009553 Bacteria 3115
239 Ga0105239_10000488 3300010375 Bacteria 57554
240 Ga0105239_10001713 3300010375 Bacteria 28869
241 Ga0105239_10001910 3300010375 Bacteria 27144
242 Ga0105239_10008508 3300010375 Bacteria 11666
243 Ga0105239_10029181 3300010375 Bacteria 6065
244 Ga0105239_10039875 3300010375 Bacteria 5145
245 Ga0105239_10197445 3300010375 Unclassified 2253
246 Ga0105239_10254145 3300010375 Bacteria 1974
247 Ga0105246_10009987 3300011119 Bacteria 5856
248 Ga0105246_10030859 3300011119 Bacteria 3543
249 Ga0157373_10009333 3300013100 Bacteria 7249
250 Ga0157371_10002424 3300013102 Bacteria 17819
251 Ga0157371_10004079 3300013102 Bacteria 12910
252 Ga0157371_10025139 3300013102 Bacteria 4344
253 Ga0157371_10034892 3300013102 Unclassified 3607
254 Ga0157371_10121467 3300013102 Bacteria 1858
255 Ga0157370_10001484 3300013104 Bacteria 29041
256 Ga0157370_10008150 3300013104 Bacteria 11332
257 Ga0157370_10011871 3300013104 Bacteria 9087
258 Ga0157370_10012794 3300013104 Bacteria 8675
259 Ga0157370_10013389 3300013104 Bacteria 8450
260 Ga0157370_10021834 3300013104 Bacteria 6376
261 Ga0157370_10031180 3300013104 Bacteria 5218
262 Ga0157369_10022017 3300013105 Bacteria 7123
263 Ga0157369_10205240 3300013105 Bacteria 2067
264 Ga0157374_10000013 3300013296 Bacteria 461240
265 Ga0157374_10002190 3300013296 Bacteria 16470
266 Ga0157374_10002453 3300013296 Bacteria 15652
267 Ga0157374_10013112 3300013296 Bacteria 7230
268 Ga0157374_10065603 3300013296 Bacteria 3410
269 Ga0157374_10073560 3300013296 Bacteria 3226
270 Ga0157374_10075274 3300013296 Bacteria 3190
271 Ga0157374_10092994 3300013296 Bacteria 2878
272 Ga0157374_10120640 3300013296 Bacteria 2530
273 Ga0157378_10019445 3300013297 Bacteria 5970
274 Ga0157378_10026281 3300013297 Bacteria 5132
275 Ga0157378_10033363 3300013297 Bacteria 4550
276 Ga0157378_10041733 3300013297 Bacteria 4070
277 Ga0163162_10000725 3300013306 Bacteria 30582
278 Ga0163162_10001913 3300013306 Bacteria 19626
279 Ga0163162_10003339 3300013306 Bacteria 15355
280 Ga0163162_10005264 3300013306 Bacteria 12478
281 Ga0163162_10025269 3300013306 Bacteria 5869
282 Ga0163162_10043198 3300013306 Bacteria 4513
283 Ga0163162_10107185 3300013306 Bacteria 2889
284 Ga0163162_10198327 3300013306 Bacteria 2136
285 Ga0163162_10345368 3300013306 Bacteria 1621
286 Ga0157372_10000747 3300013307 Bacteria 35352
287 Ga0157372_10002589 3300013307 Bacteria 19570
288 Ga0157372_10003494 3300013307 Bacteria 16941
289 Ga0157372_10007573 3300013307 Bacteria 11545
290 Ga0157372_10008586 3300013307 Bacteria 10856
291 Ga0157372_10009489 3300013307 Bacteria 10348
292 Ga0157372_10009879 3300013307 Bacteria 10150
293 Ga0157372_10013017 3300013307 Bacteria 8871
294 Ga0157372_10067344 3300013307 Bacteria 4023
295 Ga0157372_10074551 3300013307 Bacteria 3827
296 Ga0157375_10000422 3300013308 Bacteria 38347
297 Ga0157375_10004945 3300013308 Bacteria 11594
298 Ga0157375_10008894 3300013308 Bacteria 8789
299 Ga0157375_10021159 3300013308 Bacteria 5958
300 Ga0157375_10027810 3300013308 Bacteria 5291
301 Ga0157375_10041750 3300013308 Bacteria 4432
302 Ga0157375_10091529 3300013308 Bacteria 3103
303 Ga0157375_10127353 3300013308 Bacteria 2663
304 Ga0157375_10211978 3300013308 Bacteria 2095
305 Ga0163163_10000526 3300014325 Bacteria 34147
306 Ga0163163_10000732 3300014325 Bacteria 27929
307 Ga0163163_10000952 3300014325 Bacteria 24583
308 Ga0163163_10042459 3300014325 Bacteria 4454
309 Ga0163163_10069982 3300014325 Bacteria 3494
310 Ga0163163_10198533 3300014325 Bacteria 2054
311 Ga0163163_10371814 3300014325 Unclassified 1487
312 Ga0157380_10005550 3300014326 Bacteria 8820
313 Ga0157380_10010678 3300014326 Bacteria 6615
314 Ga0157380_10020326 3300014326 Unclassified 4962
315 Ga0157380_10039569 3300014326 Bacteria 3668
316 Ga0157377_10044856 3300014745 Bacteria 2467
317 Ga0157377_10115088 3300014745 Bacteria 1622
318 Ga0157379_10001164 3300014968 Bacteria 21405
319 Ga0157379_10002405 3300014968 Bacteria 15634
320 Ga0157379_10039691 3300014968 Bacteria 4200
321 Ga0157379_10160506 3300014968 Bacteria 2029
322 Ga0157379_10199267 3300014968 Bacteria 1810
323 Ga0157376_10000762 3300014969 Bacteria 21000
324 Ga0157376_10001116 3300014969 Bacteria 17609
325 Ga0157376_10005617 3300014969 Bacteria 8774
326 Ga0157376_10089660 3300014969 Bacteria 2659
327 Ga0182005_1000043 3300015265 Bacteria 140285
328 Ga0163161_10002456 3300017792 Bacteria 13233
329 Ga0163161_10003176 3300017792 Bacteria 11587
330 Ga0209436_101421 3300025208 Bacteria 8403
331 Ga0209646_1003765 3300025246 Bacteria 2907
332 Ga0209130_1005289 3300025284 Bacteria 4541
333 Ga0207426_1000033 3300025302 Bacteria 455976
334 Ga0207426_1000105 3300025302 Bacteria 247269
335 Ga0209257_1000023 3300025304 Bacteria 753019
336 Ga0207710_10001920 3300025900 Bacteria 9955
337 Ga0207688_10018807 3300025901 Bacteria 3758
338 Ga0207688_10077494 3300025901 Bacteria 1894
339 Ga0207688_10080064 3300025901 Bacteria 1864
340 Ga0207680_10000388 3300025903 Bacteria 21000
341 Ga0207647_10000131 3300025904 Bacteria 58960
342 Ga0207647_10008544 3300025904 Bacteria 7332
343 Ga0207647_10009015 3300025904 Bacteria 7109
344 Ga0207647_10009973 3300025904 Bacteria 6727
345 Ga0207647_10068340 3300025904 Bacteria 2151
346 Ga0207645_10001118 3300025907 Bacteria 22193
347 Ga0207645_10007440 3300025907 Bacteria 7733
348 Ga0207645_10019550 3300025907 Unclassified 4440
349 Ga0207643_10009005 3300025908 Bacteria 5359
350 Ga0207643_10014263 3300025908 Bacteria 4315
351 Ga0207705_10009232 3300025909 Bacteria 7178
352 Ga0207705_10053258 3300025909 Bacteria 2914
353 Ga0207705_10088123 3300025909 Bacteria 2270
354 Ga0207654_10001784 3300025911 Bacteria 11176
355 Ga0207654_10004542 3300025911 Bacteria 7013
356 Ga0207707_10004563 3300025912 Bacteria 12175
357 Ga0207695_10000217 3300025913 Bacteria 155047
358 Ga0207695_10001317 3300025913 Bacteria 42084
359 Ga0207695_10001383 3300025913 Bacteria 41051
360 Ga0207695_10002258 3300025913 Bacteria 28855
361 Ga0207695_10019233 3300025913 Bacteria 7865
362 Ga0207695_10020736 3300025913 Bacteria 7519
363 Ga0207695_10078895 3300025913 Bacteria 3339
364 Ga0207671_10001368 3300025914 Bacteria 28441
365 Ga0207671_10001848 3300025914 Bacteria 23634
366 Ga0207671_10006294 3300025914 Bacteria 10604
367 Ga0207671_10008066 3300025914 Bacteria 8997
368 Ga0207671_10011603 3300025914 Bacteria 7154
369 Ga0207671_10050115 3300025914 Bacteria 3091
370 Ga0207671_10095143 3300025914 Bacteria 2249
371 Ga0207662_10030116 3300025918 Bacteria 3148
372 Ga0207662_10042043 3300025918 Bacteria 2693
373 Ga0207657_10017781 3300025919 Bacteria 6806
374 Ga0207657_10038632 3300025919 Unclassified 4248
375 Ga0207649_10114705 3300025920 Bacteria 1806
376 Ga0207652_10000103 3300025921 Bacteria 91988
377 Ga0207652_10006111 3300025921 Bacteria 9740
378 Ga0207652_10029001 3300025921 Bacteria 4622
379 Ga0207652_10033600 3300025921 Bacteria 4320
380 Ga0207681_10002654 3300025923 Bacteria 11336
381 Ga0207681_10034199 3300025923 Bacteria 3340
382 Ga0207694_10013486 3300025924 Bacteria 6155
383 Ga0207694_10026748 3300025924 Unclassified 4392
384 Ga0207650_10000813 3300025925 Bacteria 23983
385 Ga0207650_10069465 3300025925 Unclassified 2647
386 Ga0207659_10044302 3300025926 Bacteria 3130
387 Ga0207687_10037320 3300025927 Bacteria 3314
388 Ga0207664_10000042 3300025929 Bacteria 154793
389 Ga0207644_10030426 3300025931 Bacteria 3755
390 Ga0207644_10039267 3300025931 Bacteria 3341
391 Ga0207690_10005004 3300025932 Bacteria 7828
392 Ga0207690_10073374 3300025932 Unclassified 2366
393 Ga0207706_10003190 3300025933 Bacteria 15740
394 Ga0207706_10054770 3300025933 Bacteria 3519
395 Ga0207706_10085304 3300025933 Bacteria 2776
396 Ga0207670_10021241 3300025936 Bacteria 4002
397 Ga0207670_10114727 3300025936 Bacteria 1947
398 Ga0207704_10011883 3300025938 Bacteria 4305
399 Ga0207704_10023419 3300025938 Bacteria 3328
400 Ga0207691_10000234 3300025940 Bacteria 54055
401 Ga0207691_10012577 3300025940 Bacteria 8112
402 Ga0207691_10020555 3300025940 Bacteria 6243
403 Ga0207691_10058684 3300025940 Bacteria 3500
404 Ga0207711_10133513 3300025941 Bacteria 2227
405 Ga0207689_10001731 3300025942 Bacteria 20624
406 Ga0207689_10002903 3300025942 Bacteria 15819
407 Ga0207689_10003837 3300025942 Bacteria 13696
408 Ga0207689_10018292 3300025942 Bacteria 5914
409 Ga0207689_10039610 3300025942 Bacteria 3901
410 Ga0207689_10048577 3300025942 Bacteria 3500
411 Ga0207689_10068198 3300025942 Bacteria 2923
412 Ga0207689_10125905 3300025942 Unclassified 2108
413 Ga0207689_10185102 3300025942 Bacteria 1718
414 Ga0207661_10015351 3300025944 Bacteria 5634
415 Ga0207661_10015910 3300025944 Bacteria 5542
416 Ga0207661_10034951 3300025944 Bacteria 3913
417 Ga0207661_10122815 3300025944 Bacteria 2213
418 Ga0207661_10130812 3300025944 Unclassified 2149
419 Ga0207661_10200500 3300025944 Unclassified 1754
420 Ga0207679_10001601 3300025945 Bacteria 14100
421 Ga0207667_10001839 3300025949 Bacteria 26648
422 Ga0207667_10009289 3300025949 Bacteria 11600
423 Ga0207667_10009325 3300025949 Bacteria 11574
424 Ga0207667_10044079 3300025949 Bacteria 4729
425 Ga0207651_10013291 3300025960 Bacteria 4705
426 Ga0207651_10027564 3300025960 Bacteria 3569
427 Ga0207651_10049635 3300025960 Unclassified 2844
428 Ga0207712_10001902 3300025961 Bacteria 13729
429 Ga0207712_10005835 3300025961 Bacteria 7759
430 Ga0207712_10024708 3300025961 Bacteria 3983
431 Ga0207712_10093517 3300025961 Unclassified 2219
432 Ga0207668_10079698 3300025972 Unclassified 2370
433 Ga0207640_10071643 3300025981 Bacteria 2335
434 Ga0207658_10012903 3300025986 Bacteria 5706
435 Ga0207658_10037308 3300025986 Bacteria 3491
436 Ga0207658_10054013 3300025986 Bacteria 2971
437 Ga0207658_10202462 3300025986 Bacteria 1658
438 Ga0207677_10013225 3300026023 Bacteria 4775
439 Ga0207677_10142796 3300026023 Bacteria 1836
440 Ga0207703_10004670 3300026035 Bacteria 11187
441 Ga0207639_10003317 3300026041 Bacteria 10837
442 Ga0207639_10004427 3300026041 Bacteria 9478
443 Ga0207639_10017171 3300026041 Bacteria 5129
444 Ga0207639_10155344 3300026041 Bacteria 1921
445 Ga0207678_10026209 3300026067 Bacteria 5086
446 Ga0207678_10039723 3300026067 Bacteria 4082
447 Ga0207708_10080461 3300026075 Bacteria 2503
448 Ga0207702_10055639 3300026078 Unclassified 3356
449 Ga0207641_10000026 3300026088 Bacteria 245091
450 Ga0207641_10000422 3300026088 Bacteria 49394
451 Ga0207641_10021966 3300026088 Bacteria 5247
452 Ga0207641_10029589 3300026088 Bacteria 4531
453 Ga0207641_10038099 3300026088 Bacteria 4019
454 Ga0207641_10132154 3300026088 Bacteria 2242
455 Ga0207648_10000768 3300026089 Bacteria 36105
456 Ga0207648_10009463 3300026089 Bacteria 9333
457 Ga0207648_10046592 3300026089 Bacteria 3802
458 Ga0207648_10156487 3300026089 Bacteria 2012
459 Ga0207648_10207726 3300026089 Bacteria 1738
460 Ga0207676_10018097 3300026095 Bacteria 5116
461 Ga0207676_10029802 3300026095 Bacteria 4089
462 Ga0207676_10076282 3300026095 Bacteria 2708
463 Ga0207674_10001969 3300026116 Bacteria 26000
464 Ga0207674_10008183 3300026116 Bacteria 12120
465 Ga0207674_10009341 3300026116 Bacteria 11226
466 Ga0207674_10009652 3300026116 Bacteria 11005
467 Ga0207674_10022923 3300026116 Bacteria 6699
468 Ga0207674_10043129 3300026116 Bacteria 4653
469 Ga0207674_10139411 3300026116 Bacteria 2385
470 Ga0207675_100000144 3300026118 Bacteria 61517
471 Ga0207675_100018980 3300026118 Bacteria 6420
472 Ga0207675_100025242 3300026118 Bacteria 5531
473 Ga0207675_100097595 3300026118 Bacteria 2767
474 Ga0207683_10001619 3300026121 Bacteria 20189
475 Ga0207683_10023404 3300026121 Bacteria 5313
476 Ga0207698_10003246 3300026142 Bacteria 9766
477 Ga0207698_10007808 3300026142 Bacteria 6726
478 Ga0207698_10008745 3300026142 Bacteria 6422
479 Ga0207698_10021599 3300026142 Bacteria 4456
480 Ga0207698_10028600 3300026142 Bacteria 3977
481 Ga0207698_10093807 3300026142 Bacteria 2466
482 Ga0207698_10177125 3300026142 Bacteria 1884
483 Ga0268266_10000169 3300028379 Bacteria 119437
484 Ga0268266_10040353 3300028379 Bacteria 3978
485 Ga0268265_10023099 3300028380 Bacteria 4380
486 Ga0268264_10000063 3300028381 Bacteria 301702
487 Ga0268264_10003414 3300028381 Bacteria 13700
488 Ga0268264_10054164 3300028381 Bacteria 3349
489 Ga0265323_10000193 3300028653 Bacteria 36767
490 Ga0307517_10000487 3300028786 Bacteria 68165
491 Ga0307515_10000031 3300028794 Bacteria 358648
492 Ga0265338_10006958 3300028800 Bacteria 14219
493 Ga0307511_10000409 3300030521 Bacteria 45829
494 Ga0265327_10000048 3300031251 Bacteria 269173
495 Ga0265327_10000234 3300031251 Bacteria 112034
496 Ga0265327_10000485 3300031251 Bacteria 69994
497 Ga0265327_10010626 3300031251 Bacteria 6445
498 Ga0265316_10000307 3300031344 Bacteria 54686
499 Ga0265316_10007597 3300031344 Bacteria 10194
500 Ga0307509_10080677 3300031507 Bacteria 3364
501 Ga0307408_100047278 3300031548 Bacteria 3081
502 Ga0265314_10105811 3300031711 Bacteria 1798
503 Ga0265342_10007739 3300031712 Bacteria 7823
504 Ga0316578_10073797 3300031728 Bacteria 2022
505 Ga0307516_10000384 3300031730 Bacteria 57633
506 Ga0307516_10067091 3300031730 Bacteria 3458
507 Ga0307413_10003715 3300031824 Bacteria 6491
508 Ga0307410_10006996 3300031852 Bacteria 6139
509 Ga0307414_10000153 3300032004 Bacteria 46402
510 Ga0373937_0090614 3300036401 Unclassified 2832
511 Ga0316584_0001337 3300036712 Bacteria 14624
512 Ga0395899_0000049 3300037312 Bacteria 225231
513 Ga0395899_0001033 3300037312 Bacteria 25344
514 Ga0395899_0045077 3300037312 Bacteria 3285
515 Ga0395899_0073282 3300037312 Bacteria 2505
516 Ga0395900_0000684 3300037418 Bacteria 45221
517 Ga0395900_0010049 3300037418 Bacteria 9682
518 Ga0395900_0090463 3300037418 Bacteria 3146
519 Ga0395898_0001281 3300037466 Bacteria 36973
520 Ga0395898_0023863 3300037466 Bacteria 6174
521 Ga0395898_0072758 3300037466 Bacteria 3320
522 Ga0395898_0103955 3300037466 Bacteria 2724
523 Ga0395905_0009119 3300037471 Bacteria 9719
524 Ga0395905_0016766 3300037471 Bacteria 6961
525 Ga0395905_0105038 3300037471 Bacteria 2652
526 Ga0395905_0229543 3300037471 Bacteria 1736
527 Ga0395901_0000995 3300038443 Bacteria 30617
528 Ga0395901_0007983 3300038443 Bacteria 10682
529 Ga0395901_0013422 3300038443 Bacteria 8327
530 Ga0400490_19689 3300038726 Bacteria 38346
531 Ga0436365_1847227 3300039437 Bacteria 10331
532 Ga0436365_1933142 3300039437 Bacteria 64226
533 Ga0439439_0009758 3300041406 Bacteria 2289
534 Ga0439449_0036161 3300042007 Bacteria 1837
535 Ga0439457_000442 3300042014 Bacteria 11954
536 Ga0451577_0000180 3300042876 Bacteria 135209
537 Ga0451577_0006510 3300042876 Bacteria 11629
538 Ga0451577_0018307 3300042876 Bacteria 6455
539 Ga0451577_0055711 3300042876 Bacteria 3527
540 Ga0451577_0093007 3300042876 Bacteria 2693
541 Ga0451577_0102865 3300042876 Bacteria 2552
542 Ga0451577_0135154 3300042876 Bacteria 2214
543 Ga0466969_0000106 3300044656 Bacteria 44435
544 Ga0466972_0000001 3300044658 Bacteria 412457
545 Ga0466972_0007750 3300044658 Bacteria 5391
546 Ga0453683_0000874 3300044673 Bacteria 28989
547 Ga0453683_0001893 3300044673 Bacteria 17141
548 Ga0466965_0021581 3300044683 Bacteria 3101
549 Ga0466966_0056621 3300044684 Bacteria 2480
550 Ga0466966_0094807 3300044684 Bacteria 1849
551 Ga0453684_0000913 3300044712 Bacteria 98173
552 Ga0453684_0003215 3300044712 Bacteria 37450
553 Ga0453684_0003831 3300044712 Bacteria 33176
554 Ga0453684_0009369 3300044712 Bacteria 17155
555 Ga0453684_0033962 3300044712 Bacteria 7093
556 Ga0453684_0044988 3300044712 Bacteria 5895
557 Ga0453684_0073733 3300044712 Bacteria 4302
558 Ga0453684_0087351 3300044712 Bacteria 3865
559 Ga0453684_0089281 3300044712 Bacteria 3813
560 Ga0453684_0101028 3300044712 Bacteria 3529
561 Ga0453684_0154906 3300044712 Bacteria 2718
562 Ga0453684_0177066 3300044712 Bacteria 2507
563 Ga0453684_0207018 3300044712 Bacteria 2283
564 Ga0453684_0317009 3300044712 Unclassified 1767
565 Ga0466971_0011845 3300044719 Bacteria 3821
566 Ga0466968_0013585 3300044735 Bacteria 3203
567 Ga0466970_0007288 3300044765 Bacteria 5540
568 Ga0466957_0000378 3300044842 Bacteria 21778
569 Ga0466957_0031367 3300044842 Bacteria 3176
570 Ga0466960_0034612 3300044901 Bacteria 2355
571 Ga0466959_0000003 3300045049 Bacteria 285164
572 Ga0466959_0000676 3300045049 Bacteria 19916
573 Ga0451576_0000080 3300045051 Bacteria 242782
574 Ga0451576_0010903 3300045051 Bacteria 10389
575 Ga0451576_0062267 3300045051 Bacteria 3890
576 Ga0451576_0076694 3300045051 Bacteria 3478
577 Ga0466958_0028859 3300045836 Bacteria 3292
578 Ga0495629_0069454 3300046459 Unclassified 2458
579 Ga0495638_0000001 3300046460 Bacteria 1114121
580 Ga0495650_0022146 3300046471 Unclassified 3053
581 Ga0495580_0078617 3300046472 Unclassified 2301
582 Ga0495594_0012737 3300046499 Bacteria 4388
583 Ga0495606_0006410 3300046507 Bacteria 10858
584 Ga0495643_0007737 3300046522 Bacteria 6885
585 Ga0495648_0002648 3300046524 Bacteria 16239
586 Ga0495652_0144330 3300046529 Bacteria 1868
587 Ga0495587_0081831 3300046536 Unclassified 1871
588 Ga0495668_0000097 3300046616 Bacteria 139246
589 Ga0495668_0004630 3300046616 Bacteria 9663
590 Ga0495611_0000061 3300046648 Bacteria 77533
591 Ga0495625_0087082 3300046660 Bacteria 2166
592 Ga0495658_0018761 3300046683 Bacteria 3602
593 Ga0495636_0000001 3300047318 Bacteria 149950
594 Ga0495674_0132214 3300047319 Unclassified 2102
595 Ga0495672_0007867 3300047320 Bacteria 7958
596 Ga0495672_0010270 3300047320 Bacteria 6688
597 Ga0495672_0041504 3300047320 Bacteria 2782
598 Ga0495687_001778 3300047443 Bacteria 19030
599 Ga0495686_0000010 3300047472 Bacteria 573229
600 Ga0495686_0000625 3300047472 Bacteria 48634
601 Ga0496101_0035015 3300048904 Unclassified 3550
602 Ga0496114_0004725 3300048917 Bacteria 10596
603 Ga0501292_007049 3300049515 Unclassified 1616
604 Ga0501298_000451 3300049521 Bacteria 5493
605 Ga0501031_0005804 3300049568 Bacteria 8044
606 Ga0501032_0002685 3300049569 Bacteria 13871
607 Ga0501032_0003218 3300049569 Bacteria 12559
608 Ga0501032_0024194 3300049569 Bacteria 4195
609 Ga0501032_0135104 3300049569 Bacteria 1626
610 Ga0501033_0000030 3300049570 Bacteria 157953
611 Ga0501033_0082226 3300049570 Bacteria 2362
612 Ga0501033_0150008 3300049570 Bacteria 1682
613 Ga0501034_0001691 3300049571 Bacteria 28435
614 Ga0501034_0007368 3300049571 Bacteria 11721
615 Ga0501034_0023134 3300049571 Bacteria 6333
616 Ga0501034_0083979 3300049571 Bacteria 3186
617 Ga0501034_0178258 3300049571 Bacteria 2090
618 Ga0501034_0299288 3300049571 Bacteria 1545
619 Ga0501036_0001672 3300049572 Bacteria 17196
620 Ga0501036_0010476 3300049572 Bacteria 7659
621 Ga0501036_0148690 3300049572 Bacteria 1976
622 Ga0501037_0003447 3300049573 Bacteria 11491
623 Ga0501037_0133666 3300049573 Bacteria 1777
624 Ga0501038_0029560 3300049574 Bacteria 4854
625 Ga0501038_0121214 3300049574 Bacteria 2156
626 Ga0501038_0183337 3300049574 Bacteria 1688
627 Ga0501039_0030914 3300049575 Unclassified 4129
628 Ga0501039_0125824 3300049575 Bacteria 2010
629 Ga0501043_0026225 3300049579 Bacteria 4572
630 Ga0501043_0037065 3300049579 Bacteria 3836
631 Ga0501047_0018063 3300049581 Bacteria 6759
632 Ga0501047_0039157 3300049581 Bacteria 4586
633 Ga0501047_0075877 3300049581 Bacteria 3235
634 Ga0501047_0098219 3300049581 Unclassified 2807
635 Ga0501069_0018603 3300049585 Bacteria 3750
636 Ga0501070_0008280 3300049586 Bacteria 8791
637 Ga0501070_0087030 3300049586 Bacteria 2587
638 Ga0501073_0008525 3300049589 Bacteria 7599
639 Ga0501074_0013058 3300049590 Bacteria 6037
640 Ga0501198_000442 3300049649 Bacteria 5122
641 Ga0501201_000672 3300049651 Bacteria 3198
642 Ga0501202_000366 3300049652 Bacteria 6277
643 Ga0501207_000033 3300049654 Bacteria 9861
644 Ga0501217_000032 3300049661 Bacteria 15163
645 Ga0501233_004657 3300049668 Bacteria 2526
646 Ga0501235_000540 3300049669 Bacteria 7549
647 Ga0501235_004851 3300049669 Bacteria 2913
648 Ga0501243_000061 3300049675 Bacteria 10533
649 Ga0501259_000165 3300049688 Bacteria 9969
650 Ga0501261_000807 3300049690 Bacteria 3915
651 Ga0501225_0002749 3300049705 Bacteria 5409
652 Ga0501225_0004690 3300049705 Bacteria 4054
653 Ga0501225_0004749 3300049705 Bacteria 4028
654 Ga0501234_000488 3300049707 Bacteria 6078
655 Ga0501245_001209 3300049708 Bacteria 3333
656 Ga0501080_0182078 3300049742 Bacteria 1933
657 Ga0501083_0095934 3300049744 Bacteria 1956
658 Ga0501266_001023 3300049763 Bacteria 3612
659 Ga0501268_001908 3300049765 Bacteria 2667
660 Ga0501035_0003216 3300049822 Bacteria 15655
661 Ga0501035_0018229 3300049822 Bacteria 6466
662 Ga0501044_0001914 3300049823 Bacteria 24093
663 Ga0501044_0014823 3300049823 Bacteria 8403
664 Ga0501044_0118282 3300049823 Bacteria 2653
665 Ga0501045_0000123 3300049824 Bacteria 40368
666 Ga0501284_00001 3300050005 Bacteria 261916
667 nmdc:mga05p37_1394_c1 3300050507 Bacteria 28114
668 nmdc:mga05p37_67105_c1 3300050507 Bacteria 4413
669 nmdc:mga0qj67_35739_c1 3300050509 Bacteria 3886
670 nmdc:mga06r32_59919_c1 3300050510 Unclassified 3662
671 nmdc:mga08y16_25655_c1 3300050511 Bacteria 6219
672 Ga0495619_0102045 3300053085 Unclassified 1954
673 Ga0500646_0001999 3300053090 Bacteria 5329
674 Ga0500583_0000019 3300053092 Bacteria 130534
675 Ga0500583_0001215 3300053092 Bacteria 7376
676 Ga0500650_0052920 3300053098 Bacteria 1888
677 Ga0500562_000024 3300053108 Bacteria 105996
678 Ga0500642_0034524 3300053130 Bacteria 2141
679 Ga0500568_0029575 3300053139 Bacteria 2272
680 Ga0500616_0000009 3300053153 Bacteria 779095
681 Ga0500616_0002947 3300053153 Bacteria 13540
682 Ga0500616_0034530 3300053153 Bacteria 2754
683 Ga0500622_0000353 3300053156 Bacteria 44849
684 Ga0500611_000001 3300053727 Bacteria 385744
685 Ga0500645_003247 3300053730 Bacteria 6723
686 Ga0500645_007614 3300053730 Bacteria 3756
687 Ga0466962_0008480 3300061719 Bacteria 4925

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049515 Ga0501292_007049 Ga0501292_007049_371_1606 355
2 3300009093 Ga0105240_10015806 Ga0105240_100158064 378
3 3300010375 Ga0105239_10039875 Ga0105239_100398754 378
4 3300013104 Ga0157370_10012794 Ga0157370_100127946 378
5 3300013307 Ga0157372_10009489 Ga0157372_100094895 378
6 3300025913 Ga0207695_10001383 Ga0207695_1000138333 378
7 3300028379 Ga0268266_10000169 Ga0268266_1000016973 378
8 3300046524 Ga0495648_0002648 Ga0495648_0002648_1043_2191 378
9 3300047443 Ga0495687_001778 Ga0495687_001778_1099_2247 378
10 3300049569 Ga0501032_0135104 Ga0501032_0135104_16_1164 378
11 3300053130 Ga0500642_0034524 Ga0500642_0034524_19_1167 378
12 3300049668 Ga0501233_004657 Ga0501233_004657_1152_2477 385
13 3300049574 Ga0501038_0183337 Ga0501038_0183337_337_1674 399
14 3300047319 Ga0495674_0132214 Ga0495674_0132214_16_1239 403
15 3300025901 Ga0207688_10080064 Ga0207688_100800642 405
16 3300042876 Ga0451577_0093007 Ga0451577_0093007_820_2229 431
17 3300045051 Ga0451576_0076694 Ga0451576_0076694_992_2401 431
18 3300044712 Ga0453684_0089281 Ga0453684_0089281_721_2130 432
19 3300005366 Ga0070659_100002166 Ga0070659_10000216613 434
20 3300005616 Ga0068852_100000706 Ga0068852_10000070614 434
21 3300025904 Ga0207647_10000131 Ga0207647_1000013152 434
22 3300025932 Ga0207690_10005004 Ga0207690_100050046 434
23 3300026142 Ga0207698_10008745 Ga0207698_100087456 434
24 3300005343 Ga0070687_100020594 Ga0070687_1000205943 436
25 3300005353 Ga0070669_100059023 Ga0070669_1000590231 436
26 3300006844 Ga0075428_100014704 Ga0075428_1000147043 437
27 3300006846 Ga0075430_100086919 Ga0075430_1000869192 437
28 3300006880 Ga0075429_100001064 Ga0075429_1000010646 437
29 3300047472 Ga0495686_0000010 Ga0495686_0000010_510540_511865 437
30 3300044683 Ga0466965_0021581 Ga0466965_0021581_381_1709 438
31 3300038726 Ga0400490_19689 Ga0400490_19689_18090_19490 441
32 3300005354 Ga0070675_100002115 Ga0070675_1000021157 442
33 3300005543 Ga0070672_100145047 Ga0070672_1001450472 442
34 3300005719 Ga0068861_100117666 Ga0068861_1001176661 442
35 3300025923 Ga0207681_10034199 Ga0207681_100341992 442
36 3300044673 Ga0453683_0001893 Ga0453683_0001893_14622_16028 444
37 3300049570 Ga0501033_0150008 Ga0501033_0150008_163_1644 444
38 3300026121 Ga0207683_10023404 Ga0207683_100234042 445
39 3300005289 Ga0065704_10130134 Ga0065704_101301342 446
40 3300005367 Ga0070667_100213037 Ga0070667_1002130371 446
41 3300005466 Ga0070685_10052342 Ga0070685_100523422 446
42 3300005577 Ga0068857_100011464 Ga0068857_1000114646 446
43 3300026041 Ga0207639_10155344 Ga0207639_101553441 446
44 3300026116 Ga0207674_10009341 Ga0207674_100093415 446
45 3300031712 Ga0265342_10007739 Ga0265342_100077398 446
46 3300005334 Ga0068869_100067524 Ga0068869_1000675242 447
47 3300005468 Ga0070707_100263899 Ga0070707_1002638991 447
48 3300005471 Ga0070698_100077619 Ga0070698_1000776192 447
49 3300005617 Ga0068859_100204940 Ga0068859_1002049402 447
50 3300006931 Ga0097620_100204949 Ga0097620_1002049492 447
51 3300025918 Ga0207662_10030116 Ga0207662_100301162 447
52 3300005844 Ga0068862_100080167 Ga0068862_1000801672 448
53 3300005328 Ga0070676_10017619 Ga0070676_100176193 449
54 3300005335 Ga0070666_10037855 Ga0070666_100378552 449
55 3300005356 Ga0070674_100014555 Ga0070674_1000145553 449
56 3300005364 Ga0070673_100064542 Ga0070673_1000645423 449
57 3300005367 Ga0070667_100029961 Ga0070667_1000299613 449
58 3300005456 Ga0070678_100008332 Ga0070678_1000083323 449
59 3300005539 Ga0068853_100017476 Ga0068853_1000174764 449
60 3300005843 Ga0068860_100113495 Ga0068860_1001134952 449
61 3300006237 Ga0097621_100058022 Ga0097621_1000580222 449
62 3300006358 Ga0068871_100020339 Ga0068871_1000203394 449
63 3300025901 Ga0207688_10018807 Ga0207688_100188074 449
64 3300025907 Ga0207645_10001118 Ga0207645_1000111812 449
65 3300025908 Ga0207643_10009005 Ga0207643_100090053 449
66 3300025940 Ga0207691_10020555 Ga0207691_100205553 449
67 3300025942 Ga0207689_10001731 Ga0207689_1000173117 449
68 3300025986 Ga0207658_10037308 Ga0207658_100373082 449
69 3300026116 Ga0207674_10139411 Ga0207674_101394112 449
70 3300026118 Ga0207675_100018980 Ga0207675_1000189804 449
71 3300026121 Ga0207683_10001619 Ga0207683_100016195 449
72 3300047472 Ga0495686_0000625 Ga0495686_0000625_10065_11435 449
73 3300049579 Ga0501043_0037065 Ga0501043_0037065_2236_3639 449
74 3300049649 Ga0501198_000442 Ga0501198_000442_2158_3531 449
75 3300049705 Ga0501225_0004690 Ga0501225_0004690_1737_3110 449
76 3300026075 Ga0207708_10080461 Ga0207708_100804612 450
77 3300028381 Ga0268264_10003414 Ga0268264_100034147 450
78 3300042876 Ga0451577_0055711 Ga0451577_0055711_1051_2508 450
79 3300048917 Ga0496114_0004725 Ga0496114_0004725_3616_5037 450
80 3300005329 Ga0070683_100210155 Ga0070683_1002101552 451
81 3300005330 Ga0070690_100045473 Ga0070690_1000454732 451
82 3300005334 Ga0068869_100061094 Ga0068869_1000610942 451
83 3300005335 Ga0070666_10118142 Ga0070666_101181421 451
84 3300005457 Ga0070662_100003263 Ga0070662_1000032639 451
85 3300005614 Ga0068856_100069438 Ga0068856_1000694382 451
86 3300005842 Ga0068858_100056199 Ga0068858_1000561991 451
87 3300010375 Ga0105239_10254145 Ga0105239_102541452 451
88 3300013296 Ga0157374_10013112 Ga0157374_100131124 451
89 3300013307 Ga0157372_10074551 Ga0157372_100745512 451
90 3300013308 Ga0157375_10004945 Ga0157375_100049452 451
91 3300014325 Ga0163163_10042459 Ga0163163_100424592 451
92 3300017792 Ga0163161_10003176 Ga0163161_100031763 451
93 3300025911 Ga0207654_10004542 Ga0207654_100045423 451
94 3300025913 Ga0207695_10020736 Ga0207695_100207366 451
95 3300025924 Ga0207694_10026748 Ga0207694_100267482 451
96 3300025933 Ga0207706_10003190 Ga0207706_1000319012 451
97 3300026078 Ga0207702_10055639 Ga0207702_100556393 451
98 3300042876 Ga0451577_0102865 Ga0451577_0102865_667_2082 451
99 3300044658 Ga0466972_0007750 Ga0466972_0007750_1835_3202 451
100 3300044712 Ga0453684_0101028 Ga0453684_0101028_132_1547 451
101 3300005329 Ga0070683_100002896 Ga0070683_1000028966 452
102 3300005564 Ga0070664_100000341 Ga0070664_10000034123 452
103 3300005577 Ga0068857_100000652 Ga0068857_10000065219 452
104 3300005843 Ga0068860_100069929 Ga0068860_1000699293 452
105 3300006847 Ga0075431_100011173 Ga0075431_1000111735 452
106 3300014326 Ga0157380_10005550 Ga0157380_100055503 452
107 3300025914 Ga0207671_10006294 Ga0207671_100062943 452
108 3300028381 Ga0268264_10054164 Ga0268264_100541643 452
109 3300031251 Ga0265327_10010626 Ga0265327_100106262 452
110 3300053139 Ga0500568_0029575 Ga0500568_0029575_273_1643 452
111 3300005331 Ga0070670_100085435 Ga0070670_1000854352 453
112 3300005340 Ga0070689_100011333 Ga0070689_1000113333 453
113 3300005353 Ga0070669_100001547 Ga0070669_1000015477 453
114 3300005365 Ga0070688_100008797 Ga0070688_1000087972 453
115 3300005459 Ga0068867_100121304 Ga0068867_1001213042 453
116 3300005617 Ga0068859_100010235 Ga0068859_1000102357 453
117 3300006844 Ga0075428_100039130 Ga0075428_1000391302 453
118 3300006847 Ga0075431_100011553 Ga0075431_1000115536 453
119 3300006880 Ga0075429_100014498 Ga0075429_1000144983 453
120 3300006931 Ga0097620_100010233 Ga0097620_1000102337 453
121 3300009093 Ga0105240_10000131 Ga0105240_1000013198 453
122 3300010375 Ga0105239_10001713 Ga0105239_100017135 453
123 3300014745 Ga0157377_10115088 Ga0157377_101150881 453
124 3300025913 Ga0207695_10000217 Ga0207695_1000021753 453
125 3300025923 Ga0207681_10002654 Ga0207681_100026542 453
126 3300026118 Ga0207675_100000144 Ga0207675_1000001447 453
127 3300031251 Ga0265327_10000234 Ga0265327_100002344 453
128 3300044712 Ga0453684_0154906 Ga0453684_0154906_602_2032 453
129 3300045051 Ga0451576_0062267 Ga0451576_0062267_316_1746 453
130 3300049763 Ga0501266_001023 Ga0501266_001023_439_1824 453
131 3300013100 Ga0157373_10009333 Ga0157373_100093334 454
132 3300025942 Ga0207689_10125905 Ga0207689_101259051 454
133 3300025961 Ga0207712_10024708 Ga0207712_100247082 454
134 3300005329 Ga0070683_100008183 Ga0070683_1000081832 455
135 3300005355 Ga0070671_100095081 Ga0070671_1000950811 455
136 3300005535 Ga0070684_100009042 Ga0070684_1000090425 455
137 3300005564 Ga0070664_100063257 Ga0070664_1000632572 455
138 3300005618 Ga0068864_100003504 Ga0068864_1000035043 455
139 3300011119 Ga0105246_10009987 Ga0105246_100099872 455
140 3300013296 Ga0157374_10002453 Ga0157374_100024533 455
141 3300013308 Ga0157375_10027810 Ga0157375_100278103 455
142 3300013308 Ga0157375_10127353 Ga0157375_101273532 455
143 3300014325 Ga0163163_10000732 Ga0163163_1000073217 455
144 3300025925 Ga0207650_10069465 Ga0207650_100694653 455
145 3300025931 Ga0207644_10030426 Ga0207644_100304263 455
146 3300025940 Ga0207691_10012577 Ga0207691_100125773 455
147 3300025944 Ga0207661_10015910 Ga0207661_100159101 455
148 3300025986 Ga0207658_10202462 Ga0207658_102024621 455
149 3300026023 Ga0207677_10142796 Ga0207677_101427961 455
150 3300026067 Ga0207678_10039723 Ga0207678_100397232 455
151 3300026116 Ga0207674_10022923 Ga0207674_100229233 455
152 3300031711 Ga0265314_10105811 Ga0265314_101058111 455
153 3300031730 Ga0307516_10000384 Ga0307516_1000038415 455
154 3300047318 Ga0495636_0000001 Ga0495636_0000001_54428_55873 455
155 iso_pu_bacteria 2896109856 2896112924 455
156 iso_pu_bacteria 2911138879 2911141113 455
157 3300005289 Ga0065704_10072259 Ga0065704_100722595 456
158 3300006163 Ga0070715_10046519 Ga0070715_100465192 456
159 3300006237 Ga0097621_100026494 Ga0097621_1000264943 456
160 3300026089 Ga0207648_10156487 Ga0207648_101564872 456
161 3300031728 Ga0316578_10073797 Ga0316578_100737972 456
162 3300036712 Ga0316584_0001337 Ga0316584_0001337_8192_9598 456
163 3300044712 Ga0453684_0317009 Ga0453684_0317009_216_1622 456
164 3300045051 Ga0451576_0010903 Ga0451576_0010903_8502_9908 456
165 3300046460 Ga0495638_0000001 Ga0495638_0000001_608338_609774 456
166 3300049571 Ga0501034_0299288 Ga0501034_0299288_35_1417 456
167 3300049574 Ga0501038_0121214 Ga0501038_0121214_556_1938 456
168 3300053153 Ga0500616_0000009 Ga0500616_0000009_127387_128823 456
169 iso_pu_bacteria 2884634485 2884636287 456
170 iso_pu_bacteria 2919692658 2919696055 456
171 3300005335 Ga0070666_10000064 Ga0070666_1000006475 457
172 3300005364 Ga0070673_100089652 Ga0070673_1000896522 457
173 3300005367 Ga0070667_100114295 Ga0070667_1001142952 457
174 3300005543 Ga0070672_100100565 Ga0070672_1001005652 457
175 3300005617 Ga0068859_100000003 Ga0068859_100000003160 457
176 3300005841 Ga0068863_100003550 Ga0068863_10000355012 457
177 3300005842 Ga0068858_100027838 Ga0068858_1000278383 457
178 3300006931 Ga0097620_100000003 Ga0097620_100000003160 457
179 3300025903 Ga0207680_10000388 Ga0207680_100003885 457
180 3300025911 Ga0207654_10001784 Ga0207654_100017846 457
181 3300025913 Ga0207695_10019233 Ga0207695_100192333 457
182 3300025914 Ga0207671_10001848 Ga0207671_1000184821 457
183 3300025940 Ga0207691_10058684 Ga0207691_100586843 457
184 3300025942 Ga0207689_10002903 Ga0207689_100029035 457
185 3300025961 Ga0207712_10001902 Ga0207712_100019028 457
186 3300026035 Ga0207703_10004670 Ga0207703_100046704 457
187 3300026088 Ga0207641_10000026 Ga0207641_10000026144 457
188 3300026088 Ga0207641_10000422 Ga0207641_100004222 457
189 3300026095 Ga0207676_10018097 Ga0207676_100180972 457
190 3300026142 Ga0207698_10003246 Ga0207698_100032467 457
191 iso_pu_bacteria 2881955468 2881956827 457
192 3300003794 Ga0055531_10000401 Ga0055531_1000040131 458
193 3300005290 Ga0065712_10005130 Ga0065712_100051302 458
194 3300005334 Ga0068869_100040043 Ga0068869_1000400432 458
195 3300005344 Ga0070661_100124342 Ga0070661_1001243422 458
196 3300005354 Ga0070675_100011337 Ga0070675_1000113374 458
197 3300005364 Ga0070673_100027220 Ga0070673_1000272203 458
198 3300005364 Ga0070673_100045099 Ga0070673_1000450992 458
199 3300005617 Ga0068859_100299453 Ga0068859_1002994531 458
200 3300005841 Ga0068863_100114740 Ga0068863_1001147403 458
201 3300006880 Ga0075429_100147448 Ga0075429_1001474481 458
202 3300006931 Ga0097620_100299472 Ga0097620_1002994721 458
203 3300009094 Ga0111539_10014643 Ga0111539_100146435 458
204 3300009147 Ga0114129_10076888 Ga0114129_100768883 458
205 3300009176 Ga0105242_10035315 Ga0105242_100353155 458
206 3300009176 Ga0105242_10062251 Ga0105242_100622512 458
207 3300009177 Ga0105248_10112813 Ga0105248_101128132 458
208 3300009553 Ga0105249_10063526 Ga0105249_100635262 458
209 3300013102 Ga0157371_10121467 Ga0157371_101214672 458
210 3300013105 Ga0157369_10205240 Ga0157369_102052402 458
211 3300014745 Ga0157377_10044856 Ga0157377_100448562 458
212 3300025304 Ga0209257_1000023 Ga0209257_1000023424 458
213 3300025908 Ga0207643_10014263 Ga0207643_100142632 458
214 3300025920 Ga0207649_10114705 Ga0207649_101147051 458
215 3300025941 Ga0207711_10133513 Ga0207711_101335132 458
216 3300025942 Ga0207689_10003837 Ga0207689_1000383711 458
217 3300025942 Ga0207689_10018292 Ga0207689_100182923 458
218 3300025942 Ga0207689_10039610 Ga0207689_100396102 458
219 3300025942 Ga0207689_10048577 Ga0207689_100485772 458
220 3300025960 Ga0207651_10027564 Ga0207651_100275641 458
221 3300025960 Ga0207651_10049635 Ga0207651_100496351 458
222 3300025972 Ga0207668_10079698 Ga0207668_100796981 458
223 3300025986 Ga0207658_10054013 Ga0207658_100540132 458
224 3300026088 Ga0207641_10132154 Ga0207641_101321542 458
225 3300026118 Ga0207675_100025242 Ga0207675_1000252423 458
226 3300037471 Ga0395905_0105038 Ga0395905_0105038_754_2160 458
227 3300044712 Ga0453684_0207018 Ga0453684_0207018_626_2053 458
228 3300046499 Ga0495594_0012737 Ga0495594_0012737_1241_2647 458
229 3300049765 Ga0501268_001908 Ga0501268_001908_479_1885 458
230 3300050511 nmdc:mga08y16_25655_c1 nmdc:mga08y16_25655_c1_1288_2733 458
231 3300005329 Ga0070683_100050048 Ga0070683_1000500482 459
232 3300005331 Ga0070670_100018086 Ga0070670_1000180864 459
233 3300005355 Ga0070671_100033340 Ga0070671_1000333402 459
234 3300005355 Ga0070671_100176340 Ga0070671_1001763402 459
235 3300005564 Ga0070664_100002301 Ga0070664_10000230111 459
236 3300015265 Ga0182005_1000043 Ga0182005_100004373 459
237 3300025925 Ga0207650_10000813 Ga0207650_1000081315 459
238 3300025931 Ga0207644_10039267 Ga0207644_100392672 459
239 3300025942 Ga0207689_10068198 Ga0207689_100681982 459
240 3300025944 Ga0207661_10130812 Ga0207661_101308122 459
241 3300028653 Ga0265323_10000193 Ga0265323_100001932 459
242 3300028800 Ga0265338_10006958 Ga0265338_100069588 459
243 3300031344 Ga0265316_10000307 Ga0265316_100003075 459
244 3300031344 Ga0265316_10007597 Ga0265316_100075972 459
245 3300037471 Ga0395905_0016766 Ga0395905_0016766_604_2103 459
246 3300050509 nmdc:mga0qj67_35739_c1 nmdc:mga0qj67_35739_c1_2409_3872 459
247 3300053153 Ga0500616_0034530 Ga0500616_0034530_515_1969 459
248 3300005343 Ga0070687_100005317 Ga0070687_1000053175 460
249 3300005354 Ga0070675_100145471 Ga0070675_1001454711 460
250 3300005355 Ga0070671_100003764 Ga0070671_1000037646 460
251 3300005364 Ga0070673_100017552 Ga0070673_1000175523 460
252 3300005564 Ga0070664_100054863 Ga0070664_1000548632 460
253 3300005842 Ga0068858_100088996 Ga0068858_1000889962 460
254 3300006237 Ga0097621_100129324 Ga0097621_1001293242 460
255 3300013102 Ga0157371_10004079 Ga0157371_100040797 460
256 3300014325 Ga0163163_10371814 Ga0163163_103718141 460
257 3300025901 Ga0207688_10077494 Ga0207688_100774942 460
258 3300025918 Ga0207662_10042043 Ga0207662_100420432 460
259 3300025961 Ga0207712_10093517 Ga0207712_100935172 460
260 3300026142 Ga0207698_10177125 Ga0207698_101771252 460
261 3300031251 Ga0265327_10000485 Ga0265327_1000048530 460
262 3300031548 Ga0307408_100047278 Ga0307408_1000472783 460
263 3300031824 Ga0307413_10003715 Ga0307413_100037152 460
264 3300031852 Ga0307410_10006996 Ga0307410_100069965 460
265 3300032004 Ga0307414_10000153 Ga0307414_100001535 460
266 3300037312 Ga0395899_0000049 Ga0395899_0000049_208778_210187 460
267 3300037418 Ga0395900_0090463 Ga0395900_0090463_502_1911 460
268 3300049569 Ga0501032_0024194 Ga0501032_0024194_227_1627 460
269 3300049570 Ga0501033_0082226 Ga0501033_0082226_221_1621 460
270 3300049571 Ga0501034_0023134 Ga0501034_0023134_2896_4296 460
271 3300049572 Ga0501036_0148690 Ga0501036_0148690_432_1832 460
272 3300049573 Ga0501037_0133666 Ga0501037_0133666_186_1586 460
273 3300049575 Ga0501039_0030914 Ga0501039_0030914_334_1734 460
274 3300049579 Ga0501043_0026225 Ga0501043_0026225_596_1996 460
275 3300049581 Ga0501047_0075877 Ga0501047_0075877_859_2259 460
276 3300049652 Ga0501202_000366 Ga0501202_000366_4657_6069 460
277 3300049669 Ga0501235_004851 Ga0501235_004851_13_1425 460
278 iso_pu_bacteria 2914759650 2914762440 460
279 3300003316 rootH1_10076736 rootH1_100767361 461
280 3300003323 rootH1_10116615 rootH1_101166157 461
281 3300003323 rootH1_10211012 rootH1_102110124 461
282 3300005334 Ga0068869_100130571 Ga0068869_1001305711 461
283 3300005336 Ga0070680_100004861 Ga0070680_1000048612 461
284 3300005355 Ga0070671_100036570 Ga0070671_1000365702 461
285 3300005366 Ga0070659_100015031 Ga0070659_1000150311 461
286 3300005367 Ga0070667_100046048 Ga0070667_1000460483 461
287 3300005455 Ga0070663_100077147 Ga0070663_1000771472 461
288 3300005457 Ga0070662_100034440 Ga0070662_1000344403 461
289 3300005457 Ga0070662_100140022 Ga0070662_1001400221 461
290 3300005458 Ga0070681_10011816 Ga0070681_100118162 461
291 3300005563 Ga0068855_100002248 Ga0068855_10000224815 461
292 3300005563 Ga0068855_100015455 Ga0068855_1000154552 461
293 3300005564 Ga0070664_100257117 Ga0070664_1002571171 461
294 3300005616 Ga0068852_100085278 Ga0068852_1000852782 461
295 3300005617 Ga0068859_100033423 Ga0068859_1000334232 461
296 3300005617 Ga0068859_100228100 Ga0068859_1002281002 461
297 3300005842 Ga0068858_100035990 Ga0068858_1000359903 461
298 3300006931 Ga0097620_100033422 Ga0097620_1000334225 461
299 3300006931 Ga0097620_100228106 Ga0097620_1002281062 461
300 3300009147 Ga0114129_10011797 Ga0114129_100117978 461
301 3300009545 Ga0105237_10009698 Ga0105237_100096985 461
302 3300009553 Ga0105249_10019335 Ga0105249_100193353 461
303 3300009553 Ga0105249_10075831 Ga0105249_100758312 461
304 3300013102 Ga0157371_10002424 Ga0157371_1000242412 461
305 3300013102 Ga0157371_10034892 Ga0157371_100348922 461
306 3300013104 Ga0157370_10011871 Ga0157370_100118712 461
307 3300013296 Ga0157374_10065603 Ga0157374_100656033 461
308 3300013296 Ga0157374_10075274 Ga0157374_100752742 461
309 3300013306 Ga0163162_10001913 Ga0163162_100019134 461
310 3300013306 Ga0163162_10025269 Ga0163162_100252694 461
311 3300013306 Ga0163162_10107185 Ga0163162_101071852 461
312 3300013307 Ga0157372_10009879 Ga0157372_100098794 461
313 3300013307 Ga0157372_10013017 Ga0157372_100130175 461
314 3300013308 Ga0157375_10091529 Ga0157375_100915293 461
315 3300025904 Ga0207647_10009015 Ga0207647_100090156 461
316 3300025907 Ga0207645_10019550 Ga0207645_100195505 461
317 3300025909 Ga0207705_10053258 Ga0207705_100532584 461
318 3300025921 Ga0207652_10000103 Ga0207652_1000010344 461
319 3300025921 Ga0207652_10006111 Ga0207652_100061119 461
320 3300025936 Ga0207670_10021241 Ga0207670_100212414 461
321 3300025942 Ga0207689_10185102 Ga0207689_101851021 461
322 3300025944 Ga0207661_10034951 Ga0207661_100349512 461
323 3300025949 Ga0207667_10044079 Ga0207667_100440792 461
324 3300026067 Ga0207678_10026209 Ga0207678_100262093 461
325 3300026089 Ga0207648_10046592 Ga0207648_100465922 461
326 3300026142 Ga0207698_10021599 Ga0207698_100215992 461
327 3300037312 Ga0395899_0001033 Ga0395899_0001033_16816_18222 461
328 3300037312 Ga0395899_0045077 Ga0395899_0045077_1081_2487 461
329 3300037312 Ga0395899_0073282 Ga0395899_0073282_985_2391 461
330 3300037418 Ga0395900_0000684 Ga0395900_0000684_28312_29718 461
331 3300037418 Ga0395900_0010049 Ga0395900_0010049_5703_7109 461
332 3300037466 Ga0395898_0001281 Ga0395898_0001281_15212_16618 461
333 3300037466 Ga0395898_0023863 Ga0395898_0023863_2368_3774 461
334 3300037466 Ga0395898_0103955 Ga0395898_0103955_520_1926 461
335 3300037471 Ga0395905_0229543 Ga0395905_0229543_312_1718 461
336 3300038443 Ga0395901_0000995 Ga0395901_0000995_25673_27079 461
337 3300038443 Ga0395901_0007983 Ga0395901_0007983_7100_8506 461
338 3300042876 Ga0451577_0018307 Ga0451577_0018307_1873_3294 461
339 3300044712 Ga0453684_0000913 Ga0453684_0000913_37707_39128 461
340 3300045051 Ga0451576_0000080 Ga0451576_0000080_203628_205049 461
341 3300046471 Ga0495650_0022146 Ga0495650_0022146_659_2152 461
342 3300046616 Ga0495668_0000097 Ga0495668_0000097_37675_39087 461
343 3300050507 nmdc:mga05p37_67105_c1 nmdc:mga05p37_67105_c1_1078_2481 461
344 3300050510 nmdc:mga06r32_59919_c1 nmdc:mga06r32_59919_c1_307_1710 461
345 3300053153 Ga0500616_0002947 Ga0500616_0002947_295_1707 461
346 3300003320 rootH2_10006463 rootH2_1000646322 462
347 3300003323 rootH1_10004992 rootH1_100049922 462
348 3300005327 Ga0070658_10008208 Ga0070658_100082084 462
349 3300005328 Ga0070676_10000167 Ga0070676_100001676 462
350 3300005335 Ga0070666_10000512 Ga0070666_1000051219 462
351 3300005336 Ga0070680_100062841 Ga0070680_1000628412 462
352 3300005338 Ga0068868_100004051 Ga0068868_1000040514 462
353 3300005341 Ga0070691_10004449 Ga0070691_100044494 462
354 3300005344 Ga0070661_100005273 Ga0070661_1000052736 462
355 3300005347 Ga0070668_100012112 Ga0070668_1000121124 462
356 3300005364 Ga0070673_100003256 Ga0070673_1000032564 462
357 3300005367 Ga0070667_100023384 Ga0070667_1000233842 462
358 3300005367 Ga0070667_100028206 Ga0070667_1000282063 462
359 3300005435 Ga0070714_100000081 Ga0070714_10000008159 462
360 3300005455 Ga0070663_100065626 Ga0070663_1000656262 462
361 3300005457 Ga0070662_100067894 Ga0070662_1000678943 462
362 3300005459 Ga0068867_100000714 Ga0068867_10000071424 462
363 3300005535 Ga0070684_100000042 Ga0070684_10000004264 462
364 3300005539 Ga0068853_100004615 Ga0068853_1000046156 462
365 3300005543 Ga0070672_100010987 Ga0070672_1000109873 462
366 3300005577 Ga0068857_100002017 Ga0068857_10000201710 462
367 3300005616 Ga0068852_100000391 Ga0068852_1000003915 462
368 3300005617 Ga0068859_100172480 Ga0068859_1001724802 462
369 3300005618 Ga0068864_100004147 Ga0068864_1000041475 462
370 3300005834 Ga0068851_10002509 Ga0068851_100025093 462
371 3300005841 Ga0068863_100045682 Ga0068863_1000456823 462
372 3300005842 Ga0068858_100032949 Ga0068858_1000329494 462
373 3300005843 Ga0068860_100023659 Ga0068860_1000236595 462
374 3300006237 Ga0097621_100003397 Ga0097621_10000339711 462
375 3300006237 Ga0097621_100006293 Ga0097621_1000062933 462
376 3300006358 Ga0068871_100002146 Ga0068871_10000214610 462
377 3300006881 Ga0068865_100008145 Ga0068865_1000081452 462
378 3300006931 Ga0097620_100172496 Ga0097620_1001724962 462
379 3300009093 Ga0105240_10024869 Ga0105240_100248695 462
380 3300009094 Ga0111539_10201269 Ga0111539_102012693 462
381 3300009098 Ga0105245_10033821 Ga0105245_100338213 462
382 3300009101 Ga0105247_10004604 Ga0105247_100046044 462
383 3300009174 Ga0105241_10002666 Ga0105241_100026661 462
384 3300009174 Ga0105241_10154480 Ga0105241_101544801 462
385 3300009176 Ga0105242_10021494 Ga0105242_100214944 462
386 3300009177 Ga0105248_10033429 Ga0105248_100334295 462
387 3300009545 Ga0105237_10018668 Ga0105237_100186683 462
388 3300009545 Ga0105237_10057297 Ga0105237_100572972 462
389 3300009551 Ga0105238_10031735 Ga0105238_100317354 462
390 3300009551 Ga0105238_10149535 Ga0105238_101495352 462
391 3300009551 Ga0105238_10158299 Ga0105238_101582992 462
392 3300009553 Ga0105249_10011067 Ga0105249_100110678 462
393 3300010375 Ga0105239_10008508 Ga0105239_100085086 462
394 3300011119 Ga0105246_10030859 Ga0105246_100308592 462
395 3300013104 Ga0157370_10021834 Ga0157370_100218345 462
396 3300013105 Ga0157369_10022017 Ga0157369_100220173 462
397 3300013296 Ga0157374_10092994 Ga0157374_100929942 462
398 3300013297 Ga0157378_10026281 Ga0157378_100262812 462
399 3300013306 Ga0163162_10000725 Ga0163162_1000072518 462
400 3300013306 Ga0163162_10005264 Ga0163162_100052645 462
401 3300013308 Ga0157375_10000422 Ga0157375_100004223 462
402 3300013308 Ga0157375_10008894 Ga0157375_100088945 462
403 3300013308 Ga0157375_10041750 Ga0157375_100417502 462
404 3300014325 Ga0163163_10000526 Ga0163163_1000052631 462
405 3300014968 Ga0157379_10001164 Ga0157379_100011643 462
406 3300014968 Ga0157379_10002405 Ga0157379_100024053 462
407 3300014968 Ga0157379_10039691 Ga0157379_100396913 462
408 3300014969 Ga0157376_10000762 Ga0157376_100007622 462
409 3300014969 Ga0157376_10005617 Ga0157376_100056178 462
410 3300014969 Ga0157376_10089660 Ga0157376_100896603 462
411 3300017792 Ga0163161_10002456 Ga0163161_100024562 462
412 3300025246 Ga0209646_1003765 Ga0209646_10037652 462
413 3300025900 Ga0207710_10001920 Ga0207710_100019203 462
414 3300025904 Ga0207647_10008544 Ga0207647_100085445 462
415 3300025904 Ga0207647_10068340 Ga0207647_100683402 462
416 3300025907 Ga0207645_10007440 Ga0207645_100074402 462
417 3300025909 Ga0207705_10009232 Ga0207705_100092323 462
418 3300025912 Ga0207707_10004563 Ga0207707_100045639 462
419 3300025913 Ga0207695_10078895 Ga0207695_100788953 462
420 3300025914 Ga0207671_10008066 Ga0207671_100080669 462
421 3300025919 Ga0207657_10038632 Ga0207657_100386322 462
422 3300025921 Ga0207652_10033600 Ga0207652_100336002 462
423 3300025924 Ga0207694_10013486 Ga0207694_100134865 462
424 3300025927 Ga0207687_10037320 Ga0207687_100373202 462
425 3300025929 Ga0207664_10000042 Ga0207664_1000004277 462
426 3300025933 Ga0207706_10085304 Ga0207706_100853042 462
427 3300025938 Ga0207704_10011883 Ga0207704_100118832 462
428 3300025938 Ga0207704_10023419 Ga0207704_100234192 462
429 3300025940 Ga0207691_10000234 Ga0207691_1000023439 462
430 3300025944 Ga0207661_10122815 Ga0207661_101228152 462
431 3300025945 Ga0207679_10001601 Ga0207679_100016016 462
432 3300025949 Ga0207667_10001839 Ga0207667_1000183917 462
433 3300025961 Ga0207712_10005835 Ga0207712_100058352 462
434 3300025986 Ga0207658_10012903 Ga0207658_100129032 462
435 3300026041 Ga0207639_10003317 Ga0207639_100033173 462
436 3300026088 Ga0207641_10021966 Ga0207641_100219663 462
437 3300026088 Ga0207641_10029589 Ga0207641_100295892 462
438 3300026088 Ga0207641_10038099 Ga0207641_100380992 462
439 3300026089 Ga0207648_10000768 Ga0207648_1000076837 462
440 3300026095 Ga0207676_10029802 Ga0207676_100298022 462
441 3300026116 Ga0207674_10001969 Ga0207674_1000196913 462
442 3300026116 Ga0207674_10008183 Ga0207674_100081836 462
443 3300026118 Ga0207675_100097595 Ga0207675_1000975952 462
444 3300026142 Ga0207698_10007808 Ga0207698_100078083 462
445 3300026142 Ga0207698_10028600 Ga0207698_100286004 462
446 3300028379 Ga0268266_10040353 Ga0268266_100403534 462
447 3300036401 Ga0373937_0090614 Ga0373937_0090614_954_2360 462
448 3300042007 Ga0439449_0036161 Ga0439449_0036161_182_1627 462
449 3300044712 Ga0453684_0033962 Ga0453684_0033962_5444_6859 462
450 3300044719 Ga0466971_0011845 Ga0466971_0011845_920_2326 462
451 3300044842 Ga0466957_0031367 Ga0466957_0031367_193_1599 462
452 3300045049 Ga0466959_0000676 Ga0466959_0000676_2815_4221 462
453 3300045836 Ga0466958_0028859 Ga0466958_0028859_344_1750 462
454 3300046459 Ga0495629_0069454 Ga0495629_0069454_908_2314 462
455 3300046472 Ga0495580_0078617 Ga0495580_0078617_811_2217 462
456 3300046529 Ga0495652_0144330 Ga0495652_0144330_69_1475 462
457 3300046536 Ga0495587_0081831 Ga0495587_0081831_127_1533 462
458 3300046683 Ga0495658_0018761 Ga0495658_0018761_142_1548 462
459 3300048904 Ga0496101_0035015 Ga0496101_0035015_832_2238 462
460 3300049568 Ga0501031_0005804 Ga0501031_0005804_2481_3911 462
461 3300049569 Ga0501032_0003218 Ga0501032_0003218_4126_5556 462
462 3300049570 Ga0501033_0000030 Ga0501033_0000030_9365_10795 462
463 3300049571 Ga0501034_0001691 Ga0501034_0001691_17234_18664 462
464 3300049572 Ga0501036_0010476 Ga0501036_0010476_2970_4400 462
465 3300049575 Ga0501039_0125824 Ga0501039_0125824_234_1664 462
466 3300049585 Ga0501069_0018603 Ga0501069_0018603_95_1501 462
467 3300049744 Ga0501083_0095934 Ga0501083_0095934_132_1538 462
468 3300049822 Ga0501035_0003216 Ga0501035_0003216_8465_9895 462
469 3300049823 Ga0501044_0118282 Ga0501044_0118282_674_2080 462
470 3300049824 Ga0501045_0000123 Ga0501045_0000123_8831_10261 462
471 3300053085 Ga0495619_0102045 Ga0495619_0102045_386_1792 462
472 3300061719 Ga0466962_0008480 Ga0466962_0008480_1723_3129 462
473 3300003320 rootH2_10012033 rootH2_100120333 463
474 3300005539 Ga0068853_100025049 Ga0068853_1000250492 463
475 3300005563 Ga0068855_100004845 Ga0068855_1000048452 463
476 3300005616 Ga0068852_100069937 Ga0068852_1000699372 463
477 3300005843 Ga0068860_100000003 Ga0068860_100000003297 463
478 3300005983 Ga0081540_1020250 Ga0081540_10202502 463
479 3300009093 Ga0105240_10000664 Ga0105240_100006648 463
480 3300009093 Ga0105240_10088628 Ga0105240_100886282 463
481 3300009093 Ga0105240_10090171 Ga0105240_100901712 463
482 3300009094 Ga0111539_10032512 Ga0111539_100325124 463
483 3300009174 Ga0105241_10000543 Ga0105241_100005433 463
484 3300009545 Ga0105237_10000144 Ga0105237_1000014462 463
485 3300009545 Ga0105237_10006055 Ga0105237_100060559 463
486 3300009545 Ga0105237_10014604 Ga0105237_100146045 463
487 3300009551 Ga0105238_10001637 Ga0105238_1000163713 463
488 3300010375 Ga0105239_10029181 Ga0105239_100291812 463
489 3300010375 Ga0105239_10197445 Ga0105239_101974452 463
490 3300013296 Ga0157374_10000013 Ga0157374_10000013364 463
491 3300013306 Ga0163162_10003339 Ga0163162_100033392 463
492 3300013306 Ga0163162_10043198 Ga0163162_100431982 463
493 3300013307 Ga0157372_10002589 Ga0157372_1000258910 463
494 3300013308 Ga0157375_10021159 Ga0157375_100211592 463
495 3300014325 Ga0163163_10000952 Ga0163163_1000095215 463
496 3300014325 Ga0163163_10069982 Ga0163163_100699823 463
497 3300014325 Ga0163163_10198533 Ga0163163_101985332 463
498 3300014326 Ga0157380_10020326 Ga0157380_100203262 463
499 3300014326 Ga0157380_10039569 Ga0157380_100395693 463
500 3300014969 Ga0157376_10001116 Ga0157376_100011167 463
501 3300025913 Ga0207695_10001317 Ga0207695_100013178 463
502 3300025913 Ga0207695_10002258 Ga0207695_1000225812 463
503 3300025914 Ga0207671_10001368 Ga0207671_100013684 463
504 3300025914 Ga0207671_10011603 Ga0207671_100116034 463
505 3300025944 Ga0207661_10015351 Ga0207661_100153513 463
506 3300025949 Ga0207667_10009289 Ga0207667_1000928910 463
507 3300026041 Ga0207639_10017171 Ga0207639_100171714 463
508 3300026095 Ga0207676_10076282 Ga0207676_100762822 463
509 3300026142 Ga0207698_10093807 Ga0207698_100938072 463
510 3300028381 Ga0268264_10000063 Ga0268264_10000063214 463
511 3300028786 Ga0307517_10000487 Ga0307517_100004877 463
512 3300030521 Ga0307511_10000409 Ga0307511_1000040932 463
513 3300031730 Ga0307516_10067091 Ga0307516_100670912 463
514 3300042876 Ga0451577_0000180 Ga0451577_0000180_64041_65477 463
515 3300044673 Ga0453683_0000874 Ga0453683_0000874_14285_15706 463
516 3300044712 Ga0453684_0003831 Ga0453684_0003831_235_1671 463
517 3300044712 Ga0453684_0177066 Ga0453684_0177066_1052_2461 463
518 3300046507 Ga0495606_0006410 Ga0495606_0006410_7532_8941 463
519 3300046648 Ga0495611_0000061 Ga0495611_0000061_9090_10499 463
520 3300046660 Ga0495625_0087082 Ga0495625_0087082_500_1939 463
521 3300047320 Ga0495672_0007867 Ga0495672_0007867_3825_5234 463
522 3300053727 Ga0500611_000001 Ga0500611_000001_283025_284452 463
523 3300003203 JGI25406J46586_10000886 JGI25406J46586_100008864 464
524 3300005327 Ga0070658_10019578 Ga0070658_100195782 464
525 3300005337 Ga0070682_100020387 Ga0070682_1000203871 464
526 3300005338 Ga0068868_100032460 Ga0068868_1000324602 464
527 3300005339 Ga0070660_100013009 Ga0070660_1000130093 464
528 3300005344 Ga0070661_100022229 Ga0070661_1000222292 464
529 3300005354 Ga0070675_100035094 Ga0070675_1000350943 464
530 3300005364 Ga0070673_100014566 Ga0070673_1000145664 464
531 3300005366 Ga0070659_100007353 Ga0070659_1000073533 464
532 3300005367 Ga0070667_100140172 Ga0070667_1001401722 464
533 3300005457 Ga0070662_100006273 Ga0070662_1000062737 464
534 3300005471 Ga0070698_100004403 Ga0070698_1000044033 464
535 3300005530 Ga0070679_100042529 Ga0070679_1000425291 464
536 3300005535 Ga0070684_100015194 Ga0070684_1000151945 464
537 3300005544 Ga0070686_100035991 Ga0070686_1000359912 464
538 3300005563 Ga0068855_100007429 Ga0068855_1000074298 464
539 3300005564 Ga0070664_100203742 Ga0070664_1002037421 464
540 3300005578 Ga0068854_100041746 Ga0068854_1000417462 464
541 3300005616 Ga0068852_100025764 Ga0068852_1000257642 464
542 3300005985 Ga0081539_10000284 Ga0081539_100002844 464
543 3300006358 Ga0068871_100016497 Ga0068871_1000164975 464
544 3300013104 Ga0157370_10031180 Ga0157370_100311803 464
545 3300013296 Ga0157374_10002190 Ga0157374_100021908 464
546 3300013307 Ga0157372_10008586 Ga0157372_100085867 464
547 3300013307 Ga0157372_10067344 Ga0157372_100673442 464
548 3300014968 Ga0157379_10160506 Ga0157379_101605062 464
549 3300025904 Ga0207647_10009973 Ga0207647_100099735 464
550 3300025909 Ga0207705_10088123 Ga0207705_100881232 464
551 3300025919 Ga0207657_10017781 Ga0207657_100177812 464
552 3300025921 Ga0207652_10029001 Ga0207652_100290012 464
553 3300025932 Ga0207690_10073374 Ga0207690_100733742 464
554 3300025933 Ga0207706_10054770 Ga0207706_100547703 464
555 3300025960 Ga0207651_10013291 Ga0207651_100132912 464
556 3300025981 Ga0207640_10071643 Ga0207640_100716432 464
557 3300026023 Ga0207677_10013225 Ga0207677_100132253 464
558 3300026116 Ga0207674_10009652 Ga0207674_100096525 464
559 3300044684 Ga0466966_0056621 Ga0466966_0056621_61_1473 464
560 3300044712 Ga0453684_0087351 Ga0453684_0087351_1452_2867 464
561 3300049571 Ga0501034_0007368 Ga0501034_0007368_8864_10285 464
562 3300049573 Ga0501037_0003447 Ga0501037_0003447_5762_7174 464
563 3300049823 Ga0501044_0014823 Ga0501044_0014823_4270_5682 464
564 iso_pu_bacteria 2929154850 2929159272 464
565 3300005617 Ga0068859_100026078 Ga0068859_1000260784 465
566 3300005840 Ga0068870_10007082 Ga0068870_100070823 465
567 3300006931 Ga0097620_100026077 Ga0097620_1000260774 465
568 3300009094 Ga0111539_10002241 Ga0111539_100022417 465
569 3300010375 Ga0105239_10000488 Ga0105239_1000048841 465
570 3300013297 Ga0157378_10019445 Ga0157378_100194455 465
571 3300013307 Ga0157372_10007573 Ga0157372_1000757310 465
572 3300014326 Ga0157380_10010678 Ga0157380_100106783 465
573 3300025926 Ga0207659_10044302 Ga0207659_100443023 465
574 3300026041 Ga0207639_10004427 Ga0207639_100044275 465
575 3300028380 Ga0268265_10023099 Ga0268265_100230992 465
576 3300039437 Ga0436365_1847227 Ga0436365_1847227_5895_7328 465
577 3300044712 Ga0453684_0003215 Ga0453684_0003215_20364_21785 465
578 3300046522 Ga0495643_0007737 Ga0495643_0007737_4382_5800 465
579 3300047320 Ga0495672_0041504 Ga0495672_0041504_863_2347 465
580 3300053098 Ga0500650_0052920 Ga0500650_0052920_168_1586 465
581 iso_pu_bacteria 2818991444 2819585960 465
582 iso_pu_bacteria 2840677318 2840678922 465
583 3300005459 Ga0068867_100037807 Ga0068867_1000378072 466
584 3300006237 Ga0097621_100003853 Ga0097621_1000038532 466
585 3300009176 Ga0105242_10009360 Ga0105242_100093605 466
586 3300013308 Ga0157375_10211978 Ga0157375_102119783 466
587 3300026089 Ga0207648_10009463 Ga0207648_100094636 466
588 3300031251 Ga0265327_10000048 Ga0265327_10000048127 466
589 3300039437 Ga0436365_1933142 Ga0436365_1933142_20413_21867 466
590 3300044842 Ga0466957_0000378 Ga0466957_0000378_7503_8921 466
591 3300050507 nmdc:mga05p37_1394_c1 nmdc:mga05p37_1394_c1_6941_8344 466
592 3300003320 rootH2_10203242 rootH2_102032422 467
593 3300003323 rootH1_10020501 rootH1_1002050110 467
594 3300005338 Ga0068868_100160173 Ga0068868_1001601731 467
595 3300005530 Ga0070679_100187122 Ga0070679_1001871222 467
596 3300009093 Ga0105240_10006894 Ga0105240_100068945 467
597 3300009093 Ga0105240_10012199 Ga0105240_100121994 467
598 3300010375 Ga0105239_10001910 Ga0105239_1000191019 467
599 3300013104 Ga0157370_10001484 Ga0157370_1000148416 467
600 3300013104 Ga0157370_10008150 Ga0157370_100081506 467
601 3300013296 Ga0157374_10073560 Ga0157374_100735602 467
602 3300013296 Ga0157374_10120640 Ga0157374_101206402 467
603 3300013306 Ga0163162_10198327 Ga0163162_101983272 467
604 3300013306 Ga0163162_10345368 Ga0163162_103453681 467
605 3300013307 Ga0157372_10000747 Ga0157372_1000074714 467
606 3300013307 Ga0157372_10003494 Ga0157372_100034942 467
607 3300025914 Ga0207671_10050115 Ga0207671_100501152 467
608 3300025944 Ga0207661_10200500 Ga0207661_102005002 467
609 3300028794 Ga0307515_10000031 Ga0307515_1000003152 467
610 3300031507 Ga0307509_10080677 Ga0307509_100806773 467
611 3300037466 Ga0395898_0072758 Ga0395898_0072758_120_1556 467
612 3300041406 Ga0439439_0009758 Ga0439439_0009758_498_1922 467
613 3300042014 Ga0439457_000442 Ga0439457_000442_2800_4224 467
614 3300044656 Ga0466969_0000106 Ga0466969_0000106_9509_10930 467
615 3300044658 Ga0466972_0000001 Ga0466972_0000001_171881_173302 467
616 3300044684 Ga0466966_0094807 Ga0466966_0094807_363_1784 467
617 3300044765 Ga0466970_0007288 Ga0466970_0007288_1779_3200 467
618 3300044901 Ga0466960_0034612 Ga0466960_0034612_230_1633 467
619 3300045049 Ga0466959_0000003 Ga0466959_0000003_235528_236949 467
620 3300046616 Ga0495668_0004630 Ga0495668_0004630_2706_4109 467
621 3300049571 Ga0501034_0178258 Ga0501034_0178258_141_1562 467
622 3300049581 Ga0501047_0098219 Ga0501047_0098219_80_1501 467
623 3300049705 Ga0501225_0004749 Ga0501225_0004749_454_1878 467
624 3300050005 Ga0501284_00001 Ga0501284_00001_46119_47522 467
625 3300053092 Ga0500583_0000019 Ga0500583_0000019_6949_8373 467
626 3300053092 Ga0500583_0001215 Ga0500583_0001215_5904_7328 467
627 3300053730 Ga0500645_007614 Ga0500645_007614_1574_2977 467
628 iso_pu_bacteria 2884791551 2884796625 467
629 3300005327 Ga0070658_10185855 Ga0070658_101858552 468
630 3300005337 Ga0070682_100000012 Ga0070682_100000012195 468
631 3300049742 Ga0501080_0182078 Ga0501080_0182078_41_1465 468
632 3300005563 Ga0068855_100002019 Ga0068855_10000201913 469
633 3300006237 Ga0097621_100151103 Ga0097621_1001511032 469
634 3300006358 Ga0068871_100029438 Ga0068871_1000294385 469
635 3300009545 Ga0105237_10107217 Ga0105237_101072172 469
636 3300013297 Ga0157378_10033363 Ga0157378_100333633 469
637 3300025949 Ga0207667_10009325 Ga0207667_1000932513 469
638 3300026116 Ga0207674_10043129 Ga0207674_100431294 469
639 3300042876 Ga0451577_0006510 Ga0451577_0006510_8741_10153 469
640 3300042876 Ga0451577_0135154 Ga0451577_0135154_51_1565 469
641 3300049581 Ga0501047_0039157 Ga0501047_0039157_3029_4459 469
642 3300049654 Ga0501207_000033 Ga0501207_000033_1797_3380 469
643 3300049669 Ga0501235_000540 Ga0501235_000540_1260_2843 469
644 3300049688 Ga0501259_000165 Ga0501259_000165_7202_8785 469
645 3300049705 Ga0501225_0002749 Ga0501225_0002749_1586_3169 469
646 3300049707 Ga0501234_000488 Ga0501234_000488_4475_6058 469
647 3300049708 Ga0501245_001209 Ga0501245_001209_92_1675 469
648 3300049823 Ga0501044_0001914 Ga0501044_0001914_6083_7513 469
649 3300006195 Ga0075366_10011536 Ga0075366_100115363 470
650 3300044712 Ga0453684_0044988 Ga0453684_0044988_1073_2551 470
651 3300053090 Ga0500646_0001999 Ga0500646_0001999_1379_2815 470
652 3300005459 Ga0068867_100042475 Ga0068867_1000424751 471
653 3300014968 Ga0157379_10199267 Ga0157379_101992672 471
654 3300026089 Ga0207648_10207726 Ga0207648_102077261 471
655 3300044712 Ga0453684_0009369 Ga0453684_0009369_4484_5947 471
656 3300044712 Ga0453684_0073733 Ga0453684_0073733_1726_3261 471
657 3300003320 rootH2_10026278 rootH2_100262784 472
658 3300005578 Ga0068854_100155596 Ga0068854_1001555962 472
659 3300006358 Ga0068871_100138060 Ga0068871_1001380602 472
660 3300009147 Ga0114129_10001630 Ga0114129_1000163019 472
661 3300013104 Ga0157370_10013389 Ga0157370_100133896 472
662 3300037471 Ga0395905_0009119 Ga0395905_0009119_5893_7410 472
663 3300038443 Ga0395901_0013422 Ga0395901_0013422_3243_4760 472
664 3300005365 Ga0070688_100013517 Ga0070688_1000135172 473
665 3300013102 Ga0157371_10025139 Ga0157371_100251391 473
666 3300025936 Ga0207670_10114727 Ga0207670_101147272 473
667 3300044735 Ga0466968_0013585 Ga0466968_0013585_405_1877 474
668 3300049586 Ga0501070_0087030 Ga0501070_0087030_888_2381 474
669 3300053108 Ga0500562_000024 Ga0500562_000024_63489_64958 474
670 3300053156 Ga0500622_0000353 Ga0500622_0000353_40764_42233 474
671 3300053730 Ga0500645_003247 Ga0500645_003247_3378_4847 474
672 3300005331 Ga0070670_100119985 Ga0070670_1001199852 476
673 3300025302 Ga0207426_1000105 Ga0207426_100010525 476
674 3300049521 Ga0501298_000451 Ga0501298_000451_3512_5158 476
675 3300049569 Ga0501032_0002685 Ga0501032_0002685_6508_8013 476
676 3300049571 Ga0501034_0083979 Ga0501034_0083979_1416_2921 476
677 3300049572 Ga0501036_0001672 Ga0501036_0001672_8350_9855 476
678 3300049574 Ga0501038_0029560 Ga0501038_0029560_1806_3311 476
679 3300049581 Ga0501047_0018063 Ga0501047_0018063_4137_5642 476
680 3300049586 Ga0501070_0008280 Ga0501070_0008280_4019_5524 476
681 3300049589 Ga0501073_0008525 Ga0501073_0008525_266_1771 476
682 3300049590 Ga0501074_0013058 Ga0501074_0013058_2989_4494 476
683 3300049651 Ga0501201_000672 Ga0501201_000672_1329_2975 476
684 3300049661 Ga0501217_000032 Ga0501217_000032_6392_8038 476
685 3300049675 Ga0501243_000061 Ga0501243_000061_7820_9466 476
686 3300049690 Ga0501261_000807 Ga0501261_000807_413_2059 476
687 3300049822 Ga0501035_0018229 Ga0501035_0018229_3899_5404 476
688 3300025914 Ga0207671_10095143 Ga0207671_100951431 478
689 3300013297 Ga0157378_10041733 Ga0157378_100417332 479
690 iso_pu_bacteria 2818991460 2819676768 479
691 3300047320 Ga0495672_0010270 Ga0495672_0010270_2007_3605 480
692 3300002987 JGI25159J45721_1010521 JGI25159J45721_10105212 483
693 3300003323 rootH1_10007795 rootH1_1000779534 483
694 3300003354 JGI25160J50197_1017419 JGI25160J50197_10174192 483
695 3300005577 Ga0068857_100032358 Ga0068857_1000323582 483
696 3300025208 Ga0209436_101421 Ga0209436_1014216 483
697 3300025284 Ga0209130_1005289 Ga0209130_10052892 483
698 3300025302 Ga0207426_1000033 Ga0207426_100003388 483

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05958

tRNA_U5-meth_tr

tRNA (Uracil-5-)-methyltransferase

292

545

0.87

PF05175

MTS

Methyltransferase small domain

389

495

0.8

PF13847

Methyltransf_31

Methyltransferase domain

396

533

0.76

PF02475

Met_10

Met-10+ like-protein

296

494

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj1-assembly1.cif.gz_A crystal structure of sprlmcd 0.918 15 482
5xj1-assembly1.cif.gz_A crystal structure of sprlmcd 0.9122 15 482
5zq8-assembly1.cif.gz_B crystal structure of sprlmcd with u747 stemloop rna 0.9113 15 483
5zq8-assembly1.cif.gz_B crystal structure of sprlmcd with u747 stemloop rna 0.9056 15 483
1uwv-assembly1.cif.gz_A crystal structure of ruma, the iron-sulfur cluster containing e. coli 23s ribosomal rna 5-methyluridine methyltransferase 0.889 18 479
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9067 329 405 3.40.50.150
af_Q96GJ1_309_485_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9046 300 444 3.40.50.150
2jjqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9013 307 477 3.40.50.150
1uwvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8962 311 479 3.40.50.150
af_Q4DAH6_383_557_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8961 317 476 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A519TPZ5-F1-model_v4 23S rRNA (Uracil-5-)-methyltransferase RumA 0.9889 371 480 GO:0070041
GO:0070475
AF-A0A2P7TKV7-F1-model_v4 23S rRNA (Uracil(1939)-C(5))-methyltransferase RlmD 0.9821 15 480 GO:0070041
GO:0070475
AF-A0A1A9I6H7-F1-model_v4 23S rRNA (Uracil-5-)-methyltransferase RumA 0.9816 11 480 GO:0070041
GO:0070475
AF-A0A519TPZ5-F1-model_v4 23S rRNA (Uracil-5-)-methyltransferase RumA 0.98 371 480 GO:0070041
GO:0070475
AF-A0A1V3U5X0-F1-model_v4 23S rRNA (Uracil-5-)-methyltransferase RumA 0.978 14 481 GO:0070041
GO:0070475

Feature Viewer

pLDDT pTM Quality
92.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map