F475983
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 289 | 687 | 470 |
Family's Representative Sequence
| Representative Sequence | 3300049521|Ga0501298_000451|Ga0501298_000451_3512_5158 |
| Length | 548 |
| Sequence | LELKTLAIVKGQLQTKKYFYSVRRNKSIVLEKVLVEDYAAEGKSLARWEGKVIFIENVVPGDIVDIRLRKNKKDWAEGYPIQFHSYSKQRVQPFCQHFGVCGGCQWQMLPYNLQLVYKQQQVYDNLKRIGKIPLPQFLPIAGAHETKFYRNKLEYTFSTKEYTPEKPNSTTHYNLPIEPIQTQKQVPTQFSPITEVTTRQNQFKQETFNNNNEAGISAPFIAGQTRSPQGDLREAVLGFHAKGFFDKVVNIQKCWLQHEPTNELRNSLRDFAKKNEISFYDIRAHKGLLRNMQVRVCTTGEIMVNVIFGEDKKKEITKILEFIAQQFPQITTLLYTINLKMNDSLQDQQPIVYKGKGHIIEKLENFEFKIGPKSFFQTNTRQAEKLYQITRDFAELNGSQVVYDLYCGTGSIGIFCSKRAKKIIGVEAIEEAVSDAKENAVLNKIDHAQFFKGDVVEICNDVFFAEHGQPDVLITDPPRAGMHEKLVKKILEIEAPLVVYVSCNPATQARDLNLLDEKYMVTKVQPVDMFPHTHHIENVVQLKLKRKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 4 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 5 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 6 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 7 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 8 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 9 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 10 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 11 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 185 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 199 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 200 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 201 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 202 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 254 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 255 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 257 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 269 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 280 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 281 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 283 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 284 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 287 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 288 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 289 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 0 |
| Isolates | 1.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.3 |
| Nodule | 0 |
| Rhizoplane | 0.29 |
| Rhizosphere | 92.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1010521 | 3300002987 | Bacteria | 2348 |
| 2 | JGI25406J46586_10000886 | 3300003203 | Bacteria | 14114 |
| 3 | rootH1_10076736 | 3300003316 | Unclassified | 2059 |
| 4 | rootH2_10006463 | 3300003320 | Bacteria | 45674 |
| 5 | rootH2_10012033 | 3300003320 | Bacteria | 19273 |
| 6 | rootH2_10026278 | 3300003320 | Bacteria | 14769 |
| 7 | rootH2_10203242 | 3300003320 | Bacteria | 4509 |
| 8 | rootH1_10004992 | 3300003323 | Bacteria | 2005 |
| 9 | rootH1_10007795 | 3300003323 | Bacteria | 36145 |
| 10 | rootH1_10020501 | 3300003323 | Bacteria | 26877 |
| 11 | rootH1_10116615 | 3300003323 | Bacteria | 10973 |
| 12 | rootH1_10211012 | 3300003323 | Bacteria | 7229 |
| 13 | JGI25160J50197_1017419 | 3300003354 | Bacteria | 2276 |
| 14 | Ga0055531_10000401 | 3300003794 | Bacteria | 41633 |
| 15 | Ga0065704_10072259 | 3300005289 | Bacteria | 8833 |
| 16 | Ga0065704_10130134 | 3300005289 | Bacteria | 1640 |
| 17 | Ga0065712_10005130 | 3300005290 | Bacteria | 3778 |
| 18 | Ga0070658_10008208 | 3300005327 | Bacteria | 8395 |
| 19 | Ga0070658_10019578 | 3300005327 | Bacteria | 5419 |
| 20 | Ga0070658_10185855 | 3300005327 | Bacteria | 1750 |
| 21 | Ga0070676_10000167 | 3300005328 | Bacteria | 26643 |
| 22 | Ga0070676_10017619 | 3300005328 | Bacteria | 3952 |
| 23 | Ga0070683_100002896 | 3300005329 | Bacteria | 13742 |
| 24 | Ga0070683_100008183 | 3300005329 | Bacteria | 8884 |
| 25 | Ga0070683_100050048 | 3300005329 | Unclassified | 3866 |
| 26 | Ga0070683_100210155 | 3300005329 | Bacteria | 1849 |
| 27 | Ga0070690_100045473 | 3300005330 | Bacteria | 2788 |
| 28 | Ga0070670_100018086 | 3300005331 | Bacteria | 6050 |
| 29 | Ga0070670_100085435 | 3300005331 | Unclassified | 2711 |
| 30 | Ga0070670_100119985 | 3300005331 | Bacteria | 2268 |
| 31 | Ga0068869_100040043 | 3300005334 | Bacteria | 3349 |
| 32 | Ga0068869_100061094 | 3300005334 | Bacteria | 2763 |
| 33 | Ga0068869_100067524 | 3300005334 | Bacteria | 2638 |
| 34 | Ga0068869_100130571 | 3300005334 | Bacteria | 1931 |
| 35 | Ga0070666_10000064 | 3300005335 | Bacteria | 79823 |
| 36 | Ga0070666_10000512 | 3300005335 | Bacteria | 23407 |
| 37 | Ga0070666_10037855 | 3300005335 | Bacteria | 3209 |
| 38 | Ga0070666_10118142 | 3300005335 | Bacteria | 1837 |
| 39 | Ga0070680_100004861 | 3300005336 | Bacteria | 10113 |
| 40 | Ga0070680_100062841 | 3300005336 | Bacteria | 3041 |
| 41 | Ga0070682_100000012 | 3300005337 | Bacteria | 265658 |
| 42 | Ga0070682_100020387 | 3300005337 | Bacteria | 3899 |
| 43 | Ga0068868_100004051 | 3300005338 | Bacteria | 10214 |
| 44 | Ga0068868_100032460 | 3300005338 | Bacteria | 4017 |
| 45 | Ga0068868_100160173 | 3300005338 | Bacteria | 1858 |
| 46 | Ga0070660_100013009 | 3300005339 | Bacteria | 5955 |
| 47 | Ga0070689_100011333 | 3300005340 | Bacteria | 6382 |
| 48 | Ga0070691_10004449 | 3300005341 | Bacteria | 6366 |
| 49 | Ga0070687_100005317 | 3300005343 | Bacteria | 5204 |
| 50 | Ga0070687_100020594 | 3300005343 | Bacteria | 3086 |
| 51 | Ga0070661_100005273 | 3300005344 | Bacteria | 8906 |
| 52 | Ga0070661_100022229 | 3300005344 | Bacteria | 4540 |
| 53 | Ga0070661_100124342 | 3300005344 | Bacteria | 1934 |
| 54 | Ga0070668_100012112 | 3300005347 | Bacteria | 6423 |
| 55 | Ga0070669_100001547 | 3300005353 | Bacteria | 16634 |
| 56 | Ga0070669_100059023 | 3300005353 | Bacteria | 2817 |
| 57 | Ga0070675_100002115 | 3300005354 | Bacteria | 14665 |
| 58 | Ga0070675_100011337 | 3300005354 | Bacteria | 6977 |
| 59 | Ga0070675_100035094 | 3300005354 | Bacteria | 4074 |
| 60 | Ga0070675_100145471 | 3300005354 | Bacteria | 2029 |
| 61 | Ga0070671_100003764 | 3300005355 | Bacteria | 11909 |
| 62 | Ga0070671_100033340 | 3300005355 | Unclassified | 4258 |
| 63 | Ga0070671_100036570 | 3300005355 | Unclassified | 4072 |
| 64 | Ga0070671_100095081 | 3300005355 | Bacteria | 2498 |
| 65 | Ga0070671_100176340 | 3300005355 | Bacteria | 1809 |
| 66 | Ga0070674_100014555 | 3300005356 | Bacteria | 4893 |
| 67 | Ga0070673_100003256 | 3300005364 | Bacteria | 10073 |
| 68 | Ga0070673_100014566 | 3300005364 | Bacteria | 5483 |
| 69 | Ga0070673_100017552 | 3300005364 | Bacteria | 5094 |
| 70 | Ga0070673_100027220 | 3300005364 | Bacteria | 4236 |
| 71 | Ga0070673_100045099 | 3300005364 | Bacteria | 3417 |
| 72 | Ga0070673_100064542 | 3300005364 | Bacteria | 2918 |
| 73 | Ga0070673_100089652 | 3300005364 | Bacteria | 2511 |
| 74 | Ga0070688_100008797 | 3300005365 | Bacteria | 5495 |
| 75 | Ga0070688_100013517 | 3300005365 | Bacteria | 4606 |
| 76 | Ga0070659_100002166 | 3300005366 | Bacteria | 13998 |
| 77 | Ga0070659_100007353 | 3300005366 | Bacteria | 8002 |
| 78 | Ga0070659_100015031 | 3300005366 | Bacteria | 5791 |
| 79 | Ga0070667_100023384 | 3300005367 | Bacteria | 5126 |
| 80 | Ga0070667_100028206 | 3300005367 | Bacteria | 4673 |
| 81 | Ga0070667_100029961 | 3300005367 | Bacteria | 4538 |
| 82 | Ga0070667_100046048 | 3300005367 | Bacteria | 3668 |
| 83 | Ga0070667_100114295 | 3300005367 | Bacteria | 2343 |
| 84 | Ga0070667_100140172 | 3300005367 | Bacteria | 2117 |
| 85 | Ga0070667_100213037 | 3300005367 | Bacteria | 1718 |
| 86 | Ga0070714_100000081 | 3300005435 | Bacteria | 82594 |
| 87 | Ga0070663_100065626 | 3300005455 | Bacteria | 2628 |
| 88 | Ga0070663_100077147 | 3300005455 | Bacteria | 2438 |
| 89 | Ga0070678_100008332 | 3300005456 | Bacteria | 6207 |
| 90 | Ga0070662_100003263 | 3300005457 | Bacteria | 10092 |
| 91 | Ga0070662_100006273 | 3300005457 | Bacteria | 7660 |
| 92 | Ga0070662_100034440 | 3300005457 | Bacteria | 3571 |
| 93 | Ga0070662_100067894 | 3300005457 | Bacteria | 2619 |
| 94 | Ga0070662_100140022 | 3300005457 | Bacteria | 1874 |
| 95 | Ga0070681_10011816 | 3300005458 | Bacteria | 8656 |
| 96 | Ga0068867_100000714 | 3300005459 | Bacteria | 22153 |
| 97 | Ga0068867_100037807 | 3300005459 | Bacteria | 3511 |
| 98 | Ga0068867_100042475 | 3300005459 | Bacteria | 3326 |
| 99 | Ga0068867_100121304 | 3300005459 | Bacteria | 2021 |
| 100 | Ga0070685_10052342 | 3300005466 | Bacteria | 2362 |
| 101 | Ga0070707_100263899 | 3300005468 | Unclassified | 1675 |
| 102 | Ga0070698_100004403 | 3300005471 | Bacteria | 15475 |
| 103 | Ga0070698_100077619 | 3300005471 | Unclassified | 3320 |
| 104 | Ga0070679_100042529 | 3300005530 | Bacteria | 4525 |
| 105 | Ga0070679_100187122 | 3300005530 | Bacteria | 2040 |
| 106 | Ga0070684_100000042 | 3300005535 | Bacteria | 89896 |
| 107 | Ga0070684_100009042 | 3300005535 | Bacteria | 7830 |
| 108 | Ga0070684_100015194 | 3300005535 | Bacteria | 6261 |
| 109 | Ga0068853_100004615 | 3300005539 | Bacteria | 10690 |
| 110 | Ga0068853_100017476 | 3300005539 | Bacteria | 5918 |
| 111 | Ga0068853_100025049 | 3300005539 | Bacteria | 5006 |
| 112 | Ga0070672_100010987 | 3300005543 | Bacteria | 6300 |
| 113 | Ga0070672_100100565 | 3300005543 | Bacteria | 2345 |
| 114 | Ga0070672_100145047 | 3300005543 | Bacteria | 1961 |
| 115 | Ga0070686_100035991 | 3300005544 | Bacteria | 3061 |
| 116 | Ga0068855_100002019 | 3300005563 | Bacteria | 25173 |
| 117 | Ga0068855_100002248 | 3300005563 | Bacteria | 23863 |
| 118 | Ga0068855_100004845 | 3300005563 | Bacteria | 16427 |
| 119 | Ga0068855_100007429 | 3300005563 | Bacteria | 13268 |
| 120 | Ga0068855_100015455 | 3300005563 | Bacteria | 9189 |
| 121 | Ga0070664_100000341 | 3300005564 | Bacteria | 34094 |
| 122 | Ga0070664_100002301 | 3300005564 | Bacteria | 15347 |
| 123 | Ga0070664_100054863 | 3300005564 | Bacteria | 3383 |
| 124 | Ga0070664_100063257 | 3300005564 | Unclassified | 3155 |
| 125 | Ga0070664_100203742 | 3300005564 | Bacteria | 1766 |
| 126 | Ga0070664_100257117 | 3300005564 | Bacteria | 1571 |
| 127 | Ga0068857_100000652 | 3300005577 | Bacteria | 25600 |
| 128 | Ga0068857_100002017 | 3300005577 | Bacteria | 16457 |
| 129 | Ga0068857_100011464 | 3300005577 | Bacteria | 7716 |
| 130 | Ga0068857_100032358 | 3300005577 | Bacteria | 4624 |
| 131 | Ga0068854_100041746 | 3300005578 | Bacteria | 3243 |
| 132 | Ga0068854_100155596 | 3300005578 | Unclassified | 1766 |
| 133 | Ga0068856_100069438 | 3300005614 | Unclassified | 3484 |
| 134 | Ga0068852_100000391 | 3300005616 | Bacteria | 29415 |
| 135 | Ga0068852_100000706 | 3300005616 | Bacteria | 21835 |
| 136 | Ga0068852_100025764 | 3300005616 | Bacteria | 4770 |
| 137 | Ga0068852_100069937 | 3300005616 | Bacteria | 3078 |
| 138 | Ga0068852_100085278 | 3300005616 | Bacteria | 2813 |
| 139 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 140 | Ga0068859_100010235 | 3300005617 | Bacteria | 9439 |
| 141 | Ga0068859_100026078 | 3300005617 | Bacteria | 5863 |
| 142 | Ga0068859_100033423 | 3300005617 | Bacteria | 5164 |
| 143 | Ga0068859_100172480 | 3300005617 | Bacteria | 2244 |
| 144 | Ga0068859_100204940 | 3300005617 | Bacteria | 2057 |
| 145 | Ga0068859_100228100 | 3300005617 | Bacteria | 1950 |
| 146 | Ga0068859_100299453 | 3300005617 | Bacteria | 1701 |
| 147 | Ga0068864_100003504 | 3300005618 | Bacteria | 12970 |
| 148 | Ga0068864_100004147 | 3300005618 | Bacteria | 11896 |
| 149 | Ga0068861_100117666 | 3300005719 | Bacteria | 2139 |
| 150 | Ga0068851_10002509 | 3300005834 | Bacteria | 8069 |
| 151 | Ga0068870_10007082 | 3300005840 | Bacteria | 4983 |
| 152 | Ga0068863_100003550 | 3300005841 | Bacteria | 15382 |
| 153 | Ga0068863_100045682 | 3300005841 | Bacteria | 4157 |
| 154 | Ga0068863_100114740 | 3300005841 | Bacteria | 2566 |
| 155 | Ga0068858_100027838 | 3300005842 | Bacteria | 5251 |
| 156 | Ga0068858_100032949 | 3300005842 | Bacteria | 4811 |
| 157 | Ga0068858_100035990 | 3300005842 | Bacteria | 4590 |
| 158 | Ga0068858_100056199 | 3300005842 | Bacteria | 3638 |
| 159 | Ga0068858_100088996 | 3300005842 | Bacteria | 2873 |
| 160 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 161 | Ga0068860_100023659 | 3300005843 | Bacteria | 5937 |
| 162 | Ga0068860_100069929 | 3300005843 | Bacteria | 3337 |
| 163 | Ga0068860_100113495 | 3300005843 | Bacteria | 2591 |
| 164 | Ga0068862_100080167 | 3300005844 | Bacteria | 2831 |
| 165 | Ga0081540_1020250 | 3300005983 | Bacteria | 4009 |
| 166 | Ga0081539_10000284 | 3300005985 | Bacteria | 114545 |
| 167 | Ga0070715_10046519 | 3300006163 | Unclassified | 1845 |
| 168 | Ga0075366_10011536 | 3300006195 | Bacteria | 4989 |
| 169 | Ga0097621_100003397 | 3300006237 | Bacteria | 10963 |
| 170 | Ga0097621_100003853 | 3300006237 | Bacteria | 10388 |
| 171 | Ga0097621_100006293 | 3300006237 | Bacteria | 8423 |
| 172 | Ga0097621_100026494 | 3300006237 | Bacteria | 4548 |
| 173 | Ga0097621_100058022 | 3300006237 | Bacteria | 3167 |
| 174 | Ga0097621_100129324 | 3300006237 | Bacteria | 2148 |
| 175 | Ga0097621_100151103 | 3300006237 | Bacteria | 1991 |
| 176 | Ga0068871_100002146 | 3300006358 | Bacteria | 13383 |
| 177 | Ga0068871_100016497 | 3300006358 | Bacteria | 5564 |
| 178 | Ga0068871_100020339 | 3300006358 | Bacteria | 5084 |
| 179 | Ga0068871_100029438 | 3300006358 | Bacteria | 4313 |
| 180 | Ga0068871_100138060 | 3300006358 | Bacteria | 2071 |
| 181 | Ga0075428_100014704 | 3300006844 | Bacteria | 8692 |
| 182 | Ga0075428_100039130 | 3300006844 | Bacteria | 5219 |
| 183 | Ga0075430_100086919 | 3300006846 | Bacteria | 2616 |
| 184 | Ga0075431_100011173 | 3300006847 | Bacteria | 9040 |
| 185 | Ga0075431_100011553 | 3300006847 | Bacteria | 8907 |
| 186 | Ga0075429_100001064 | 3300006880 | Bacteria | 21975 |
| 187 | Ga0075429_100014498 | 3300006880 | Bacteria | 6831 |
| 188 | Ga0075429_100147448 | 3300006880 | Unclassified | 2060 |
| 189 | Ga0068865_100008145 | 3300006881 | Bacteria | 6467 |
| 190 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 191 | Ga0097620_100010233 | 3300006931 | Bacteria | 9439 |
| 192 | Ga0097620_100026077 | 3300006931 | Bacteria | 5863 |
| 193 | Ga0097620_100033422 | 3300006931 | Bacteria | 5164 |
| 194 | Ga0097620_100172496 | 3300006931 | Bacteria | 2244 |
| 195 | Ga0097620_100204949 | 3300006931 | Bacteria | 2057 |
| 196 | Ga0097620_100228106 | 3300006931 | Bacteria | 1950 |
| 197 | Ga0097620_100299472 | 3300006931 | Bacteria | 1701 |
| 198 | Ga0105240_10000131 | 3300009093 | Bacteria | 154386 |
| 199 | Ga0105240_10000664 | 3300009093 | Bacteria | 63206 |
| 200 | Ga0105240_10006894 | 3300009093 | Bacteria | 16604 |
| 201 | Ga0105240_10012199 | 3300009093 | Bacteria | 11885 |
| 202 | Ga0105240_10015806 | 3300009093 | Bacteria | 10241 |
| 203 | Ga0105240_10024869 | 3300009093 | Bacteria | 7884 |
| 204 | Ga0105240_10088628 | 3300009093 | Bacteria | 3786 |
| 205 | Ga0105240_10090171 | 3300009093 | Bacteria | 3748 |
| 206 | Ga0111539_10002241 | 3300009094 | Bacteria | 25812 |
| 207 | Ga0111539_10014643 | 3300009094 | Bacteria | 9785 |
| 208 | Ga0111539_10032512 | 3300009094 | Bacteria | 6334 |
| 209 | Ga0111539_10201269 | 3300009094 | Bacteria | 2322 |
| 210 | Ga0105245_10033821 | 3300009098 | Bacteria | 4531 |
| 211 | Ga0105247_10004604 | 3300009101 | Bacteria | 8792 |
| 212 | Ga0114129_10001630 | 3300009147 | Bacteria | 30480 |
| 213 | Ga0114129_10011797 | 3300009147 | Bacteria | 12432 |
| 214 | Ga0114129_10076888 | 3300009147 | Bacteria | 4645 |
| 215 | Ga0105241_10000543 | 3300009174 | Bacteria | 28453 |
| 216 | Ga0105241_10002666 | 3300009174 | Bacteria | 13368 |
| 217 | Ga0105241_10154480 | 3300009174 | Bacteria | 1880 |
| 218 | Ga0105242_10009360 | 3300009176 | Bacteria | 7519 |
| 219 | Ga0105242_10021494 | 3300009176 | Bacteria | 5068 |
| 220 | Ga0105242_10035315 | 3300009176 | Bacteria | 4009 |
| 221 | Ga0105242_10062251 | 3300009176 | Bacteria | 3070 |
| 222 | Ga0105248_10033429 | 3300009177 | Bacteria | 5745 |
| 223 | Ga0105248_10112813 | 3300009177 | Bacteria | 3066 |
| 224 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 225 | Ga0105237_10006055 | 3300009545 | Bacteria | 13528 |
| 226 | Ga0105237_10009698 | 3300009545 | Bacteria | 10300 |
| 227 | Ga0105237_10014604 | 3300009545 | Bacteria | 8205 |
| 228 | Ga0105237_10018668 | 3300009545 | Bacteria | 7170 |
| 229 | Ga0105237_10057297 | 3300009545 | Bacteria | 3900 |
| 230 | Ga0105237_10107217 | 3300009545 | Bacteria | 2785 |
| 231 | Ga0105238_10001637 | 3300009551 | Bacteria | 22439 |
| 232 | Ga0105238_10031735 | 3300009551 | Bacteria | 5376 |
| 233 | Ga0105238_10149535 | 3300009551 | Bacteria | 2311 |
| 234 | Ga0105238_10158299 | 3300009551 | Bacteria | 2240 |
| 235 | Ga0105249_10011067 | 3300009553 | Bacteria | 7927 |
| 236 | Ga0105249_10019335 | 3300009553 | Bacteria | 6075 |
| 237 | Ga0105249_10063526 | 3300009553 | Bacteria | 3392 |
| 238 | Ga0105249_10075831 | 3300009553 | Bacteria | 3115 |
| 239 | Ga0105239_10000488 | 3300010375 | Bacteria | 57554 |
| 240 | Ga0105239_10001713 | 3300010375 | Bacteria | 28869 |
| 241 | Ga0105239_10001910 | 3300010375 | Bacteria | 27144 |
| 242 | Ga0105239_10008508 | 3300010375 | Bacteria | 11666 |
| 243 | Ga0105239_10029181 | 3300010375 | Bacteria | 6065 |
| 244 | Ga0105239_10039875 | 3300010375 | Bacteria | 5145 |
| 245 | Ga0105239_10197445 | 3300010375 | Unclassified | 2253 |
| 246 | Ga0105239_10254145 | 3300010375 | Bacteria | 1974 |
| 247 | Ga0105246_10009987 | 3300011119 | Bacteria | 5856 |
| 248 | Ga0105246_10030859 | 3300011119 | Bacteria | 3543 |
| 249 | Ga0157373_10009333 | 3300013100 | Bacteria | 7249 |
| 250 | Ga0157371_10002424 | 3300013102 | Bacteria | 17819 |
| 251 | Ga0157371_10004079 | 3300013102 | Bacteria | 12910 |
| 252 | Ga0157371_10025139 | 3300013102 | Bacteria | 4344 |
| 253 | Ga0157371_10034892 | 3300013102 | Unclassified | 3607 |
| 254 | Ga0157371_10121467 | 3300013102 | Bacteria | 1858 |
| 255 | Ga0157370_10001484 | 3300013104 | Bacteria | 29041 |
| 256 | Ga0157370_10008150 | 3300013104 | Bacteria | 11332 |
| 257 | Ga0157370_10011871 | 3300013104 | Bacteria | 9087 |
| 258 | Ga0157370_10012794 | 3300013104 | Bacteria | 8675 |
| 259 | Ga0157370_10013389 | 3300013104 | Bacteria | 8450 |
| 260 | Ga0157370_10021834 | 3300013104 | Bacteria | 6376 |
| 261 | Ga0157370_10031180 | 3300013104 | Bacteria | 5218 |
| 262 | Ga0157369_10022017 | 3300013105 | Bacteria | 7123 |
| 263 | Ga0157369_10205240 | 3300013105 | Bacteria | 2067 |
| 264 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 265 | Ga0157374_10002190 | 3300013296 | Bacteria | 16470 |
| 266 | Ga0157374_10002453 | 3300013296 | Bacteria | 15652 |
| 267 | Ga0157374_10013112 | 3300013296 | Bacteria | 7230 |
| 268 | Ga0157374_10065603 | 3300013296 | Bacteria | 3410 |
| 269 | Ga0157374_10073560 | 3300013296 | Bacteria | 3226 |
| 270 | Ga0157374_10075274 | 3300013296 | Bacteria | 3190 |
| 271 | Ga0157374_10092994 | 3300013296 | Bacteria | 2878 |
| 272 | Ga0157374_10120640 | 3300013296 | Bacteria | 2530 |
| 273 | Ga0157378_10019445 | 3300013297 | Bacteria | 5970 |
| 274 | Ga0157378_10026281 | 3300013297 | Bacteria | 5132 |
| 275 | Ga0157378_10033363 | 3300013297 | Bacteria | 4550 |
| 276 | Ga0157378_10041733 | 3300013297 | Bacteria | 4070 |
| 277 | Ga0163162_10000725 | 3300013306 | Bacteria | 30582 |
| 278 | Ga0163162_10001913 | 3300013306 | Bacteria | 19626 |
| 279 | Ga0163162_10003339 | 3300013306 | Bacteria | 15355 |
| 280 | Ga0163162_10005264 | 3300013306 | Bacteria | 12478 |
| 281 | Ga0163162_10025269 | 3300013306 | Bacteria | 5869 |
| 282 | Ga0163162_10043198 | 3300013306 | Bacteria | 4513 |
| 283 | Ga0163162_10107185 | 3300013306 | Bacteria | 2889 |
| 284 | Ga0163162_10198327 | 3300013306 | Bacteria | 2136 |
| 285 | Ga0163162_10345368 | 3300013306 | Bacteria | 1621 |
| 286 | Ga0157372_10000747 | 3300013307 | Bacteria | 35352 |
| 287 | Ga0157372_10002589 | 3300013307 | Bacteria | 19570 |
| 288 | Ga0157372_10003494 | 3300013307 | Bacteria | 16941 |
| 289 | Ga0157372_10007573 | 3300013307 | Bacteria | 11545 |
| 290 | Ga0157372_10008586 | 3300013307 | Bacteria | 10856 |
| 291 | Ga0157372_10009489 | 3300013307 | Bacteria | 10348 |
| 292 | Ga0157372_10009879 | 3300013307 | Bacteria | 10150 |
| 293 | Ga0157372_10013017 | 3300013307 | Bacteria | 8871 |
| 294 | Ga0157372_10067344 | 3300013307 | Bacteria | 4023 |
| 295 | Ga0157372_10074551 | 3300013307 | Bacteria | 3827 |
| 296 | Ga0157375_10000422 | 3300013308 | Bacteria | 38347 |
| 297 | Ga0157375_10004945 | 3300013308 | Bacteria | 11594 |
| 298 | Ga0157375_10008894 | 3300013308 | Bacteria | 8789 |
| 299 | Ga0157375_10021159 | 3300013308 | Bacteria | 5958 |
| 300 | Ga0157375_10027810 | 3300013308 | Bacteria | 5291 |
| 301 | Ga0157375_10041750 | 3300013308 | Bacteria | 4432 |
| 302 | Ga0157375_10091529 | 3300013308 | Bacteria | 3103 |
| 303 | Ga0157375_10127353 | 3300013308 | Bacteria | 2663 |
| 304 | Ga0157375_10211978 | 3300013308 | Bacteria | 2095 |
| 305 | Ga0163163_10000526 | 3300014325 | Bacteria | 34147 |
| 306 | Ga0163163_10000732 | 3300014325 | Bacteria | 27929 |
| 307 | Ga0163163_10000952 | 3300014325 | Bacteria | 24583 |
| 308 | Ga0163163_10042459 | 3300014325 | Bacteria | 4454 |
| 309 | Ga0163163_10069982 | 3300014325 | Bacteria | 3494 |
| 310 | Ga0163163_10198533 | 3300014325 | Bacteria | 2054 |
| 311 | Ga0163163_10371814 | 3300014325 | Unclassified | 1487 |
| 312 | Ga0157380_10005550 | 3300014326 | Bacteria | 8820 |
| 313 | Ga0157380_10010678 | 3300014326 | Bacteria | 6615 |
| 314 | Ga0157380_10020326 | 3300014326 | Unclassified | 4962 |
| 315 | Ga0157380_10039569 | 3300014326 | Bacteria | 3668 |
| 316 | Ga0157377_10044856 | 3300014745 | Bacteria | 2467 |
| 317 | Ga0157377_10115088 | 3300014745 | Bacteria | 1622 |
| 318 | Ga0157379_10001164 | 3300014968 | Bacteria | 21405 |
| 319 | Ga0157379_10002405 | 3300014968 | Bacteria | 15634 |
| 320 | Ga0157379_10039691 | 3300014968 | Bacteria | 4200 |
| 321 | Ga0157379_10160506 | 3300014968 | Bacteria | 2029 |
| 322 | Ga0157379_10199267 | 3300014968 | Bacteria | 1810 |
| 323 | Ga0157376_10000762 | 3300014969 | Bacteria | 21000 |
| 324 | Ga0157376_10001116 | 3300014969 | Bacteria | 17609 |
| 325 | Ga0157376_10005617 | 3300014969 | Bacteria | 8774 |
| 326 | Ga0157376_10089660 | 3300014969 | Bacteria | 2659 |
| 327 | Ga0182005_1000043 | 3300015265 | Bacteria | 140285 |
| 328 | Ga0163161_10002456 | 3300017792 | Bacteria | 13233 |
| 329 | Ga0163161_10003176 | 3300017792 | Bacteria | 11587 |
| 330 | Ga0209436_101421 | 3300025208 | Bacteria | 8403 |
| 331 | Ga0209646_1003765 | 3300025246 | Bacteria | 2907 |
| 332 | Ga0209130_1005289 | 3300025284 | Bacteria | 4541 |
| 333 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 334 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 335 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 336 | Ga0207710_10001920 | 3300025900 | Bacteria | 9955 |
| 337 | Ga0207688_10018807 | 3300025901 | Bacteria | 3758 |
| 338 | Ga0207688_10077494 | 3300025901 | Bacteria | 1894 |
| 339 | Ga0207688_10080064 | 3300025901 | Bacteria | 1864 |
| 340 | Ga0207680_10000388 | 3300025903 | Bacteria | 21000 |
| 341 | Ga0207647_10000131 | 3300025904 | Bacteria | 58960 |
| 342 | Ga0207647_10008544 | 3300025904 | Bacteria | 7332 |
| 343 | Ga0207647_10009015 | 3300025904 | Bacteria | 7109 |
| 344 | Ga0207647_10009973 | 3300025904 | Bacteria | 6727 |
| 345 | Ga0207647_10068340 | 3300025904 | Bacteria | 2151 |
| 346 | Ga0207645_10001118 | 3300025907 | Bacteria | 22193 |
| 347 | Ga0207645_10007440 | 3300025907 | Bacteria | 7733 |
| 348 | Ga0207645_10019550 | 3300025907 | Unclassified | 4440 |
| 349 | Ga0207643_10009005 | 3300025908 | Bacteria | 5359 |
| 350 | Ga0207643_10014263 | 3300025908 | Bacteria | 4315 |
| 351 | Ga0207705_10009232 | 3300025909 | Bacteria | 7178 |
| 352 | Ga0207705_10053258 | 3300025909 | Bacteria | 2914 |
| 353 | Ga0207705_10088123 | 3300025909 | Bacteria | 2270 |
| 354 | Ga0207654_10001784 | 3300025911 | Bacteria | 11176 |
| 355 | Ga0207654_10004542 | 3300025911 | Bacteria | 7013 |
| 356 | Ga0207707_10004563 | 3300025912 | Bacteria | 12175 |
| 357 | Ga0207695_10000217 | 3300025913 | Bacteria | 155047 |
| 358 | Ga0207695_10001317 | 3300025913 | Bacteria | 42084 |
| 359 | Ga0207695_10001383 | 3300025913 | Bacteria | 41051 |
| 360 | Ga0207695_10002258 | 3300025913 | Bacteria | 28855 |
| 361 | Ga0207695_10019233 | 3300025913 | Bacteria | 7865 |
| 362 | Ga0207695_10020736 | 3300025913 | Bacteria | 7519 |
| 363 | Ga0207695_10078895 | 3300025913 | Bacteria | 3339 |
| 364 | Ga0207671_10001368 | 3300025914 | Bacteria | 28441 |
| 365 | Ga0207671_10001848 | 3300025914 | Bacteria | 23634 |
| 366 | Ga0207671_10006294 | 3300025914 | Bacteria | 10604 |
| 367 | Ga0207671_10008066 | 3300025914 | Bacteria | 8997 |
| 368 | Ga0207671_10011603 | 3300025914 | Bacteria | 7154 |
| 369 | Ga0207671_10050115 | 3300025914 | Bacteria | 3091 |
| 370 | Ga0207671_10095143 | 3300025914 | Bacteria | 2249 |
| 371 | Ga0207662_10030116 | 3300025918 | Bacteria | 3148 |
| 372 | Ga0207662_10042043 | 3300025918 | Bacteria | 2693 |
| 373 | Ga0207657_10017781 | 3300025919 | Bacteria | 6806 |
| 374 | Ga0207657_10038632 | 3300025919 | Unclassified | 4248 |
| 375 | Ga0207649_10114705 | 3300025920 | Bacteria | 1806 |
| 376 | Ga0207652_10000103 | 3300025921 | Bacteria | 91988 |
| 377 | Ga0207652_10006111 | 3300025921 | Bacteria | 9740 |
| 378 | Ga0207652_10029001 | 3300025921 | Bacteria | 4622 |
| 379 | Ga0207652_10033600 | 3300025921 | Bacteria | 4320 |
| 380 | Ga0207681_10002654 | 3300025923 | Bacteria | 11336 |
| 381 | Ga0207681_10034199 | 3300025923 | Bacteria | 3340 |
| 382 | Ga0207694_10013486 | 3300025924 | Bacteria | 6155 |
| 383 | Ga0207694_10026748 | 3300025924 | Unclassified | 4392 |
| 384 | Ga0207650_10000813 | 3300025925 | Bacteria | 23983 |
| 385 | Ga0207650_10069465 | 3300025925 | Unclassified | 2647 |
| 386 | Ga0207659_10044302 | 3300025926 | Bacteria | 3130 |
| 387 | Ga0207687_10037320 | 3300025927 | Bacteria | 3314 |
| 388 | Ga0207664_10000042 | 3300025929 | Bacteria | 154793 |
| 389 | Ga0207644_10030426 | 3300025931 | Bacteria | 3755 |
| 390 | Ga0207644_10039267 | 3300025931 | Bacteria | 3341 |
| 391 | Ga0207690_10005004 | 3300025932 | Bacteria | 7828 |
| 392 | Ga0207690_10073374 | 3300025932 | Unclassified | 2366 |
| 393 | Ga0207706_10003190 | 3300025933 | Bacteria | 15740 |
| 394 | Ga0207706_10054770 | 3300025933 | Bacteria | 3519 |
| 395 | Ga0207706_10085304 | 3300025933 | Bacteria | 2776 |
| 396 | Ga0207670_10021241 | 3300025936 | Bacteria | 4002 |
| 397 | Ga0207670_10114727 | 3300025936 | Bacteria | 1947 |
| 398 | Ga0207704_10011883 | 3300025938 | Bacteria | 4305 |
| 399 | Ga0207704_10023419 | 3300025938 | Bacteria | 3328 |
| 400 | Ga0207691_10000234 | 3300025940 | Bacteria | 54055 |
| 401 | Ga0207691_10012577 | 3300025940 | Bacteria | 8112 |
| 402 | Ga0207691_10020555 | 3300025940 | Bacteria | 6243 |
| 403 | Ga0207691_10058684 | 3300025940 | Bacteria | 3500 |
| 404 | Ga0207711_10133513 | 3300025941 | Bacteria | 2227 |
| 405 | Ga0207689_10001731 | 3300025942 | Bacteria | 20624 |
| 406 | Ga0207689_10002903 | 3300025942 | Bacteria | 15819 |
| 407 | Ga0207689_10003837 | 3300025942 | Bacteria | 13696 |
| 408 | Ga0207689_10018292 | 3300025942 | Bacteria | 5914 |
| 409 | Ga0207689_10039610 | 3300025942 | Bacteria | 3901 |
| 410 | Ga0207689_10048577 | 3300025942 | Bacteria | 3500 |
| 411 | Ga0207689_10068198 | 3300025942 | Bacteria | 2923 |
| 412 | Ga0207689_10125905 | 3300025942 | Unclassified | 2108 |
| 413 | Ga0207689_10185102 | 3300025942 | Bacteria | 1718 |
| 414 | Ga0207661_10015351 | 3300025944 | Bacteria | 5634 |
| 415 | Ga0207661_10015910 | 3300025944 | Bacteria | 5542 |
| 416 | Ga0207661_10034951 | 3300025944 | Bacteria | 3913 |
| 417 | Ga0207661_10122815 | 3300025944 | Bacteria | 2213 |
| 418 | Ga0207661_10130812 | 3300025944 | Unclassified | 2149 |
| 419 | Ga0207661_10200500 | 3300025944 | Unclassified | 1754 |
| 420 | Ga0207679_10001601 | 3300025945 | Bacteria | 14100 |
| 421 | Ga0207667_10001839 | 3300025949 | Bacteria | 26648 |
| 422 | Ga0207667_10009289 | 3300025949 | Bacteria | 11600 |
| 423 | Ga0207667_10009325 | 3300025949 | Bacteria | 11574 |
| 424 | Ga0207667_10044079 | 3300025949 | Bacteria | 4729 |
| 425 | Ga0207651_10013291 | 3300025960 | Bacteria | 4705 |
| 426 | Ga0207651_10027564 | 3300025960 | Bacteria | 3569 |
| 427 | Ga0207651_10049635 | 3300025960 | Unclassified | 2844 |
| 428 | Ga0207712_10001902 | 3300025961 | Bacteria | 13729 |
| 429 | Ga0207712_10005835 | 3300025961 | Bacteria | 7759 |
| 430 | Ga0207712_10024708 | 3300025961 | Bacteria | 3983 |
| 431 | Ga0207712_10093517 | 3300025961 | Unclassified | 2219 |
| 432 | Ga0207668_10079698 | 3300025972 | Unclassified | 2370 |
| 433 | Ga0207640_10071643 | 3300025981 | Bacteria | 2335 |
| 434 | Ga0207658_10012903 | 3300025986 | Bacteria | 5706 |
| 435 | Ga0207658_10037308 | 3300025986 | Bacteria | 3491 |
| 436 | Ga0207658_10054013 | 3300025986 | Bacteria | 2971 |
| 437 | Ga0207658_10202462 | 3300025986 | Bacteria | 1658 |
| 438 | Ga0207677_10013225 | 3300026023 | Bacteria | 4775 |
| 439 | Ga0207677_10142796 | 3300026023 | Bacteria | 1836 |
| 440 | Ga0207703_10004670 | 3300026035 | Bacteria | 11187 |
| 441 | Ga0207639_10003317 | 3300026041 | Bacteria | 10837 |
| 442 | Ga0207639_10004427 | 3300026041 | Bacteria | 9478 |
| 443 | Ga0207639_10017171 | 3300026041 | Bacteria | 5129 |
| 444 | Ga0207639_10155344 | 3300026041 | Bacteria | 1921 |
| 445 | Ga0207678_10026209 | 3300026067 | Bacteria | 5086 |
| 446 | Ga0207678_10039723 | 3300026067 | Bacteria | 4082 |
| 447 | Ga0207708_10080461 | 3300026075 | Bacteria | 2503 |
| 448 | Ga0207702_10055639 | 3300026078 | Unclassified | 3356 |
| 449 | Ga0207641_10000026 | 3300026088 | Bacteria | 245091 |
| 450 | Ga0207641_10000422 | 3300026088 | Bacteria | 49394 |
| 451 | Ga0207641_10021966 | 3300026088 | Bacteria | 5247 |
| 452 | Ga0207641_10029589 | 3300026088 | Bacteria | 4531 |
| 453 | Ga0207641_10038099 | 3300026088 | Bacteria | 4019 |
| 454 | Ga0207641_10132154 | 3300026088 | Bacteria | 2242 |
| 455 | Ga0207648_10000768 | 3300026089 | Bacteria | 36105 |
| 456 | Ga0207648_10009463 | 3300026089 | Bacteria | 9333 |
| 457 | Ga0207648_10046592 | 3300026089 | Bacteria | 3802 |
| 458 | Ga0207648_10156487 | 3300026089 | Bacteria | 2012 |
| 459 | Ga0207648_10207726 | 3300026089 | Bacteria | 1738 |
| 460 | Ga0207676_10018097 | 3300026095 | Bacteria | 5116 |
| 461 | Ga0207676_10029802 | 3300026095 | Bacteria | 4089 |
| 462 | Ga0207676_10076282 | 3300026095 | Bacteria | 2708 |
| 463 | Ga0207674_10001969 | 3300026116 | Bacteria | 26000 |
| 464 | Ga0207674_10008183 | 3300026116 | Bacteria | 12120 |
| 465 | Ga0207674_10009341 | 3300026116 | Bacteria | 11226 |
| 466 | Ga0207674_10009652 | 3300026116 | Bacteria | 11005 |
| 467 | Ga0207674_10022923 | 3300026116 | Bacteria | 6699 |
| 468 | Ga0207674_10043129 | 3300026116 | Bacteria | 4653 |
| 469 | Ga0207674_10139411 | 3300026116 | Bacteria | 2385 |
| 470 | Ga0207675_100000144 | 3300026118 | Bacteria | 61517 |
| 471 | Ga0207675_100018980 | 3300026118 | Bacteria | 6420 |
| 472 | Ga0207675_100025242 | 3300026118 | Bacteria | 5531 |
| 473 | Ga0207675_100097595 | 3300026118 | Bacteria | 2767 |
| 474 | Ga0207683_10001619 | 3300026121 | Bacteria | 20189 |
| 475 | Ga0207683_10023404 | 3300026121 | Bacteria | 5313 |
| 476 | Ga0207698_10003246 | 3300026142 | Bacteria | 9766 |
| 477 | Ga0207698_10007808 | 3300026142 | Bacteria | 6726 |
| 478 | Ga0207698_10008745 | 3300026142 | Bacteria | 6422 |
| 479 | Ga0207698_10021599 | 3300026142 | Bacteria | 4456 |
| 480 | Ga0207698_10028600 | 3300026142 | Bacteria | 3977 |
| 481 | Ga0207698_10093807 | 3300026142 | Bacteria | 2466 |
| 482 | Ga0207698_10177125 | 3300026142 | Bacteria | 1884 |
| 483 | Ga0268266_10000169 | 3300028379 | Bacteria | 119437 |
| 484 | Ga0268266_10040353 | 3300028379 | Bacteria | 3978 |
| 485 | Ga0268265_10023099 | 3300028380 | Bacteria | 4380 |
| 486 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 487 | Ga0268264_10003414 | 3300028381 | Bacteria | 13700 |
| 488 | Ga0268264_10054164 | 3300028381 | Bacteria | 3349 |
| 489 | Ga0265323_10000193 | 3300028653 | Bacteria | 36767 |
| 490 | Ga0307517_10000487 | 3300028786 | Bacteria | 68165 |
| 491 | Ga0307515_10000031 | 3300028794 | Bacteria | 358648 |
| 492 | Ga0265338_10006958 | 3300028800 | Bacteria | 14219 |
| 493 | Ga0307511_10000409 | 3300030521 | Bacteria | 45829 |
| 494 | Ga0265327_10000048 | 3300031251 | Bacteria | 269173 |
| 495 | Ga0265327_10000234 | 3300031251 | Bacteria | 112034 |
| 496 | Ga0265327_10000485 | 3300031251 | Bacteria | 69994 |
| 497 | Ga0265327_10010626 | 3300031251 | Bacteria | 6445 |
| 498 | Ga0265316_10000307 | 3300031344 | Bacteria | 54686 |
| 499 | Ga0265316_10007597 | 3300031344 | Bacteria | 10194 |
| 500 | Ga0307509_10080677 | 3300031507 | Bacteria | 3364 |
| 501 | Ga0307408_100047278 | 3300031548 | Bacteria | 3081 |
| 502 | Ga0265314_10105811 | 3300031711 | Bacteria | 1798 |
| 503 | Ga0265342_10007739 | 3300031712 | Bacteria | 7823 |
| 504 | Ga0316578_10073797 | 3300031728 | Bacteria | 2022 |
| 505 | Ga0307516_10000384 | 3300031730 | Bacteria | 57633 |
| 506 | Ga0307516_10067091 | 3300031730 | Bacteria | 3458 |
| 507 | Ga0307413_10003715 | 3300031824 | Bacteria | 6491 |
| 508 | Ga0307410_10006996 | 3300031852 | Bacteria | 6139 |
| 509 | Ga0307414_10000153 | 3300032004 | Bacteria | 46402 |
| 510 | Ga0373937_0090614 | 3300036401 | Unclassified | 2832 |
| 511 | Ga0316584_0001337 | 3300036712 | Bacteria | 14624 |
| 512 | Ga0395899_0000049 | 3300037312 | Bacteria | 225231 |
| 513 | Ga0395899_0001033 | 3300037312 | Bacteria | 25344 |
| 514 | Ga0395899_0045077 | 3300037312 | Bacteria | 3285 |
| 515 | Ga0395899_0073282 | 3300037312 | Bacteria | 2505 |
| 516 | Ga0395900_0000684 | 3300037418 | Bacteria | 45221 |
| 517 | Ga0395900_0010049 | 3300037418 | Bacteria | 9682 |
| 518 | Ga0395900_0090463 | 3300037418 | Bacteria | 3146 |
| 519 | Ga0395898_0001281 | 3300037466 | Bacteria | 36973 |
| 520 | Ga0395898_0023863 | 3300037466 | Bacteria | 6174 |
| 521 | Ga0395898_0072758 | 3300037466 | Bacteria | 3320 |
| 522 | Ga0395898_0103955 | 3300037466 | Bacteria | 2724 |
| 523 | Ga0395905_0009119 | 3300037471 | Bacteria | 9719 |
| 524 | Ga0395905_0016766 | 3300037471 | Bacteria | 6961 |
| 525 | Ga0395905_0105038 | 3300037471 | Bacteria | 2652 |
| 526 | Ga0395905_0229543 | 3300037471 | Bacteria | 1736 |
| 527 | Ga0395901_0000995 | 3300038443 | Bacteria | 30617 |
| 528 | Ga0395901_0007983 | 3300038443 | Bacteria | 10682 |
| 529 | Ga0395901_0013422 | 3300038443 | Bacteria | 8327 |
| 530 | Ga0400490_19689 | 3300038726 | Bacteria | 38346 |
| 531 | Ga0436365_1847227 | 3300039437 | Bacteria | 10331 |
| 532 | Ga0436365_1933142 | 3300039437 | Bacteria | 64226 |
| 533 | Ga0439439_0009758 | 3300041406 | Bacteria | 2289 |
| 534 | Ga0439449_0036161 | 3300042007 | Bacteria | 1837 |
| 535 | Ga0439457_000442 | 3300042014 | Bacteria | 11954 |
| 536 | Ga0451577_0000180 | 3300042876 | Bacteria | 135209 |
| 537 | Ga0451577_0006510 | 3300042876 | Bacteria | 11629 |
| 538 | Ga0451577_0018307 | 3300042876 | Bacteria | 6455 |
| 539 | Ga0451577_0055711 | 3300042876 | Bacteria | 3527 |
| 540 | Ga0451577_0093007 | 3300042876 | Bacteria | 2693 |
| 541 | Ga0451577_0102865 | 3300042876 | Bacteria | 2552 |
| 542 | Ga0451577_0135154 | 3300042876 | Bacteria | 2214 |
| 543 | Ga0466969_0000106 | 3300044656 | Bacteria | 44435 |
| 544 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 545 | Ga0466972_0007750 | 3300044658 | Bacteria | 5391 |
| 546 | Ga0453683_0000874 | 3300044673 | Bacteria | 28989 |
| 547 | Ga0453683_0001893 | 3300044673 | Bacteria | 17141 |
| 548 | Ga0466965_0021581 | 3300044683 | Bacteria | 3101 |
| 549 | Ga0466966_0056621 | 3300044684 | Bacteria | 2480 |
| 550 | Ga0466966_0094807 | 3300044684 | Bacteria | 1849 |
| 551 | Ga0453684_0000913 | 3300044712 | Bacteria | 98173 |
| 552 | Ga0453684_0003215 | 3300044712 | Bacteria | 37450 |
| 553 | Ga0453684_0003831 | 3300044712 | Bacteria | 33176 |
| 554 | Ga0453684_0009369 | 3300044712 | Bacteria | 17155 |
| 555 | Ga0453684_0033962 | 3300044712 | Bacteria | 7093 |
| 556 | Ga0453684_0044988 | 3300044712 | Bacteria | 5895 |
| 557 | Ga0453684_0073733 | 3300044712 | Bacteria | 4302 |
| 558 | Ga0453684_0087351 | 3300044712 | Bacteria | 3865 |
| 559 | Ga0453684_0089281 | 3300044712 | Bacteria | 3813 |
| 560 | Ga0453684_0101028 | 3300044712 | Bacteria | 3529 |
| 561 | Ga0453684_0154906 | 3300044712 | Bacteria | 2718 |
| 562 | Ga0453684_0177066 | 3300044712 | Bacteria | 2507 |
| 563 | Ga0453684_0207018 | 3300044712 | Bacteria | 2283 |
| 564 | Ga0453684_0317009 | 3300044712 | Unclassified | 1767 |
| 565 | Ga0466971_0011845 | 3300044719 | Bacteria | 3821 |
| 566 | Ga0466968_0013585 | 3300044735 | Bacteria | 3203 |
| 567 | Ga0466970_0007288 | 3300044765 | Bacteria | 5540 |
| 568 | Ga0466957_0000378 | 3300044842 | Bacteria | 21778 |
| 569 | Ga0466957_0031367 | 3300044842 | Bacteria | 3176 |
| 570 | Ga0466960_0034612 | 3300044901 | Bacteria | 2355 |
| 571 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 572 | Ga0466959_0000676 | 3300045049 | Bacteria | 19916 |
| 573 | Ga0451576_0000080 | 3300045051 | Bacteria | 242782 |
| 574 | Ga0451576_0010903 | 3300045051 | Bacteria | 10389 |
| 575 | Ga0451576_0062267 | 3300045051 | Bacteria | 3890 |
| 576 | Ga0451576_0076694 | 3300045051 | Bacteria | 3478 |
| 577 | Ga0466958_0028859 | 3300045836 | Bacteria | 3292 |
| 578 | Ga0495629_0069454 | 3300046459 | Unclassified | 2458 |
| 579 | Ga0495638_0000001 | 3300046460 | Bacteria | 1114121 |
| 580 | Ga0495650_0022146 | 3300046471 | Unclassified | 3053 |
| 581 | Ga0495580_0078617 | 3300046472 | Unclassified | 2301 |
| 582 | Ga0495594_0012737 | 3300046499 | Bacteria | 4388 |
| 583 | Ga0495606_0006410 | 3300046507 | Bacteria | 10858 |
| 584 | Ga0495643_0007737 | 3300046522 | Bacteria | 6885 |
| 585 | Ga0495648_0002648 | 3300046524 | Bacteria | 16239 |
| 586 | Ga0495652_0144330 | 3300046529 | Bacteria | 1868 |
| 587 | Ga0495587_0081831 | 3300046536 | Unclassified | 1871 |
| 588 | Ga0495668_0000097 | 3300046616 | Bacteria | 139246 |
| 589 | Ga0495668_0004630 | 3300046616 | Bacteria | 9663 |
| 590 | Ga0495611_0000061 | 3300046648 | Bacteria | 77533 |
| 591 | Ga0495625_0087082 | 3300046660 | Bacteria | 2166 |
| 592 | Ga0495658_0018761 | 3300046683 | Bacteria | 3602 |
| 593 | Ga0495636_0000001 | 3300047318 | Bacteria | 149950 |
| 594 | Ga0495674_0132214 | 3300047319 | Unclassified | 2102 |
| 595 | Ga0495672_0007867 | 3300047320 | Bacteria | 7958 |
| 596 | Ga0495672_0010270 | 3300047320 | Bacteria | 6688 |
| 597 | Ga0495672_0041504 | 3300047320 | Bacteria | 2782 |
| 598 | Ga0495687_001778 | 3300047443 | Bacteria | 19030 |
| 599 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 600 | Ga0495686_0000625 | 3300047472 | Bacteria | 48634 |
| 601 | Ga0496101_0035015 | 3300048904 | Unclassified | 3550 |
| 602 | Ga0496114_0004725 | 3300048917 | Bacteria | 10596 |
| 603 | Ga0501292_007049 | 3300049515 | Unclassified | 1616 |
| 604 | Ga0501298_000451 | 3300049521 | Bacteria | 5493 |
| 605 | Ga0501031_0005804 | 3300049568 | Bacteria | 8044 |
| 606 | Ga0501032_0002685 | 3300049569 | Bacteria | 13871 |
| 607 | Ga0501032_0003218 | 3300049569 | Bacteria | 12559 |
| 608 | Ga0501032_0024194 | 3300049569 | Bacteria | 4195 |
| 609 | Ga0501032_0135104 | 3300049569 | Bacteria | 1626 |
| 610 | Ga0501033_0000030 | 3300049570 | Bacteria | 157953 |
| 611 | Ga0501033_0082226 | 3300049570 | Bacteria | 2362 |
| 612 | Ga0501033_0150008 | 3300049570 | Bacteria | 1682 |
| 613 | Ga0501034_0001691 | 3300049571 | Bacteria | 28435 |
| 614 | Ga0501034_0007368 | 3300049571 | Bacteria | 11721 |
| 615 | Ga0501034_0023134 | 3300049571 | Bacteria | 6333 |
| 616 | Ga0501034_0083979 | 3300049571 | Bacteria | 3186 |
| 617 | Ga0501034_0178258 | 3300049571 | Bacteria | 2090 |
| 618 | Ga0501034_0299288 | 3300049571 | Bacteria | 1545 |
| 619 | Ga0501036_0001672 | 3300049572 | Bacteria | 17196 |
| 620 | Ga0501036_0010476 | 3300049572 | Bacteria | 7659 |
| 621 | Ga0501036_0148690 | 3300049572 | Bacteria | 1976 |
| 622 | Ga0501037_0003447 | 3300049573 | Bacteria | 11491 |
| 623 | Ga0501037_0133666 | 3300049573 | Bacteria | 1777 |
| 624 | Ga0501038_0029560 | 3300049574 | Bacteria | 4854 |
| 625 | Ga0501038_0121214 | 3300049574 | Bacteria | 2156 |
| 626 | Ga0501038_0183337 | 3300049574 | Bacteria | 1688 |
| 627 | Ga0501039_0030914 | 3300049575 | Unclassified | 4129 |
| 628 | Ga0501039_0125824 | 3300049575 | Bacteria | 2010 |
| 629 | Ga0501043_0026225 | 3300049579 | Bacteria | 4572 |
| 630 | Ga0501043_0037065 | 3300049579 | Bacteria | 3836 |
| 631 | Ga0501047_0018063 | 3300049581 | Bacteria | 6759 |
| 632 | Ga0501047_0039157 | 3300049581 | Bacteria | 4586 |
| 633 | Ga0501047_0075877 | 3300049581 | Bacteria | 3235 |
| 634 | Ga0501047_0098219 | 3300049581 | Unclassified | 2807 |
| 635 | Ga0501069_0018603 | 3300049585 | Bacteria | 3750 |
| 636 | Ga0501070_0008280 | 3300049586 | Bacteria | 8791 |
| 637 | Ga0501070_0087030 | 3300049586 | Bacteria | 2587 |
| 638 | Ga0501073_0008525 | 3300049589 | Bacteria | 7599 |
| 639 | Ga0501074_0013058 | 3300049590 | Bacteria | 6037 |
| 640 | Ga0501198_000442 | 3300049649 | Bacteria | 5122 |
| 641 | Ga0501201_000672 | 3300049651 | Bacteria | 3198 |
| 642 | Ga0501202_000366 | 3300049652 | Bacteria | 6277 |
| 643 | Ga0501207_000033 | 3300049654 | Bacteria | 9861 |
| 644 | Ga0501217_000032 | 3300049661 | Bacteria | 15163 |
| 645 | Ga0501233_004657 | 3300049668 | Bacteria | 2526 |
| 646 | Ga0501235_000540 | 3300049669 | Bacteria | 7549 |
| 647 | Ga0501235_004851 | 3300049669 | Bacteria | 2913 |
| 648 | Ga0501243_000061 | 3300049675 | Bacteria | 10533 |
| 649 | Ga0501259_000165 | 3300049688 | Bacteria | 9969 |
| 650 | Ga0501261_000807 | 3300049690 | Bacteria | 3915 |
| 651 | Ga0501225_0002749 | 3300049705 | Bacteria | 5409 |
| 652 | Ga0501225_0004690 | 3300049705 | Bacteria | 4054 |
| 653 | Ga0501225_0004749 | 3300049705 | Bacteria | 4028 |
| 654 | Ga0501234_000488 | 3300049707 | Bacteria | 6078 |
| 655 | Ga0501245_001209 | 3300049708 | Bacteria | 3333 |
| 656 | Ga0501080_0182078 | 3300049742 | Bacteria | 1933 |
| 657 | Ga0501083_0095934 | 3300049744 | Bacteria | 1956 |
| 658 | Ga0501266_001023 | 3300049763 | Bacteria | 3612 |
| 659 | Ga0501268_001908 | 3300049765 | Bacteria | 2667 |
| 660 | Ga0501035_0003216 | 3300049822 | Bacteria | 15655 |
| 661 | Ga0501035_0018229 | 3300049822 | Bacteria | 6466 |
| 662 | Ga0501044_0001914 | 3300049823 | Bacteria | 24093 |
| 663 | Ga0501044_0014823 | 3300049823 | Bacteria | 8403 |
| 664 | Ga0501044_0118282 | 3300049823 | Bacteria | 2653 |
| 665 | Ga0501045_0000123 | 3300049824 | Bacteria | 40368 |
| 666 | Ga0501284_00001 | 3300050005 | Bacteria | 261916 |
| 667 | nmdc:mga05p37_1394_c1 | 3300050507 | Bacteria | 28114 |
| 668 | nmdc:mga05p37_67105_c1 | 3300050507 | Bacteria | 4413 |
| 669 | nmdc:mga0qj67_35739_c1 | 3300050509 | Bacteria | 3886 |
| 670 | nmdc:mga06r32_59919_c1 | 3300050510 | Unclassified | 3662 |
| 671 | nmdc:mga08y16_25655_c1 | 3300050511 | Bacteria | 6219 |
| 672 | Ga0495619_0102045 | 3300053085 | Unclassified | 1954 |
| 673 | Ga0500646_0001999 | 3300053090 | Bacteria | 5329 |
| 674 | Ga0500583_0000019 | 3300053092 | Bacteria | 130534 |
| 675 | Ga0500583_0001215 | 3300053092 | Bacteria | 7376 |
| 676 | Ga0500650_0052920 | 3300053098 | Bacteria | 1888 |
| 677 | Ga0500562_000024 | 3300053108 | Bacteria | 105996 |
| 678 | Ga0500642_0034524 | 3300053130 | Bacteria | 2141 |
| 679 | Ga0500568_0029575 | 3300053139 | Bacteria | 2272 |
| 680 | Ga0500616_0000009 | 3300053153 | Bacteria | 779095 |
| 681 | Ga0500616_0002947 | 3300053153 | Bacteria | 13540 |
| 682 | Ga0500616_0034530 | 3300053153 | Bacteria | 2754 |
| 683 | Ga0500622_0000353 | 3300053156 | Bacteria | 44849 |
| 684 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
| 685 | Ga0500645_003247 | 3300053730 | Bacteria | 6723 |
| 686 | Ga0500645_007614 | 3300053730 | Bacteria | 3756 |
| 687 | Ga0466962_0008480 | 3300061719 | Bacteria | 4925 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049515 | Ga0501292_007049 | Ga0501292_007049_371_1606 | 355 |
| 2 | 3300009093 | Ga0105240_10015806 | Ga0105240_100158064 | 378 |
| 3 | 3300010375 | Ga0105239_10039875 | Ga0105239_100398754 | 378 |
| 4 | 3300013104 | Ga0157370_10012794 | Ga0157370_100127946 | 378 |
| 5 | 3300013307 | Ga0157372_10009489 | Ga0157372_100094895 | 378 |
| 6 | 3300025913 | Ga0207695_10001383 | Ga0207695_1000138333 | 378 |
| 7 | 3300028379 | Ga0268266_10000169 | Ga0268266_1000016973 | 378 |
| 8 | 3300046524 | Ga0495648_0002648 | Ga0495648_0002648_1043_2191 | 378 |
| 9 | 3300047443 | Ga0495687_001778 | Ga0495687_001778_1099_2247 | 378 |
| 10 | 3300049569 | Ga0501032_0135104 | Ga0501032_0135104_16_1164 | 378 |
| 11 | 3300053130 | Ga0500642_0034524 | Ga0500642_0034524_19_1167 | 378 |
| 12 | 3300049668 | Ga0501233_004657 | Ga0501233_004657_1152_2477 | 385 |
| 13 | 3300049574 | Ga0501038_0183337 | Ga0501038_0183337_337_1674 | 399 |
| 14 | 3300047319 | Ga0495674_0132214 | Ga0495674_0132214_16_1239 | 403 |
| 15 | 3300025901 | Ga0207688_10080064 | Ga0207688_100800642 | 405 |
| 16 | 3300042876 | Ga0451577_0093007 | Ga0451577_0093007_820_2229 | 431 |
| 17 | 3300045051 | Ga0451576_0076694 | Ga0451576_0076694_992_2401 | 431 |
| 18 | 3300044712 | Ga0453684_0089281 | Ga0453684_0089281_721_2130 | 432 |
| 19 | 3300005366 | Ga0070659_100002166 | Ga0070659_10000216613 | 434 |
| 20 | 3300005616 | Ga0068852_100000706 | Ga0068852_10000070614 | 434 |
| 21 | 3300025904 | Ga0207647_10000131 | Ga0207647_1000013152 | 434 |
| 22 | 3300025932 | Ga0207690_10005004 | Ga0207690_100050046 | 434 |
| 23 | 3300026142 | Ga0207698_10008745 | Ga0207698_100087456 | 434 |
| 24 | 3300005343 | Ga0070687_100020594 | Ga0070687_1000205943 | 436 |
| 25 | 3300005353 | Ga0070669_100059023 | Ga0070669_1000590231 | 436 |
| 26 | 3300006844 | Ga0075428_100014704 | Ga0075428_1000147043 | 437 |
| 27 | 3300006846 | Ga0075430_100086919 | Ga0075430_1000869192 | 437 |
| 28 | 3300006880 | Ga0075429_100001064 | Ga0075429_1000010646 | 437 |
| 29 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_510540_511865 | 437 |
| 30 | 3300044683 | Ga0466965_0021581 | Ga0466965_0021581_381_1709 | 438 |
| 31 | 3300038726 | Ga0400490_19689 | Ga0400490_19689_18090_19490 | 441 |
| 32 | 3300005354 | Ga0070675_100002115 | Ga0070675_1000021157 | 442 |
| 33 | 3300005543 | Ga0070672_100145047 | Ga0070672_1001450472 | 442 |
| 34 | 3300005719 | Ga0068861_100117666 | Ga0068861_1001176661 | 442 |
| 35 | 3300025923 | Ga0207681_10034199 | Ga0207681_100341992 | 442 |
| 36 | 3300044673 | Ga0453683_0001893 | Ga0453683_0001893_14622_16028 | 444 |
| 37 | 3300049570 | Ga0501033_0150008 | Ga0501033_0150008_163_1644 | 444 |
| 38 | 3300026121 | Ga0207683_10023404 | Ga0207683_100234042 | 445 |
| 39 | 3300005289 | Ga0065704_10130134 | Ga0065704_101301342 | 446 |
| 40 | 3300005367 | Ga0070667_100213037 | Ga0070667_1002130371 | 446 |
| 41 | 3300005466 | Ga0070685_10052342 | Ga0070685_100523422 | 446 |
| 42 | 3300005577 | Ga0068857_100011464 | Ga0068857_1000114646 | 446 |
| 43 | 3300026041 | Ga0207639_10155344 | Ga0207639_101553441 | 446 |
| 44 | 3300026116 | Ga0207674_10009341 | Ga0207674_100093415 | 446 |
| 45 | 3300031712 | Ga0265342_10007739 | Ga0265342_100077398 | 446 |
| 46 | 3300005334 | Ga0068869_100067524 | Ga0068869_1000675242 | 447 |
| 47 | 3300005468 | Ga0070707_100263899 | Ga0070707_1002638991 | 447 |
| 48 | 3300005471 | Ga0070698_100077619 | Ga0070698_1000776192 | 447 |
| 49 | 3300005617 | Ga0068859_100204940 | Ga0068859_1002049402 | 447 |
| 50 | 3300006931 | Ga0097620_100204949 | Ga0097620_1002049492 | 447 |
| 51 | 3300025918 | Ga0207662_10030116 | Ga0207662_100301162 | 447 |
| 52 | 3300005844 | Ga0068862_100080167 | Ga0068862_1000801672 | 448 |
| 53 | 3300005328 | Ga0070676_10017619 | Ga0070676_100176193 | 449 |
| 54 | 3300005335 | Ga0070666_10037855 | Ga0070666_100378552 | 449 |
| 55 | 3300005356 | Ga0070674_100014555 | Ga0070674_1000145553 | 449 |
| 56 | 3300005364 | Ga0070673_100064542 | Ga0070673_1000645423 | 449 |
| 57 | 3300005367 | Ga0070667_100029961 | Ga0070667_1000299613 | 449 |
| 58 | 3300005456 | Ga0070678_100008332 | Ga0070678_1000083323 | 449 |
| 59 | 3300005539 | Ga0068853_100017476 | Ga0068853_1000174764 | 449 |
| 60 | 3300005843 | Ga0068860_100113495 | Ga0068860_1001134952 | 449 |
| 61 | 3300006237 | Ga0097621_100058022 | Ga0097621_1000580222 | 449 |
| 62 | 3300006358 | Ga0068871_100020339 | Ga0068871_1000203394 | 449 |
| 63 | 3300025901 | Ga0207688_10018807 | Ga0207688_100188074 | 449 |
| 64 | 3300025907 | Ga0207645_10001118 | Ga0207645_1000111812 | 449 |
| 65 | 3300025908 | Ga0207643_10009005 | Ga0207643_100090053 | 449 |
| 66 | 3300025940 | Ga0207691_10020555 | Ga0207691_100205553 | 449 |
| 67 | 3300025942 | Ga0207689_10001731 | Ga0207689_1000173117 | 449 |
| 68 | 3300025986 | Ga0207658_10037308 | Ga0207658_100373082 | 449 |
| 69 | 3300026116 | Ga0207674_10139411 | Ga0207674_101394112 | 449 |
| 70 | 3300026118 | Ga0207675_100018980 | Ga0207675_1000189804 | 449 |
| 71 | 3300026121 | Ga0207683_10001619 | Ga0207683_100016195 | 449 |
| 72 | 3300047472 | Ga0495686_0000625 | Ga0495686_0000625_10065_11435 | 449 |
| 73 | 3300049579 | Ga0501043_0037065 | Ga0501043_0037065_2236_3639 | 449 |
| 74 | 3300049649 | Ga0501198_000442 | Ga0501198_000442_2158_3531 | 449 |
| 75 | 3300049705 | Ga0501225_0004690 | Ga0501225_0004690_1737_3110 | 449 |
| 76 | 3300026075 | Ga0207708_10080461 | Ga0207708_100804612 | 450 |
| 77 | 3300028381 | Ga0268264_10003414 | Ga0268264_100034147 | 450 |
| 78 | 3300042876 | Ga0451577_0055711 | Ga0451577_0055711_1051_2508 | 450 |
| 79 | 3300048917 | Ga0496114_0004725 | Ga0496114_0004725_3616_5037 | 450 |
| 80 | 3300005329 | Ga0070683_100210155 | Ga0070683_1002101552 | 451 |
| 81 | 3300005330 | Ga0070690_100045473 | Ga0070690_1000454732 | 451 |
| 82 | 3300005334 | Ga0068869_100061094 | Ga0068869_1000610942 | 451 |
| 83 | 3300005335 | Ga0070666_10118142 | Ga0070666_101181421 | 451 |
| 84 | 3300005457 | Ga0070662_100003263 | Ga0070662_1000032639 | 451 |
| 85 | 3300005614 | Ga0068856_100069438 | Ga0068856_1000694382 | 451 |
| 86 | 3300005842 | Ga0068858_100056199 | Ga0068858_1000561991 | 451 |
| 87 | 3300010375 | Ga0105239_10254145 | Ga0105239_102541452 | 451 |
| 88 | 3300013296 | Ga0157374_10013112 | Ga0157374_100131124 | 451 |
| 89 | 3300013307 | Ga0157372_10074551 | Ga0157372_100745512 | 451 |
| 90 | 3300013308 | Ga0157375_10004945 | Ga0157375_100049452 | 451 |
| 91 | 3300014325 | Ga0163163_10042459 | Ga0163163_100424592 | 451 |
| 92 | 3300017792 | Ga0163161_10003176 | Ga0163161_100031763 | 451 |
| 93 | 3300025911 | Ga0207654_10004542 | Ga0207654_100045423 | 451 |
| 94 | 3300025913 | Ga0207695_10020736 | Ga0207695_100207366 | 451 |
| 95 | 3300025924 | Ga0207694_10026748 | Ga0207694_100267482 | 451 |
| 96 | 3300025933 | Ga0207706_10003190 | Ga0207706_1000319012 | 451 |
| 97 | 3300026078 | Ga0207702_10055639 | Ga0207702_100556393 | 451 |
| 98 | 3300042876 | Ga0451577_0102865 | Ga0451577_0102865_667_2082 | 451 |
| 99 | 3300044658 | Ga0466972_0007750 | Ga0466972_0007750_1835_3202 | 451 |
| 100 | 3300044712 | Ga0453684_0101028 | Ga0453684_0101028_132_1547 | 451 |
| 101 | 3300005329 | Ga0070683_100002896 | Ga0070683_1000028966 | 452 |
| 102 | 3300005564 | Ga0070664_100000341 | Ga0070664_10000034123 | 452 |
| 103 | 3300005577 | Ga0068857_100000652 | Ga0068857_10000065219 | 452 |
| 104 | 3300005843 | Ga0068860_100069929 | Ga0068860_1000699293 | 452 |
| 105 | 3300006847 | Ga0075431_100011173 | Ga0075431_1000111735 | 452 |
| 106 | 3300014326 | Ga0157380_10005550 | Ga0157380_100055503 | 452 |
| 107 | 3300025914 | Ga0207671_10006294 | Ga0207671_100062943 | 452 |
| 108 | 3300028381 | Ga0268264_10054164 | Ga0268264_100541643 | 452 |
| 109 | 3300031251 | Ga0265327_10010626 | Ga0265327_100106262 | 452 |
| 110 | 3300053139 | Ga0500568_0029575 | Ga0500568_0029575_273_1643 | 452 |
| 111 | 3300005331 | Ga0070670_100085435 | Ga0070670_1000854352 | 453 |
| 112 | 3300005340 | Ga0070689_100011333 | Ga0070689_1000113333 | 453 |
| 113 | 3300005353 | Ga0070669_100001547 | Ga0070669_1000015477 | 453 |
| 114 | 3300005365 | Ga0070688_100008797 | Ga0070688_1000087972 | 453 |
| 115 | 3300005459 | Ga0068867_100121304 | Ga0068867_1001213042 | 453 |
| 116 | 3300005617 | Ga0068859_100010235 | Ga0068859_1000102357 | 453 |
| 117 | 3300006844 | Ga0075428_100039130 | Ga0075428_1000391302 | 453 |
| 118 | 3300006847 | Ga0075431_100011553 | Ga0075431_1000115536 | 453 |
| 119 | 3300006880 | Ga0075429_100014498 | Ga0075429_1000144983 | 453 |
| 120 | 3300006931 | Ga0097620_100010233 | Ga0097620_1000102337 | 453 |
| 121 | 3300009093 | Ga0105240_10000131 | Ga0105240_1000013198 | 453 |
| 122 | 3300010375 | Ga0105239_10001713 | Ga0105239_100017135 | 453 |
| 123 | 3300014745 | Ga0157377_10115088 | Ga0157377_101150881 | 453 |
| 124 | 3300025913 | Ga0207695_10000217 | Ga0207695_1000021753 | 453 |
| 125 | 3300025923 | Ga0207681_10002654 | Ga0207681_100026542 | 453 |
| 126 | 3300026118 | Ga0207675_100000144 | Ga0207675_1000001447 | 453 |
| 127 | 3300031251 | Ga0265327_10000234 | Ga0265327_100002344 | 453 |
| 128 | 3300044712 | Ga0453684_0154906 | Ga0453684_0154906_602_2032 | 453 |
| 129 | 3300045051 | Ga0451576_0062267 | Ga0451576_0062267_316_1746 | 453 |
| 130 | 3300049763 | Ga0501266_001023 | Ga0501266_001023_439_1824 | 453 |
| 131 | 3300013100 | Ga0157373_10009333 | Ga0157373_100093334 | 454 |
| 132 | 3300025942 | Ga0207689_10125905 | Ga0207689_101259051 | 454 |
| 133 | 3300025961 | Ga0207712_10024708 | Ga0207712_100247082 | 454 |
| 134 | 3300005329 | Ga0070683_100008183 | Ga0070683_1000081832 | 455 |
| 135 | 3300005355 | Ga0070671_100095081 | Ga0070671_1000950811 | 455 |
| 136 | 3300005535 | Ga0070684_100009042 | Ga0070684_1000090425 | 455 |
| 137 | 3300005564 | Ga0070664_100063257 | Ga0070664_1000632572 | 455 |
| 138 | 3300005618 | Ga0068864_100003504 | Ga0068864_1000035043 | 455 |
| 139 | 3300011119 | Ga0105246_10009987 | Ga0105246_100099872 | 455 |
| 140 | 3300013296 | Ga0157374_10002453 | Ga0157374_100024533 | 455 |
| 141 | 3300013308 | Ga0157375_10027810 | Ga0157375_100278103 | 455 |
| 142 | 3300013308 | Ga0157375_10127353 | Ga0157375_101273532 | 455 |
| 143 | 3300014325 | Ga0163163_10000732 | Ga0163163_1000073217 | 455 |
| 144 | 3300025925 | Ga0207650_10069465 | Ga0207650_100694653 | 455 |
| 145 | 3300025931 | Ga0207644_10030426 | Ga0207644_100304263 | 455 |
| 146 | 3300025940 | Ga0207691_10012577 | Ga0207691_100125773 | 455 |
| 147 | 3300025944 | Ga0207661_10015910 | Ga0207661_100159101 | 455 |
| 148 | 3300025986 | Ga0207658_10202462 | Ga0207658_102024621 | 455 |
| 149 | 3300026023 | Ga0207677_10142796 | Ga0207677_101427961 | 455 |
| 150 | 3300026067 | Ga0207678_10039723 | Ga0207678_100397232 | 455 |
| 151 | 3300026116 | Ga0207674_10022923 | Ga0207674_100229233 | 455 |
| 152 | 3300031711 | Ga0265314_10105811 | Ga0265314_101058111 | 455 |
| 153 | 3300031730 | Ga0307516_10000384 | Ga0307516_1000038415 | 455 |
| 154 | 3300047318 | Ga0495636_0000001 | Ga0495636_0000001_54428_55873 | 455 |
| 155 | iso_pu_bacteria | 2896109856 | 2896112924 | 455 |
| 156 | iso_pu_bacteria | 2911138879 | 2911141113 | 455 |
| 157 | 3300005289 | Ga0065704_10072259 | Ga0065704_100722595 | 456 |
| 158 | 3300006163 | Ga0070715_10046519 | Ga0070715_100465192 | 456 |
| 159 | 3300006237 | Ga0097621_100026494 | Ga0097621_1000264943 | 456 |
| 160 | 3300026089 | Ga0207648_10156487 | Ga0207648_101564872 | 456 |
| 161 | 3300031728 | Ga0316578_10073797 | Ga0316578_100737972 | 456 |
| 162 | 3300036712 | Ga0316584_0001337 | Ga0316584_0001337_8192_9598 | 456 |
| 163 | 3300044712 | Ga0453684_0317009 | Ga0453684_0317009_216_1622 | 456 |
| 164 | 3300045051 | Ga0451576_0010903 | Ga0451576_0010903_8502_9908 | 456 |
| 165 | 3300046460 | Ga0495638_0000001 | Ga0495638_0000001_608338_609774 | 456 |
| 166 | 3300049571 | Ga0501034_0299288 | Ga0501034_0299288_35_1417 | 456 |
| 167 | 3300049574 | Ga0501038_0121214 | Ga0501038_0121214_556_1938 | 456 |
| 168 | 3300053153 | Ga0500616_0000009 | Ga0500616_0000009_127387_128823 | 456 |
| 169 | iso_pu_bacteria | 2884634485 | 2884636287 | 456 |
| 170 | iso_pu_bacteria | 2919692658 | 2919696055 | 456 |
| 171 | 3300005335 | Ga0070666_10000064 | Ga0070666_1000006475 | 457 |
| 172 | 3300005364 | Ga0070673_100089652 | Ga0070673_1000896522 | 457 |
| 173 | 3300005367 | Ga0070667_100114295 | Ga0070667_1001142952 | 457 |
| 174 | 3300005543 | Ga0070672_100100565 | Ga0070672_1001005652 | 457 |
| 175 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003160 | 457 |
| 176 | 3300005841 | Ga0068863_100003550 | Ga0068863_10000355012 | 457 |
| 177 | 3300005842 | Ga0068858_100027838 | Ga0068858_1000278383 | 457 |
| 178 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003160 | 457 |
| 179 | 3300025903 | Ga0207680_10000388 | Ga0207680_100003885 | 457 |
| 180 | 3300025911 | Ga0207654_10001784 | Ga0207654_100017846 | 457 |
| 181 | 3300025913 | Ga0207695_10019233 | Ga0207695_100192333 | 457 |
| 182 | 3300025914 | Ga0207671_10001848 | Ga0207671_1000184821 | 457 |
| 183 | 3300025940 | Ga0207691_10058684 | Ga0207691_100586843 | 457 |
| 184 | 3300025942 | Ga0207689_10002903 | Ga0207689_100029035 | 457 |
| 185 | 3300025961 | Ga0207712_10001902 | Ga0207712_100019028 | 457 |
| 186 | 3300026035 | Ga0207703_10004670 | Ga0207703_100046704 | 457 |
| 187 | 3300026088 | Ga0207641_10000026 | Ga0207641_10000026144 | 457 |
| 188 | 3300026088 | Ga0207641_10000422 | Ga0207641_100004222 | 457 |
| 189 | 3300026095 | Ga0207676_10018097 | Ga0207676_100180972 | 457 |
| 190 | 3300026142 | Ga0207698_10003246 | Ga0207698_100032467 | 457 |
| 191 | iso_pu_bacteria | 2881955468 | 2881956827 | 457 |
| 192 | 3300003794 | Ga0055531_10000401 | Ga0055531_1000040131 | 458 |
| 193 | 3300005290 | Ga0065712_10005130 | Ga0065712_100051302 | 458 |
| 194 | 3300005334 | Ga0068869_100040043 | Ga0068869_1000400432 | 458 |
| 195 | 3300005344 | Ga0070661_100124342 | Ga0070661_1001243422 | 458 |
| 196 | 3300005354 | Ga0070675_100011337 | Ga0070675_1000113374 | 458 |
| 197 | 3300005364 | Ga0070673_100027220 | Ga0070673_1000272203 | 458 |
| 198 | 3300005364 | Ga0070673_100045099 | Ga0070673_1000450992 | 458 |
| 199 | 3300005617 | Ga0068859_100299453 | Ga0068859_1002994531 | 458 |
| 200 | 3300005841 | Ga0068863_100114740 | Ga0068863_1001147403 | 458 |
| 201 | 3300006880 | Ga0075429_100147448 | Ga0075429_1001474481 | 458 |
| 202 | 3300006931 | Ga0097620_100299472 | Ga0097620_1002994721 | 458 |
| 203 | 3300009094 | Ga0111539_10014643 | Ga0111539_100146435 | 458 |
| 204 | 3300009147 | Ga0114129_10076888 | Ga0114129_100768883 | 458 |
| 205 | 3300009176 | Ga0105242_10035315 | Ga0105242_100353155 | 458 |
| 206 | 3300009176 | Ga0105242_10062251 | Ga0105242_100622512 | 458 |
| 207 | 3300009177 | Ga0105248_10112813 | Ga0105248_101128132 | 458 |
| 208 | 3300009553 | Ga0105249_10063526 | Ga0105249_100635262 | 458 |
| 209 | 3300013102 | Ga0157371_10121467 | Ga0157371_101214672 | 458 |
| 210 | 3300013105 | Ga0157369_10205240 | Ga0157369_102052402 | 458 |
| 211 | 3300014745 | Ga0157377_10044856 | Ga0157377_100448562 | 458 |
| 212 | 3300025304 | Ga0209257_1000023 | Ga0209257_1000023424 | 458 |
| 213 | 3300025908 | Ga0207643_10014263 | Ga0207643_100142632 | 458 |
| 214 | 3300025920 | Ga0207649_10114705 | Ga0207649_101147051 | 458 |
| 215 | 3300025941 | Ga0207711_10133513 | Ga0207711_101335132 | 458 |
| 216 | 3300025942 | Ga0207689_10003837 | Ga0207689_1000383711 | 458 |
| 217 | 3300025942 | Ga0207689_10018292 | Ga0207689_100182923 | 458 |
| 218 | 3300025942 | Ga0207689_10039610 | Ga0207689_100396102 | 458 |
| 219 | 3300025942 | Ga0207689_10048577 | Ga0207689_100485772 | 458 |
| 220 | 3300025960 | Ga0207651_10027564 | Ga0207651_100275641 | 458 |
| 221 | 3300025960 | Ga0207651_10049635 | Ga0207651_100496351 | 458 |
| 222 | 3300025972 | Ga0207668_10079698 | Ga0207668_100796981 | 458 |
| 223 | 3300025986 | Ga0207658_10054013 | Ga0207658_100540132 | 458 |
| 224 | 3300026088 | Ga0207641_10132154 | Ga0207641_101321542 | 458 |
| 225 | 3300026118 | Ga0207675_100025242 | Ga0207675_1000252423 | 458 |
| 226 | 3300037471 | Ga0395905_0105038 | Ga0395905_0105038_754_2160 | 458 |
| 227 | 3300044712 | Ga0453684_0207018 | Ga0453684_0207018_626_2053 | 458 |
| 228 | 3300046499 | Ga0495594_0012737 | Ga0495594_0012737_1241_2647 | 458 |
| 229 | 3300049765 | Ga0501268_001908 | Ga0501268_001908_479_1885 | 458 |
| 230 | 3300050511 | nmdc:mga08y16_25655_c1 | nmdc:mga08y16_25655_c1_1288_2733 | 458 |
| 231 | 3300005329 | Ga0070683_100050048 | Ga0070683_1000500482 | 459 |
| 232 | 3300005331 | Ga0070670_100018086 | Ga0070670_1000180864 | 459 |
| 233 | 3300005355 | Ga0070671_100033340 | Ga0070671_1000333402 | 459 |
| 234 | 3300005355 | Ga0070671_100176340 | Ga0070671_1001763402 | 459 |
| 235 | 3300005564 | Ga0070664_100002301 | Ga0070664_10000230111 | 459 |
| 236 | 3300015265 | Ga0182005_1000043 | Ga0182005_100004373 | 459 |
| 237 | 3300025925 | Ga0207650_10000813 | Ga0207650_1000081315 | 459 |
| 238 | 3300025931 | Ga0207644_10039267 | Ga0207644_100392672 | 459 |
| 239 | 3300025942 | Ga0207689_10068198 | Ga0207689_100681982 | 459 |
| 240 | 3300025944 | Ga0207661_10130812 | Ga0207661_101308122 | 459 |
| 241 | 3300028653 | Ga0265323_10000193 | Ga0265323_100001932 | 459 |
| 242 | 3300028800 | Ga0265338_10006958 | Ga0265338_100069588 | 459 |
| 243 | 3300031344 | Ga0265316_10000307 | Ga0265316_100003075 | 459 |
| 244 | 3300031344 | Ga0265316_10007597 | Ga0265316_100075972 | 459 |
| 245 | 3300037471 | Ga0395905_0016766 | Ga0395905_0016766_604_2103 | 459 |
| 246 | 3300050509 | nmdc:mga0qj67_35739_c1 | nmdc:mga0qj67_35739_c1_2409_3872 | 459 |
| 247 | 3300053153 | Ga0500616_0034530 | Ga0500616_0034530_515_1969 | 459 |
| 248 | 3300005343 | Ga0070687_100005317 | Ga0070687_1000053175 | 460 |
| 249 | 3300005354 | Ga0070675_100145471 | Ga0070675_1001454711 | 460 |
| 250 | 3300005355 | Ga0070671_100003764 | Ga0070671_1000037646 | 460 |
| 251 | 3300005364 | Ga0070673_100017552 | Ga0070673_1000175523 | 460 |
| 252 | 3300005564 | Ga0070664_100054863 | Ga0070664_1000548632 | 460 |
| 253 | 3300005842 | Ga0068858_100088996 | Ga0068858_1000889962 | 460 |
| 254 | 3300006237 | Ga0097621_100129324 | Ga0097621_1001293242 | 460 |
| 255 | 3300013102 | Ga0157371_10004079 | Ga0157371_100040797 | 460 |
| 256 | 3300014325 | Ga0163163_10371814 | Ga0163163_103718141 | 460 |
| 257 | 3300025901 | Ga0207688_10077494 | Ga0207688_100774942 | 460 |
| 258 | 3300025918 | Ga0207662_10042043 | Ga0207662_100420432 | 460 |
| 259 | 3300025961 | Ga0207712_10093517 | Ga0207712_100935172 | 460 |
| 260 | 3300026142 | Ga0207698_10177125 | Ga0207698_101771252 | 460 |
| 261 | 3300031251 | Ga0265327_10000485 | Ga0265327_1000048530 | 460 |
| 262 | 3300031548 | Ga0307408_100047278 | Ga0307408_1000472783 | 460 |
| 263 | 3300031824 | Ga0307413_10003715 | Ga0307413_100037152 | 460 |
| 264 | 3300031852 | Ga0307410_10006996 | Ga0307410_100069965 | 460 |
| 265 | 3300032004 | Ga0307414_10000153 | Ga0307414_100001535 | 460 |
| 266 | 3300037312 | Ga0395899_0000049 | Ga0395899_0000049_208778_210187 | 460 |
| 267 | 3300037418 | Ga0395900_0090463 | Ga0395900_0090463_502_1911 | 460 |
| 268 | 3300049569 | Ga0501032_0024194 | Ga0501032_0024194_227_1627 | 460 |
| 269 | 3300049570 | Ga0501033_0082226 | Ga0501033_0082226_221_1621 | 460 |
| 270 | 3300049571 | Ga0501034_0023134 | Ga0501034_0023134_2896_4296 | 460 |
| 271 | 3300049572 | Ga0501036_0148690 | Ga0501036_0148690_432_1832 | 460 |
| 272 | 3300049573 | Ga0501037_0133666 | Ga0501037_0133666_186_1586 | 460 |
| 273 | 3300049575 | Ga0501039_0030914 | Ga0501039_0030914_334_1734 | 460 |
| 274 | 3300049579 | Ga0501043_0026225 | Ga0501043_0026225_596_1996 | 460 |
| 275 | 3300049581 | Ga0501047_0075877 | Ga0501047_0075877_859_2259 | 460 |
| 276 | 3300049652 | Ga0501202_000366 | Ga0501202_000366_4657_6069 | 460 |
| 277 | 3300049669 | Ga0501235_004851 | Ga0501235_004851_13_1425 | 460 |
| 278 | iso_pu_bacteria | 2914759650 | 2914762440 | 460 |
| 279 | 3300003316 | rootH1_10076736 | rootH1_100767361 | 461 |
| 280 | 3300003323 | rootH1_10116615 | rootH1_101166157 | 461 |
| 281 | 3300003323 | rootH1_10211012 | rootH1_102110124 | 461 |
| 282 | 3300005334 | Ga0068869_100130571 | Ga0068869_1001305711 | 461 |
| 283 | 3300005336 | Ga0070680_100004861 | Ga0070680_1000048612 | 461 |
| 284 | 3300005355 | Ga0070671_100036570 | Ga0070671_1000365702 | 461 |
| 285 | 3300005366 | Ga0070659_100015031 | Ga0070659_1000150311 | 461 |
| 286 | 3300005367 | Ga0070667_100046048 | Ga0070667_1000460483 | 461 |
| 287 | 3300005455 | Ga0070663_100077147 | Ga0070663_1000771472 | 461 |
| 288 | 3300005457 | Ga0070662_100034440 | Ga0070662_1000344403 | 461 |
| 289 | 3300005457 | Ga0070662_100140022 | Ga0070662_1001400221 | 461 |
| 290 | 3300005458 | Ga0070681_10011816 | Ga0070681_100118162 | 461 |
| 291 | 3300005563 | Ga0068855_100002248 | Ga0068855_10000224815 | 461 |
| 292 | 3300005563 | Ga0068855_100015455 | Ga0068855_1000154552 | 461 |
| 293 | 3300005564 | Ga0070664_100257117 | Ga0070664_1002571171 | 461 |
| 294 | 3300005616 | Ga0068852_100085278 | Ga0068852_1000852782 | 461 |
| 295 | 3300005617 | Ga0068859_100033423 | Ga0068859_1000334232 | 461 |
| 296 | 3300005617 | Ga0068859_100228100 | Ga0068859_1002281002 | 461 |
| 297 | 3300005842 | Ga0068858_100035990 | Ga0068858_1000359903 | 461 |
| 298 | 3300006931 | Ga0097620_100033422 | Ga0097620_1000334225 | 461 |
| 299 | 3300006931 | Ga0097620_100228106 | Ga0097620_1002281062 | 461 |
| 300 | 3300009147 | Ga0114129_10011797 | Ga0114129_100117978 | 461 |
| 301 | 3300009545 | Ga0105237_10009698 | Ga0105237_100096985 | 461 |
| 302 | 3300009553 | Ga0105249_10019335 | Ga0105249_100193353 | 461 |
| 303 | 3300009553 | Ga0105249_10075831 | Ga0105249_100758312 | 461 |
| 304 | 3300013102 | Ga0157371_10002424 | Ga0157371_1000242412 | 461 |
| 305 | 3300013102 | Ga0157371_10034892 | Ga0157371_100348922 | 461 |
| 306 | 3300013104 | Ga0157370_10011871 | Ga0157370_100118712 | 461 |
| 307 | 3300013296 | Ga0157374_10065603 | Ga0157374_100656033 | 461 |
| 308 | 3300013296 | Ga0157374_10075274 | Ga0157374_100752742 | 461 |
| 309 | 3300013306 | Ga0163162_10001913 | Ga0163162_100019134 | 461 |
| 310 | 3300013306 | Ga0163162_10025269 | Ga0163162_100252694 | 461 |
| 311 | 3300013306 | Ga0163162_10107185 | Ga0163162_101071852 | 461 |
| 312 | 3300013307 | Ga0157372_10009879 | Ga0157372_100098794 | 461 |
| 313 | 3300013307 | Ga0157372_10013017 | Ga0157372_100130175 | 461 |
| 314 | 3300013308 | Ga0157375_10091529 | Ga0157375_100915293 | 461 |
| 315 | 3300025904 | Ga0207647_10009015 | Ga0207647_100090156 | 461 |
| 316 | 3300025907 | Ga0207645_10019550 | Ga0207645_100195505 | 461 |
| 317 | 3300025909 | Ga0207705_10053258 | Ga0207705_100532584 | 461 |
| 318 | 3300025921 | Ga0207652_10000103 | Ga0207652_1000010344 | 461 |
| 319 | 3300025921 | Ga0207652_10006111 | Ga0207652_100061119 | 461 |
| 320 | 3300025936 | Ga0207670_10021241 | Ga0207670_100212414 | 461 |
| 321 | 3300025942 | Ga0207689_10185102 | Ga0207689_101851021 | 461 |
| 322 | 3300025944 | Ga0207661_10034951 | Ga0207661_100349512 | 461 |
| 323 | 3300025949 | Ga0207667_10044079 | Ga0207667_100440792 | 461 |
| 324 | 3300026067 | Ga0207678_10026209 | Ga0207678_100262093 | 461 |
| 325 | 3300026089 | Ga0207648_10046592 | Ga0207648_100465922 | 461 |
| 326 | 3300026142 | Ga0207698_10021599 | Ga0207698_100215992 | 461 |
| 327 | 3300037312 | Ga0395899_0001033 | Ga0395899_0001033_16816_18222 | 461 |
| 328 | 3300037312 | Ga0395899_0045077 | Ga0395899_0045077_1081_2487 | 461 |
| 329 | 3300037312 | Ga0395899_0073282 | Ga0395899_0073282_985_2391 | 461 |
| 330 | 3300037418 | Ga0395900_0000684 | Ga0395900_0000684_28312_29718 | 461 |
| 331 | 3300037418 | Ga0395900_0010049 | Ga0395900_0010049_5703_7109 | 461 |
| 332 | 3300037466 | Ga0395898_0001281 | Ga0395898_0001281_15212_16618 | 461 |
| 333 | 3300037466 | Ga0395898_0023863 | Ga0395898_0023863_2368_3774 | 461 |
| 334 | 3300037466 | Ga0395898_0103955 | Ga0395898_0103955_520_1926 | 461 |
| 335 | 3300037471 | Ga0395905_0229543 | Ga0395905_0229543_312_1718 | 461 |
| 336 | 3300038443 | Ga0395901_0000995 | Ga0395901_0000995_25673_27079 | 461 |
| 337 | 3300038443 | Ga0395901_0007983 | Ga0395901_0007983_7100_8506 | 461 |
| 338 | 3300042876 | Ga0451577_0018307 | Ga0451577_0018307_1873_3294 | 461 |
| 339 | 3300044712 | Ga0453684_0000913 | Ga0453684_0000913_37707_39128 | 461 |
| 340 | 3300045051 | Ga0451576_0000080 | Ga0451576_0000080_203628_205049 | 461 |
| 341 | 3300046471 | Ga0495650_0022146 | Ga0495650_0022146_659_2152 | 461 |
| 342 | 3300046616 | Ga0495668_0000097 | Ga0495668_0000097_37675_39087 | 461 |
| 343 | 3300050507 | nmdc:mga05p37_67105_c1 | nmdc:mga05p37_67105_c1_1078_2481 | 461 |
| 344 | 3300050510 | nmdc:mga06r32_59919_c1 | nmdc:mga06r32_59919_c1_307_1710 | 461 |
| 345 | 3300053153 | Ga0500616_0002947 | Ga0500616_0002947_295_1707 | 461 |
| 346 | 3300003320 | rootH2_10006463 | rootH2_1000646322 | 462 |
| 347 | 3300003323 | rootH1_10004992 | rootH1_100049922 | 462 |
| 348 | 3300005327 | Ga0070658_10008208 | Ga0070658_100082084 | 462 |
| 349 | 3300005328 | Ga0070676_10000167 | Ga0070676_100001676 | 462 |
| 350 | 3300005335 | Ga0070666_10000512 | Ga0070666_1000051219 | 462 |
| 351 | 3300005336 | Ga0070680_100062841 | Ga0070680_1000628412 | 462 |
| 352 | 3300005338 | Ga0068868_100004051 | Ga0068868_1000040514 | 462 |
| 353 | 3300005341 | Ga0070691_10004449 | Ga0070691_100044494 | 462 |
| 354 | 3300005344 | Ga0070661_100005273 | Ga0070661_1000052736 | 462 |
| 355 | 3300005347 | Ga0070668_100012112 | Ga0070668_1000121124 | 462 |
| 356 | 3300005364 | Ga0070673_100003256 | Ga0070673_1000032564 | 462 |
| 357 | 3300005367 | Ga0070667_100023384 | Ga0070667_1000233842 | 462 |
| 358 | 3300005367 | Ga0070667_100028206 | Ga0070667_1000282063 | 462 |
| 359 | 3300005435 | Ga0070714_100000081 | Ga0070714_10000008159 | 462 |
| 360 | 3300005455 | Ga0070663_100065626 | Ga0070663_1000656262 | 462 |
| 361 | 3300005457 | Ga0070662_100067894 | Ga0070662_1000678943 | 462 |
| 362 | 3300005459 | Ga0068867_100000714 | Ga0068867_10000071424 | 462 |
| 363 | 3300005535 | Ga0070684_100000042 | Ga0070684_10000004264 | 462 |
| 364 | 3300005539 | Ga0068853_100004615 | Ga0068853_1000046156 | 462 |
| 365 | 3300005543 | Ga0070672_100010987 | Ga0070672_1000109873 | 462 |
| 366 | 3300005577 | Ga0068857_100002017 | Ga0068857_10000201710 | 462 |
| 367 | 3300005616 | Ga0068852_100000391 | Ga0068852_1000003915 | 462 |
| 368 | 3300005617 | Ga0068859_100172480 | Ga0068859_1001724802 | 462 |
| 369 | 3300005618 | Ga0068864_100004147 | Ga0068864_1000041475 | 462 |
| 370 | 3300005834 | Ga0068851_10002509 | Ga0068851_100025093 | 462 |
| 371 | 3300005841 | Ga0068863_100045682 | Ga0068863_1000456823 | 462 |
| 372 | 3300005842 | Ga0068858_100032949 | Ga0068858_1000329494 | 462 |
| 373 | 3300005843 | Ga0068860_100023659 | Ga0068860_1000236595 | 462 |
| 374 | 3300006237 | Ga0097621_100003397 | Ga0097621_10000339711 | 462 |
| 375 | 3300006237 | Ga0097621_100006293 | Ga0097621_1000062933 | 462 |
| 376 | 3300006358 | Ga0068871_100002146 | Ga0068871_10000214610 | 462 |
| 377 | 3300006881 | Ga0068865_100008145 | Ga0068865_1000081452 | 462 |
| 378 | 3300006931 | Ga0097620_100172496 | Ga0097620_1001724962 | 462 |
| 379 | 3300009093 | Ga0105240_10024869 | Ga0105240_100248695 | 462 |
| 380 | 3300009094 | Ga0111539_10201269 | Ga0111539_102012693 | 462 |
| 381 | 3300009098 | Ga0105245_10033821 | Ga0105245_100338213 | 462 |
| 382 | 3300009101 | Ga0105247_10004604 | Ga0105247_100046044 | 462 |
| 383 | 3300009174 | Ga0105241_10002666 | Ga0105241_100026661 | 462 |
| 384 | 3300009174 | Ga0105241_10154480 | Ga0105241_101544801 | 462 |
| 385 | 3300009176 | Ga0105242_10021494 | Ga0105242_100214944 | 462 |
| 386 | 3300009177 | Ga0105248_10033429 | Ga0105248_100334295 | 462 |
| 387 | 3300009545 | Ga0105237_10018668 | Ga0105237_100186683 | 462 |
| 388 | 3300009545 | Ga0105237_10057297 | Ga0105237_100572972 | 462 |
| 389 | 3300009551 | Ga0105238_10031735 | Ga0105238_100317354 | 462 |
| 390 | 3300009551 | Ga0105238_10149535 | Ga0105238_101495352 | 462 |
| 391 | 3300009551 | Ga0105238_10158299 | Ga0105238_101582992 | 462 |
| 392 | 3300009553 | Ga0105249_10011067 | Ga0105249_100110678 | 462 |
| 393 | 3300010375 | Ga0105239_10008508 | Ga0105239_100085086 | 462 |
| 394 | 3300011119 | Ga0105246_10030859 | Ga0105246_100308592 | 462 |
| 395 | 3300013104 | Ga0157370_10021834 | Ga0157370_100218345 | 462 |
| 396 | 3300013105 | Ga0157369_10022017 | Ga0157369_100220173 | 462 |
| 397 | 3300013296 | Ga0157374_10092994 | Ga0157374_100929942 | 462 |
| 398 | 3300013297 | Ga0157378_10026281 | Ga0157378_100262812 | 462 |
| 399 | 3300013306 | Ga0163162_10000725 | Ga0163162_1000072518 | 462 |
| 400 | 3300013306 | Ga0163162_10005264 | Ga0163162_100052645 | 462 |
| 401 | 3300013308 | Ga0157375_10000422 | Ga0157375_100004223 | 462 |
| 402 | 3300013308 | Ga0157375_10008894 | Ga0157375_100088945 | 462 |
| 403 | 3300013308 | Ga0157375_10041750 | Ga0157375_100417502 | 462 |
| 404 | 3300014325 | Ga0163163_10000526 | Ga0163163_1000052631 | 462 |
| 405 | 3300014968 | Ga0157379_10001164 | Ga0157379_100011643 | 462 |
| 406 | 3300014968 | Ga0157379_10002405 | Ga0157379_100024053 | 462 |
| 407 | 3300014968 | Ga0157379_10039691 | Ga0157379_100396913 | 462 |
| 408 | 3300014969 | Ga0157376_10000762 | Ga0157376_100007622 | 462 |
| 409 | 3300014969 | Ga0157376_10005617 | Ga0157376_100056178 | 462 |
| 410 | 3300014969 | Ga0157376_10089660 | Ga0157376_100896603 | 462 |
| 411 | 3300017792 | Ga0163161_10002456 | Ga0163161_100024562 | 462 |
| 412 | 3300025246 | Ga0209646_1003765 | Ga0209646_10037652 | 462 |
| 413 | 3300025900 | Ga0207710_10001920 | Ga0207710_100019203 | 462 |
| 414 | 3300025904 | Ga0207647_10008544 | Ga0207647_100085445 | 462 |
| 415 | 3300025904 | Ga0207647_10068340 | Ga0207647_100683402 | 462 |
| 416 | 3300025907 | Ga0207645_10007440 | Ga0207645_100074402 | 462 |
| 417 | 3300025909 | Ga0207705_10009232 | Ga0207705_100092323 | 462 |
| 418 | 3300025912 | Ga0207707_10004563 | Ga0207707_100045639 | 462 |
| 419 | 3300025913 | Ga0207695_10078895 | Ga0207695_100788953 | 462 |
| 420 | 3300025914 | Ga0207671_10008066 | Ga0207671_100080669 | 462 |
| 421 | 3300025919 | Ga0207657_10038632 | Ga0207657_100386322 | 462 |
| 422 | 3300025921 | Ga0207652_10033600 | Ga0207652_100336002 | 462 |
| 423 | 3300025924 | Ga0207694_10013486 | Ga0207694_100134865 | 462 |
| 424 | 3300025927 | Ga0207687_10037320 | Ga0207687_100373202 | 462 |
| 425 | 3300025929 | Ga0207664_10000042 | Ga0207664_1000004277 | 462 |
| 426 | 3300025933 | Ga0207706_10085304 | Ga0207706_100853042 | 462 |
| 427 | 3300025938 | Ga0207704_10011883 | Ga0207704_100118832 | 462 |
| 428 | 3300025938 | Ga0207704_10023419 | Ga0207704_100234192 | 462 |
| 429 | 3300025940 | Ga0207691_10000234 | Ga0207691_1000023439 | 462 |
| 430 | 3300025944 | Ga0207661_10122815 | Ga0207661_101228152 | 462 |
| 431 | 3300025945 | Ga0207679_10001601 | Ga0207679_100016016 | 462 |
| 432 | 3300025949 | Ga0207667_10001839 | Ga0207667_1000183917 | 462 |
| 433 | 3300025961 | Ga0207712_10005835 | Ga0207712_100058352 | 462 |
| 434 | 3300025986 | Ga0207658_10012903 | Ga0207658_100129032 | 462 |
| 435 | 3300026041 | Ga0207639_10003317 | Ga0207639_100033173 | 462 |
| 436 | 3300026088 | Ga0207641_10021966 | Ga0207641_100219663 | 462 |
| 437 | 3300026088 | Ga0207641_10029589 | Ga0207641_100295892 | 462 |
| 438 | 3300026088 | Ga0207641_10038099 | Ga0207641_100380992 | 462 |
| 439 | 3300026089 | Ga0207648_10000768 | Ga0207648_1000076837 | 462 |
| 440 | 3300026095 | Ga0207676_10029802 | Ga0207676_100298022 | 462 |
| 441 | 3300026116 | Ga0207674_10001969 | Ga0207674_1000196913 | 462 |
| 442 | 3300026116 | Ga0207674_10008183 | Ga0207674_100081836 | 462 |
| 443 | 3300026118 | Ga0207675_100097595 | Ga0207675_1000975952 | 462 |
| 444 | 3300026142 | Ga0207698_10007808 | Ga0207698_100078083 | 462 |
| 445 | 3300026142 | Ga0207698_10028600 | Ga0207698_100286004 | 462 |
| 446 | 3300028379 | Ga0268266_10040353 | Ga0268266_100403534 | 462 |
| 447 | 3300036401 | Ga0373937_0090614 | Ga0373937_0090614_954_2360 | 462 |
| 448 | 3300042007 | Ga0439449_0036161 | Ga0439449_0036161_182_1627 | 462 |
| 449 | 3300044712 | Ga0453684_0033962 | Ga0453684_0033962_5444_6859 | 462 |
| 450 | 3300044719 | Ga0466971_0011845 | Ga0466971_0011845_920_2326 | 462 |
| 451 | 3300044842 | Ga0466957_0031367 | Ga0466957_0031367_193_1599 | 462 |
| 452 | 3300045049 | Ga0466959_0000676 | Ga0466959_0000676_2815_4221 | 462 |
| 453 | 3300045836 | Ga0466958_0028859 | Ga0466958_0028859_344_1750 | 462 |
| 454 | 3300046459 | Ga0495629_0069454 | Ga0495629_0069454_908_2314 | 462 |
| 455 | 3300046472 | Ga0495580_0078617 | Ga0495580_0078617_811_2217 | 462 |
| 456 | 3300046529 | Ga0495652_0144330 | Ga0495652_0144330_69_1475 | 462 |
| 457 | 3300046536 | Ga0495587_0081831 | Ga0495587_0081831_127_1533 | 462 |
| 458 | 3300046683 | Ga0495658_0018761 | Ga0495658_0018761_142_1548 | 462 |
| 459 | 3300048904 | Ga0496101_0035015 | Ga0496101_0035015_832_2238 | 462 |
| 460 | 3300049568 | Ga0501031_0005804 | Ga0501031_0005804_2481_3911 | 462 |
| 461 | 3300049569 | Ga0501032_0003218 | Ga0501032_0003218_4126_5556 | 462 |
| 462 | 3300049570 | Ga0501033_0000030 | Ga0501033_0000030_9365_10795 | 462 |
| 463 | 3300049571 | Ga0501034_0001691 | Ga0501034_0001691_17234_18664 | 462 |
| 464 | 3300049572 | Ga0501036_0010476 | Ga0501036_0010476_2970_4400 | 462 |
| 465 | 3300049575 | Ga0501039_0125824 | Ga0501039_0125824_234_1664 | 462 |
| 466 | 3300049585 | Ga0501069_0018603 | Ga0501069_0018603_95_1501 | 462 |
| 467 | 3300049744 | Ga0501083_0095934 | Ga0501083_0095934_132_1538 | 462 |
| 468 | 3300049822 | Ga0501035_0003216 | Ga0501035_0003216_8465_9895 | 462 |
| 469 | 3300049823 | Ga0501044_0118282 | Ga0501044_0118282_674_2080 | 462 |
| 470 | 3300049824 | Ga0501045_0000123 | Ga0501045_0000123_8831_10261 | 462 |
| 471 | 3300053085 | Ga0495619_0102045 | Ga0495619_0102045_386_1792 | 462 |
| 472 | 3300061719 | Ga0466962_0008480 | Ga0466962_0008480_1723_3129 | 462 |
| 473 | 3300003320 | rootH2_10012033 | rootH2_100120333 | 463 |
| 474 | 3300005539 | Ga0068853_100025049 | Ga0068853_1000250492 | 463 |
| 475 | 3300005563 | Ga0068855_100004845 | Ga0068855_1000048452 | 463 |
| 476 | 3300005616 | Ga0068852_100069937 | Ga0068852_1000699372 | 463 |
| 477 | 3300005843 | Ga0068860_100000003 | Ga0068860_100000003297 | 463 |
| 478 | 3300005983 | Ga0081540_1020250 | Ga0081540_10202502 | 463 |
| 479 | 3300009093 | Ga0105240_10000664 | Ga0105240_100006648 | 463 |
| 480 | 3300009093 | Ga0105240_10088628 | Ga0105240_100886282 | 463 |
| 481 | 3300009093 | Ga0105240_10090171 | Ga0105240_100901712 | 463 |
| 482 | 3300009094 | Ga0111539_10032512 | Ga0111539_100325124 | 463 |
| 483 | 3300009174 | Ga0105241_10000543 | Ga0105241_100005433 | 463 |
| 484 | 3300009545 | Ga0105237_10000144 | Ga0105237_1000014462 | 463 |
| 485 | 3300009545 | Ga0105237_10006055 | Ga0105237_100060559 | 463 |
| 486 | 3300009545 | Ga0105237_10014604 | Ga0105237_100146045 | 463 |
| 487 | 3300009551 | Ga0105238_10001637 | Ga0105238_1000163713 | 463 |
| 488 | 3300010375 | Ga0105239_10029181 | Ga0105239_100291812 | 463 |
| 489 | 3300010375 | Ga0105239_10197445 | Ga0105239_101974452 | 463 |
| 490 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013364 | 463 |
| 491 | 3300013306 | Ga0163162_10003339 | Ga0163162_100033392 | 463 |
| 492 | 3300013306 | Ga0163162_10043198 | Ga0163162_100431982 | 463 |
| 493 | 3300013307 | Ga0157372_10002589 | Ga0157372_1000258910 | 463 |
| 494 | 3300013308 | Ga0157375_10021159 | Ga0157375_100211592 | 463 |
| 495 | 3300014325 | Ga0163163_10000952 | Ga0163163_1000095215 | 463 |
| 496 | 3300014325 | Ga0163163_10069982 | Ga0163163_100699823 | 463 |
| 497 | 3300014325 | Ga0163163_10198533 | Ga0163163_101985332 | 463 |
| 498 | 3300014326 | Ga0157380_10020326 | Ga0157380_100203262 | 463 |
| 499 | 3300014326 | Ga0157380_10039569 | Ga0157380_100395693 | 463 |
| 500 | 3300014969 | Ga0157376_10001116 | Ga0157376_100011167 | 463 |
| 501 | 3300025913 | Ga0207695_10001317 | Ga0207695_100013178 | 463 |
| 502 | 3300025913 | Ga0207695_10002258 | Ga0207695_1000225812 | 463 |
| 503 | 3300025914 | Ga0207671_10001368 | Ga0207671_100013684 | 463 |
| 504 | 3300025914 | Ga0207671_10011603 | Ga0207671_100116034 | 463 |
| 505 | 3300025944 | Ga0207661_10015351 | Ga0207661_100153513 | 463 |
| 506 | 3300025949 | Ga0207667_10009289 | Ga0207667_1000928910 | 463 |
| 507 | 3300026041 | Ga0207639_10017171 | Ga0207639_100171714 | 463 |
| 508 | 3300026095 | Ga0207676_10076282 | Ga0207676_100762822 | 463 |
| 509 | 3300026142 | Ga0207698_10093807 | Ga0207698_100938072 | 463 |
| 510 | 3300028381 | Ga0268264_10000063 | Ga0268264_10000063214 | 463 |
| 511 | 3300028786 | Ga0307517_10000487 | Ga0307517_100004877 | 463 |
| 512 | 3300030521 | Ga0307511_10000409 | Ga0307511_1000040932 | 463 |
| 513 | 3300031730 | Ga0307516_10067091 | Ga0307516_100670912 | 463 |
| 514 | 3300042876 | Ga0451577_0000180 | Ga0451577_0000180_64041_65477 | 463 |
| 515 | 3300044673 | Ga0453683_0000874 | Ga0453683_0000874_14285_15706 | 463 |
| 516 | 3300044712 | Ga0453684_0003831 | Ga0453684_0003831_235_1671 | 463 |
| 517 | 3300044712 | Ga0453684_0177066 | Ga0453684_0177066_1052_2461 | 463 |
| 518 | 3300046507 | Ga0495606_0006410 | Ga0495606_0006410_7532_8941 | 463 |
| 519 | 3300046648 | Ga0495611_0000061 | Ga0495611_0000061_9090_10499 | 463 |
| 520 | 3300046660 | Ga0495625_0087082 | Ga0495625_0087082_500_1939 | 463 |
| 521 | 3300047320 | Ga0495672_0007867 | Ga0495672_0007867_3825_5234 | 463 |
| 522 | 3300053727 | Ga0500611_000001 | Ga0500611_000001_283025_284452 | 463 |
| 523 | 3300003203 | JGI25406J46586_10000886 | JGI25406J46586_100008864 | 464 |
| 524 | 3300005327 | Ga0070658_10019578 | Ga0070658_100195782 | 464 |
| 525 | 3300005337 | Ga0070682_100020387 | Ga0070682_1000203871 | 464 |
| 526 | 3300005338 | Ga0068868_100032460 | Ga0068868_1000324602 | 464 |
| 527 | 3300005339 | Ga0070660_100013009 | Ga0070660_1000130093 | 464 |
| 528 | 3300005344 | Ga0070661_100022229 | Ga0070661_1000222292 | 464 |
| 529 | 3300005354 | Ga0070675_100035094 | Ga0070675_1000350943 | 464 |
| 530 | 3300005364 | Ga0070673_100014566 | Ga0070673_1000145664 | 464 |
| 531 | 3300005366 | Ga0070659_100007353 | Ga0070659_1000073533 | 464 |
| 532 | 3300005367 | Ga0070667_100140172 | Ga0070667_1001401722 | 464 |
| 533 | 3300005457 | Ga0070662_100006273 | Ga0070662_1000062737 | 464 |
| 534 | 3300005471 | Ga0070698_100004403 | Ga0070698_1000044033 | 464 |
| 535 | 3300005530 | Ga0070679_100042529 | Ga0070679_1000425291 | 464 |
| 536 | 3300005535 | Ga0070684_100015194 | Ga0070684_1000151945 | 464 |
| 537 | 3300005544 | Ga0070686_100035991 | Ga0070686_1000359912 | 464 |
| 538 | 3300005563 | Ga0068855_100007429 | Ga0068855_1000074298 | 464 |
| 539 | 3300005564 | Ga0070664_100203742 | Ga0070664_1002037421 | 464 |
| 540 | 3300005578 | Ga0068854_100041746 | Ga0068854_1000417462 | 464 |
| 541 | 3300005616 | Ga0068852_100025764 | Ga0068852_1000257642 | 464 |
| 542 | 3300005985 | Ga0081539_10000284 | Ga0081539_100002844 | 464 |
| 543 | 3300006358 | Ga0068871_100016497 | Ga0068871_1000164975 | 464 |
| 544 | 3300013104 | Ga0157370_10031180 | Ga0157370_100311803 | 464 |
| 545 | 3300013296 | Ga0157374_10002190 | Ga0157374_100021908 | 464 |
| 546 | 3300013307 | Ga0157372_10008586 | Ga0157372_100085867 | 464 |
| 547 | 3300013307 | Ga0157372_10067344 | Ga0157372_100673442 | 464 |
| 548 | 3300014968 | Ga0157379_10160506 | Ga0157379_101605062 | 464 |
| 549 | 3300025904 | Ga0207647_10009973 | Ga0207647_100099735 | 464 |
| 550 | 3300025909 | Ga0207705_10088123 | Ga0207705_100881232 | 464 |
| 551 | 3300025919 | Ga0207657_10017781 | Ga0207657_100177812 | 464 |
| 552 | 3300025921 | Ga0207652_10029001 | Ga0207652_100290012 | 464 |
| 553 | 3300025932 | Ga0207690_10073374 | Ga0207690_100733742 | 464 |
| 554 | 3300025933 | Ga0207706_10054770 | Ga0207706_100547703 | 464 |
| 555 | 3300025960 | Ga0207651_10013291 | Ga0207651_100132912 | 464 |
| 556 | 3300025981 | Ga0207640_10071643 | Ga0207640_100716432 | 464 |
| 557 | 3300026023 | Ga0207677_10013225 | Ga0207677_100132253 | 464 |
| 558 | 3300026116 | Ga0207674_10009652 | Ga0207674_100096525 | 464 |
| 559 | 3300044684 | Ga0466966_0056621 | Ga0466966_0056621_61_1473 | 464 |
| 560 | 3300044712 | Ga0453684_0087351 | Ga0453684_0087351_1452_2867 | 464 |
| 561 | 3300049571 | Ga0501034_0007368 | Ga0501034_0007368_8864_10285 | 464 |
| 562 | 3300049573 | Ga0501037_0003447 | Ga0501037_0003447_5762_7174 | 464 |
| 563 | 3300049823 | Ga0501044_0014823 | Ga0501044_0014823_4270_5682 | 464 |
| 564 | iso_pu_bacteria | 2929154850 | 2929159272 | 464 |
| 565 | 3300005617 | Ga0068859_100026078 | Ga0068859_1000260784 | 465 |
| 566 | 3300005840 | Ga0068870_10007082 | Ga0068870_100070823 | 465 |
| 567 | 3300006931 | Ga0097620_100026077 | Ga0097620_1000260774 | 465 |
| 568 | 3300009094 | Ga0111539_10002241 | Ga0111539_100022417 | 465 |
| 569 | 3300010375 | Ga0105239_10000488 | Ga0105239_1000048841 | 465 |
| 570 | 3300013297 | Ga0157378_10019445 | Ga0157378_100194455 | 465 |
| 571 | 3300013307 | Ga0157372_10007573 | Ga0157372_1000757310 | 465 |
| 572 | 3300014326 | Ga0157380_10010678 | Ga0157380_100106783 | 465 |
| 573 | 3300025926 | Ga0207659_10044302 | Ga0207659_100443023 | 465 |
| 574 | 3300026041 | Ga0207639_10004427 | Ga0207639_100044275 | 465 |
| 575 | 3300028380 | Ga0268265_10023099 | Ga0268265_100230992 | 465 |
| 576 | 3300039437 | Ga0436365_1847227 | Ga0436365_1847227_5895_7328 | 465 |
| 577 | 3300044712 | Ga0453684_0003215 | Ga0453684_0003215_20364_21785 | 465 |
| 578 | 3300046522 | Ga0495643_0007737 | Ga0495643_0007737_4382_5800 | 465 |
| 579 | 3300047320 | Ga0495672_0041504 | Ga0495672_0041504_863_2347 | 465 |
| 580 | 3300053098 | Ga0500650_0052920 | Ga0500650_0052920_168_1586 | 465 |
| 581 | iso_pu_bacteria | 2818991444 | 2819585960 | 465 |
| 582 | iso_pu_bacteria | 2840677318 | 2840678922 | 465 |
| 583 | 3300005459 | Ga0068867_100037807 | Ga0068867_1000378072 | 466 |
| 584 | 3300006237 | Ga0097621_100003853 | Ga0097621_1000038532 | 466 |
| 585 | 3300009176 | Ga0105242_10009360 | Ga0105242_100093605 | 466 |
| 586 | 3300013308 | Ga0157375_10211978 | Ga0157375_102119783 | 466 |
| 587 | 3300026089 | Ga0207648_10009463 | Ga0207648_100094636 | 466 |
| 588 | 3300031251 | Ga0265327_10000048 | Ga0265327_10000048127 | 466 |
| 589 | 3300039437 | Ga0436365_1933142 | Ga0436365_1933142_20413_21867 | 466 |
| 590 | 3300044842 | Ga0466957_0000378 | Ga0466957_0000378_7503_8921 | 466 |
| 591 | 3300050507 | nmdc:mga05p37_1394_c1 | nmdc:mga05p37_1394_c1_6941_8344 | 466 |
| 592 | 3300003320 | rootH2_10203242 | rootH2_102032422 | 467 |
| 593 | 3300003323 | rootH1_10020501 | rootH1_1002050110 | 467 |
| 594 | 3300005338 | Ga0068868_100160173 | Ga0068868_1001601731 | 467 |
| 595 | 3300005530 | Ga0070679_100187122 | Ga0070679_1001871222 | 467 |
| 596 | 3300009093 | Ga0105240_10006894 | Ga0105240_100068945 | 467 |
| 597 | 3300009093 | Ga0105240_10012199 | Ga0105240_100121994 | 467 |
| 598 | 3300010375 | Ga0105239_10001910 | Ga0105239_1000191019 | 467 |
| 599 | 3300013104 | Ga0157370_10001484 | Ga0157370_1000148416 | 467 |
| 600 | 3300013104 | Ga0157370_10008150 | Ga0157370_100081506 | 467 |
| 601 | 3300013296 | Ga0157374_10073560 | Ga0157374_100735602 | 467 |
| 602 | 3300013296 | Ga0157374_10120640 | Ga0157374_101206402 | 467 |
| 603 | 3300013306 | Ga0163162_10198327 | Ga0163162_101983272 | 467 |
| 604 | 3300013306 | Ga0163162_10345368 | Ga0163162_103453681 | 467 |
| 605 | 3300013307 | Ga0157372_10000747 | Ga0157372_1000074714 | 467 |
| 606 | 3300013307 | Ga0157372_10003494 | Ga0157372_100034942 | 467 |
| 607 | 3300025914 | Ga0207671_10050115 | Ga0207671_100501152 | 467 |
| 608 | 3300025944 | Ga0207661_10200500 | Ga0207661_102005002 | 467 |
| 609 | 3300028794 | Ga0307515_10000031 | Ga0307515_1000003152 | 467 |
| 610 | 3300031507 | Ga0307509_10080677 | Ga0307509_100806773 | 467 |
| 611 | 3300037466 | Ga0395898_0072758 | Ga0395898_0072758_120_1556 | 467 |
| 612 | 3300041406 | Ga0439439_0009758 | Ga0439439_0009758_498_1922 | 467 |
| 613 | 3300042014 | Ga0439457_000442 | Ga0439457_000442_2800_4224 | 467 |
| 614 | 3300044656 | Ga0466969_0000106 | Ga0466969_0000106_9509_10930 | 467 |
| 615 | 3300044658 | Ga0466972_0000001 | Ga0466972_0000001_171881_173302 | 467 |
| 616 | 3300044684 | Ga0466966_0094807 | Ga0466966_0094807_363_1784 | 467 |
| 617 | 3300044765 | Ga0466970_0007288 | Ga0466970_0007288_1779_3200 | 467 |
| 618 | 3300044901 | Ga0466960_0034612 | Ga0466960_0034612_230_1633 | 467 |
| 619 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_235528_236949 | 467 |
| 620 | 3300046616 | Ga0495668_0004630 | Ga0495668_0004630_2706_4109 | 467 |
| 621 | 3300049571 | Ga0501034_0178258 | Ga0501034_0178258_141_1562 | 467 |
| 622 | 3300049581 | Ga0501047_0098219 | Ga0501047_0098219_80_1501 | 467 |
| 623 | 3300049705 | Ga0501225_0004749 | Ga0501225_0004749_454_1878 | 467 |
| 624 | 3300050005 | Ga0501284_00001 | Ga0501284_00001_46119_47522 | 467 |
| 625 | 3300053092 | Ga0500583_0000019 | Ga0500583_0000019_6949_8373 | 467 |
| 626 | 3300053092 | Ga0500583_0001215 | Ga0500583_0001215_5904_7328 | 467 |
| 627 | 3300053730 | Ga0500645_007614 | Ga0500645_007614_1574_2977 | 467 |
| 628 | iso_pu_bacteria | 2884791551 | 2884796625 | 467 |
| 629 | 3300005327 | Ga0070658_10185855 | Ga0070658_101858552 | 468 |
| 630 | 3300005337 | Ga0070682_100000012 | Ga0070682_100000012195 | 468 |
| 631 | 3300049742 | Ga0501080_0182078 | Ga0501080_0182078_41_1465 | 468 |
| 632 | 3300005563 | Ga0068855_100002019 | Ga0068855_10000201913 | 469 |
| 633 | 3300006237 | Ga0097621_100151103 | Ga0097621_1001511032 | 469 |
| 634 | 3300006358 | Ga0068871_100029438 | Ga0068871_1000294385 | 469 |
| 635 | 3300009545 | Ga0105237_10107217 | Ga0105237_101072172 | 469 |
| 636 | 3300013297 | Ga0157378_10033363 | Ga0157378_100333633 | 469 |
| 637 | 3300025949 | Ga0207667_10009325 | Ga0207667_1000932513 | 469 |
| 638 | 3300026116 | Ga0207674_10043129 | Ga0207674_100431294 | 469 |
| 639 | 3300042876 | Ga0451577_0006510 | Ga0451577_0006510_8741_10153 | 469 |
| 640 | 3300042876 | Ga0451577_0135154 | Ga0451577_0135154_51_1565 | 469 |
| 641 | 3300049581 | Ga0501047_0039157 | Ga0501047_0039157_3029_4459 | 469 |
| 642 | 3300049654 | Ga0501207_000033 | Ga0501207_000033_1797_3380 | 469 |
| 643 | 3300049669 | Ga0501235_000540 | Ga0501235_000540_1260_2843 | 469 |
| 644 | 3300049688 | Ga0501259_000165 | Ga0501259_000165_7202_8785 | 469 |
| 645 | 3300049705 | Ga0501225_0002749 | Ga0501225_0002749_1586_3169 | 469 |
| 646 | 3300049707 | Ga0501234_000488 | Ga0501234_000488_4475_6058 | 469 |
| 647 | 3300049708 | Ga0501245_001209 | Ga0501245_001209_92_1675 | 469 |
| 648 | 3300049823 | Ga0501044_0001914 | Ga0501044_0001914_6083_7513 | 469 |
| 649 | 3300006195 | Ga0075366_10011536 | Ga0075366_100115363 | 470 |
| 650 | 3300044712 | Ga0453684_0044988 | Ga0453684_0044988_1073_2551 | 470 |
| 651 | 3300053090 | Ga0500646_0001999 | Ga0500646_0001999_1379_2815 | 470 |
| 652 | 3300005459 | Ga0068867_100042475 | Ga0068867_1000424751 | 471 |
| 653 | 3300014968 | Ga0157379_10199267 | Ga0157379_101992672 | 471 |
| 654 | 3300026089 | Ga0207648_10207726 | Ga0207648_102077261 | 471 |
| 655 | 3300044712 | Ga0453684_0009369 | Ga0453684_0009369_4484_5947 | 471 |
| 656 | 3300044712 | Ga0453684_0073733 | Ga0453684_0073733_1726_3261 | 471 |
| 657 | 3300003320 | rootH2_10026278 | rootH2_100262784 | 472 |
| 658 | 3300005578 | Ga0068854_100155596 | Ga0068854_1001555962 | 472 |
| 659 | 3300006358 | Ga0068871_100138060 | Ga0068871_1001380602 | 472 |
| 660 | 3300009147 | Ga0114129_10001630 | Ga0114129_1000163019 | 472 |
| 661 | 3300013104 | Ga0157370_10013389 | Ga0157370_100133896 | 472 |
| 662 | 3300037471 | Ga0395905_0009119 | Ga0395905_0009119_5893_7410 | 472 |
| 663 | 3300038443 | Ga0395901_0013422 | Ga0395901_0013422_3243_4760 | 472 |
| 664 | 3300005365 | Ga0070688_100013517 | Ga0070688_1000135172 | 473 |
| 665 | 3300013102 | Ga0157371_10025139 | Ga0157371_100251391 | 473 |
| 666 | 3300025936 | Ga0207670_10114727 | Ga0207670_101147272 | 473 |
| 667 | 3300044735 | Ga0466968_0013585 | Ga0466968_0013585_405_1877 | 474 |
| 668 | 3300049586 | Ga0501070_0087030 | Ga0501070_0087030_888_2381 | 474 |
| 669 | 3300053108 | Ga0500562_000024 | Ga0500562_000024_63489_64958 | 474 |
| 670 | 3300053156 | Ga0500622_0000353 | Ga0500622_0000353_40764_42233 | 474 |
| 671 | 3300053730 | Ga0500645_003247 | Ga0500645_003247_3378_4847 | 474 |
| 672 | 3300005331 | Ga0070670_100119985 | Ga0070670_1001199852 | 476 |
| 673 | 3300025302 | Ga0207426_1000105 | Ga0207426_100010525 | 476 |
| 674 | 3300049521 | Ga0501298_000451 | Ga0501298_000451_3512_5158 | 476 |
| 675 | 3300049569 | Ga0501032_0002685 | Ga0501032_0002685_6508_8013 | 476 |
| 676 | 3300049571 | Ga0501034_0083979 | Ga0501034_0083979_1416_2921 | 476 |
| 677 | 3300049572 | Ga0501036_0001672 | Ga0501036_0001672_8350_9855 | 476 |
| 678 | 3300049574 | Ga0501038_0029560 | Ga0501038_0029560_1806_3311 | 476 |
| 679 | 3300049581 | Ga0501047_0018063 | Ga0501047_0018063_4137_5642 | 476 |
| 680 | 3300049586 | Ga0501070_0008280 | Ga0501070_0008280_4019_5524 | 476 |
| 681 | 3300049589 | Ga0501073_0008525 | Ga0501073_0008525_266_1771 | 476 |
| 682 | 3300049590 | Ga0501074_0013058 | Ga0501074_0013058_2989_4494 | 476 |
| 683 | 3300049651 | Ga0501201_000672 | Ga0501201_000672_1329_2975 | 476 |
| 684 | 3300049661 | Ga0501217_000032 | Ga0501217_000032_6392_8038 | 476 |
| 685 | 3300049675 | Ga0501243_000061 | Ga0501243_000061_7820_9466 | 476 |
| 686 | 3300049690 | Ga0501261_000807 | Ga0501261_000807_413_2059 | 476 |
| 687 | 3300049822 | Ga0501035_0018229 | Ga0501035_0018229_3899_5404 | 476 |
| 688 | 3300025914 | Ga0207671_10095143 | Ga0207671_100951431 | 478 |
| 689 | 3300013297 | Ga0157378_10041733 | Ga0157378_100417332 | 479 |
| 690 | iso_pu_bacteria | 2818991460 | 2819676768 | 479 |
| 691 | 3300047320 | Ga0495672_0010270 | Ga0495672_0010270_2007_3605 | 480 |
| 692 | 3300002987 | JGI25159J45721_1010521 | JGI25159J45721_10105212 | 483 |
| 693 | 3300003323 | rootH1_10007795 | rootH1_1000779534 | 483 |
| 694 | 3300003354 | JGI25160J50197_1017419 | JGI25160J50197_10174192 | 483 |
| 695 | 3300005577 | Ga0068857_100032358 | Ga0068857_1000323582 | 483 |
| 696 | 3300025208 | Ga0209436_101421 | Ga0209436_1014216 | 483 |
| 697 | 3300025284 | Ga0209130_1005289 | Ga0209130_10052892 | 483 |
| 698 | 3300025302 | Ga0207426_1000033 | Ga0207426_100003388 | 483 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xj1-assembly1.cif.gz_A | crystal structure of sprlmcd | 0.918 | 15 | 482 |
| 5xj1-assembly1.cif.gz_A | crystal structure of sprlmcd | 0.9122 | 15 | 482 |
| 5zq8-assembly1.cif.gz_B | crystal structure of sprlmcd with u747 stemloop rna | 0.9113 | 15 | 483 |
| 5zq8-assembly1.cif.gz_B | crystal structure of sprlmcd with u747 stemloop rna | 0.9056 | 15 | 483 |
| 1uwv-assembly1.cif.gz_A | crystal structure of ruma, the iron-sulfur cluster containing e. coli 23s ribosomal rna 5-methyluridine methyltransferase | 0.889 | 18 | 479 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9067 | 329 | 405 | 3.40.50.150 |
| af_Q96GJ1_309_485_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9046 | 300 | 444 | 3.40.50.150 |
| 2jjqA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9013 | 307 | 477 | 3.40.50.150 |
| 1uwvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8962 | 311 | 479 | 3.40.50.150 |
| af_Q4DAH6_383_557_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8961 | 317 | 476 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519TPZ5-F1-model_v4 | 23S rRNA (Uracil-5-)-methyltransferase RumA | 0.9889 | 371 | 480 |
GO:0070041
GO:0070475 |
| AF-A0A2P7TKV7-F1-model_v4 | 23S rRNA (Uracil(1939)-C(5))-methyltransferase RlmD | 0.9821 | 15 | 480 |
GO:0070041
GO:0070475 |
| AF-A0A1A9I6H7-F1-model_v4 | 23S rRNA (Uracil-5-)-methyltransferase RumA | 0.9816 | 11 | 480 |
GO:0070041
GO:0070475 |
| AF-A0A519TPZ5-F1-model_v4 | 23S rRNA (Uracil-5-)-methyltransferase RumA | 0.98 | 371 | 480 |
GO:0070041
GO:0070475 |
| AF-A0A1V3U5X0-F1-model_v4 | 23S rRNA (Uracil-5-)-methyltransferase RumA | 0.978 | 14 | 481 |
GO:0070041
GO:0070475 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar