F473197
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 313 | 656 | 516 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0047840|Ga0466970_0047840_39_1694 |
| Length | 551 |
| Sequence | VAAAKPHPEHEKESDEAEREHPMQDDRVIIFDTTLRDGEQSPGISLNTAEKLEIAHQLARLGVDVIEAGFPIASPGDFEAVQAIAREVQGPIIAGLARAHAGDIDRAFDAVRDAERAGGARIHTFISTSDIHIEHQLQSTRADVLGQARAAVAHARELVEDVEFSPMDATRADIEYTAEVLQVALDEGATTINVPDTVGYATPDEYARFLGRLYELVPGLRDVVLSVHCHDDLGLAVANSLAGLSVGARQVECAINGLGERAGNASLEEIVMVLRTREDAVGLTTGVNTREIARTSRLVSRLTGYPEQPNKAIIGRNAFSHESGIHQDGVLKERSTYEIMDAASVGVDDANQLVLGKHSGRHALKSALAELGFEVEGHALNTAFKRFKEIADKKKQVTAMDLEALVVDELRSELAAYTLVWFDVEASSRRPPHATVELTNPEGETVRGDFTGDGPVDAIFRAINSATRREARLREFRVDAVTSGQDALGEASVVLELSXXTAAGQGVSTDIIEAAAQAYTRALSNAERKVVLAAGAAERGESSERQLAGAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 2 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.43 |
| Nodule | 0 |
| Rhizoplane | 10.64 |
| Rhizosphere | 82.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001017 | 3300000549 | Bacteria | 4286 |
| 2 | JGI24740J21852_10011271 | 3300001979 | Bacteria | 3408 |
| 3 | JGI25407J50210_10000813 | 3300003373 | Bacteria | 6659 |
| 4 | JGI25407J50210_10008812 | 3300003373 | Bacteria | 2547 |
| 5 | JGI25407J50210_10015480 | 3300003373 | Bacteria | 1970 |
| 6 | Ga0070658_10069134 | 3300005327 | Bacteria | 2889 |
| 7 | Ga0070683_100025146 | 3300005329 | Bacteria | 5344 |
| 8 | Ga0070683_100039766 | 3300005329 | Bacteria | 4320 |
| 9 | Ga0070683_100043036 | 3300005329 | Bacteria | 4161 |
| 10 | Ga0070683_100057875 | 3300005329 | Bacteria | 3601 |
| 11 | Ga0070683_100074051 | 3300005329 | Bacteria | 3180 |
| 12 | Ga0070683_100085928 | 3300005329 | Bacteria | 2950 |
| 13 | Ga0070670_100041099 | 3300005331 | Bacteria | 3974 |
| 14 | Ga0068869_100160925 | 3300005334 | Bacteria | 1748 |
| 15 | Ga0070682_100000171 | 3300005337 | Bacteria | 48470 |
| 16 | Ga0068868_100000633 | 3300005338 | Bacteria | 23661 |
| 17 | Ga0068868_100001000 | 3300005338 | Bacteria | 19303 |
| 18 | Ga0068868_100022786 | 3300005338 | Bacteria | 4733 |
| 19 | Ga0070689_100054916 | 3300005340 | Bacteria | 3084 |
| 20 | Ga0070691_10000362 | 3300005341 | Bacteria | 16367 |
| 21 | Ga0070687_100000924 | 3300005343 | Bacteria | 9926 |
| 22 | Ga0070692_10000809 | 3300005345 | Bacteria | 10396 |
| 23 | Ga0070668_100004996 | 3300005347 | Bacteria | 9824 |
| 24 | Ga0070668_100037191 | 3300005347 | Bacteria | 3716 |
| 25 | Ga0070668_100037922 | 3300005347 | Bacteria | 3682 |
| 26 | Ga0070675_100000377 | 3300005354 | Bacteria | 30146 |
| 27 | Ga0070675_100139275 | 3300005354 | Bacteria | 2073 |
| 28 | Ga0070671_100090007 | 3300005355 | Bacteria | 2569 |
| 29 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 30 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 31 | Ga0070674_100008378 | 3300005356 | Bacteria | 6155 |
| 32 | Ga0070688_100000285 | 3300005365 | Bacteria | 26015 |
| 33 | Ga0070688_100000428 | 3300005365 | Bacteria | 21246 |
| 34 | Ga0070688_100039415 | 3300005365 | Bacteria | 2890 |
| 35 | Ga0070659_100000132 | 3300005366 | Bacteria | 56931 |
| 36 | Ga0070659_100006257 | 3300005366 | Bacteria | 8605 |
| 37 | Ga0070659_100009454 | 3300005366 | Bacteria | 7161 |
| 38 | Ga0070659_100017917 | 3300005366 | Bacteria | 5336 |
| 39 | Ga0070667_100001439 | 3300005367 | Bacteria | 21347 |
| 40 | Ga0070703_10014907 | 3300005406 | Bacteria | 2219 |
| 41 | Ga0070709_10002238 | 3300005434 | Bacteria | 10487 |
| 42 | Ga0070714_100000347 | 3300005435 | Bacteria | 34714 |
| 43 | Ga0070714_100005669 | 3300005435 | Bacteria | 9554 |
| 44 | Ga0070714_100035558 | 3300005435 | Bacteria | 4176 |
| 45 | Ga0070714_100120675 | 3300005435 | Bacteria | 2331 |
| 46 | Ga0070713_100000380 | 3300005436 | Bacteria | 28361 |
| 47 | Ga0070713_100053985 | 3300005436 | Bacteria | 3332 |
| 48 | Ga0070710_10000015 | 3300005437 | Bacteria | 103891 |
| 49 | Ga0070701_10024104 | 3300005438 | Bacteria | 2940 |
| 50 | Ga0070711_100006224 | 3300005439 | Bacteria | 7184 |
| 51 | Ga0070705_100002087 | 3300005440 | Bacteria | 10198 |
| 52 | Ga0070700_100016626 | 3300005441 | Bacteria | 4194 |
| 53 | Ga0070663_100001585 | 3300005455 | Bacteria | 12522 |
| 54 | Ga0070663_100003097 | 3300005455 | Bacteria | 9512 |
| 55 | Ga0070662_100002985 | 3300005457 | Bacteria | 10516 |
| 56 | Ga0070681_10083993 | 3300005458 | Bacteria | 3136 |
| 57 | Ga0068867_100004390 | 3300005459 | Bacteria | 9921 |
| 58 | Ga0068867_100009607 | 3300005459 | Bacteria | 6820 |
| 59 | Ga0068867_100051179 | 3300005459 | Bacteria | 3046 |
| 60 | Ga0070685_10000159 | 3300005466 | Bacteria | 43951 |
| 61 | Ga0070685_10000174 | 3300005466 | Bacteria | 42617 |
| 62 | Ga0070679_100003483 | 3300005530 | Bacteria | 14409 |
| 63 | Ga0070679_100025361 | 3300005530 | Bacteria | 5817 |
| 64 | Ga0070684_100052176 | 3300005535 | Bacteria | 3555 |
| 65 | Ga0070684_100072643 | 3300005535 | Bacteria | 3029 |
| 66 | Ga0070684_100118508 | 3300005535 | Bacteria | 2379 |
| 67 | Ga0068853_100021127 | 3300005539 | Bacteria | 5420 |
| 68 | Ga0068853_100134353 | 3300005539 | Bacteria | 2217 |
| 69 | Ga0070672_100000006 | 3300005543 | Bacteria | 117060 |
| 70 | Ga0070672_100005111 | 3300005543 | Bacteria | 8655 |
| 71 | Ga0070672_100112583 | 3300005543 | Bacteria | 2220 |
| 72 | Ga0070693_100010237 | 3300005547 | Bacteria | 4692 |
| 73 | Ga0070665_100000627 | 3300005548 | Bacteria | 48156 |
| 74 | Ga0070665_100007718 | 3300005548 | Bacteria | 10923 |
| 75 | Ga0070665_100202457 | 3300005548 | Bacteria | 1986 |
| 76 | Ga0070664_100021697 | 3300005564 | Bacteria | 5296 |
| 77 | Ga0070664_100071251 | 3300005564 | Bacteria | 2978 |
| 78 | Ga0068857_100014880 | 3300005577 | Bacteria | 6785 |
| 79 | Ga0068854_100012127 | 3300005578 | Bacteria | 5638 |
| 80 | Ga0068856_100046055 | 3300005614 | Bacteria | 4295 |
| 81 | Ga0068856_100076645 | 3300005614 | Bacteria | 3313 |
| 82 | Ga0068856_100161960 | 3300005614 | Bacteria | 2248 |
| 83 | Ga0070702_100058822 | 3300005615 | Bacteria | 2228 |
| 84 | Ga0068852_100006635 | 3300005616 | Bacteria | 8385 |
| 85 | Ga0068852_100010424 | 3300005616 | Bacteria | 6946 |
| 86 | Ga0068859_100003264 | 3300005617 | Bacteria | 16511 |
| 87 | Ga0068859_100043111 | 3300005617 | Bacteria | 4534 |
| 88 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 89 | Ga0068864_100091284 | 3300005618 | Bacteria | 2687 |
| 90 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 91 | Ga0068866_10000062 | 3300005718 | Bacteria | 42082 |
| 92 | Ga0068861_100042924 | 3300005719 | Bacteria | 3391 |
| 93 | Ga0068851_10000945 | 3300005834 | Bacteria | 12571 |
| 94 | Ga0068863_100124192 | 3300005841 | Bacteria | 2462 |
| 95 | Ga0068858_100000075 | 3300005842 | Bacteria | 104349 |
| 96 | Ga0068860_100010512 | 3300005843 | Bacteria | 9150 |
| 97 | Ga0068862_100012267 | 3300005844 | Bacteria | 7086 |
| 98 | Ga0081455_10007309 | 3300005937 | Bacteria | 11650 |
| 99 | Ga0081455_10010376 | 3300005937 | Bacteria | 9464 |
| 100 | Ga0081455_10011436 | 3300005937 | Bacteria | 8918 |
| 101 | Ga0081455_10018195 | 3300005937 | Bacteria | 6707 |
| 102 | Ga0081455_10108999 | 3300005937 | Bacteria | 2204 |
| 103 | Ga0081538_10000235 | 3300005981 | Bacteria | 62346 |
| 104 | Ga0081538_10000364 | 3300005981 | Bacteria | 51665 |
| 105 | Ga0081538_10000487 | 3300005981 | Bacteria | 44314 |
| 106 | Ga0081538_10000523 | 3300005981 | Bacteria | 42849 |
| 107 | Ga0081538_10001335 | 3300005981 | Bacteria | 25371 |
| 108 | Ga0081538_10003277 | 3300005981 | Bacteria | 15371 |
| 109 | Ga0081538_10006379 | 3300005981 | Bacteria | 10398 |
| 110 | Ga0081538_10006612 | 3300005981 | Bacteria | 10165 |
| 111 | Ga0081538_10010215 | 3300005981 | Bacteria | 7712 |
| 112 | Ga0081538_10011526 | 3300005981 | Bacteria | 7157 |
| 113 | Ga0081538_10014226 | 3300005981 | Bacteria | 6243 |
| 114 | Ga0081538_10021470 | 3300005981 | Bacteria | 4712 |
| 115 | Ga0081538_10022785 | 3300005981 | Bacteria | 4524 |
| 116 | Ga0081540_1000041 | 3300005983 | Bacteria | 136874 |
| 117 | Ga0081540_1002867 | 3300005983 | Bacteria | 13938 |
| 118 | Ga0081540_1041199 | 3300005983 | Bacteria | 2397 |
| 119 | Ga0081539_10002813 | 3300005985 | Bacteria | 23253 |
| 120 | Ga0081539_10002920 | 3300005985 | Bacteria | 22553 |
| 121 | Ga0081539_10005004 | 3300005985 | Bacteria | 13998 |
| 122 | Ga0081539_10021343 | 3300005985 | Bacteria | 4332 |
| 123 | Ga0081539_10037509 | 3300005985 | Bacteria | 2887 |
| 124 | Ga0070717_10000059 | 3300006028 | Bacteria | 92958 |
| 125 | Ga0070717_10064191 | 3300006028 | Bacteria | 3049 |
| 126 | Ga0070717_10133380 | 3300006028 | Bacteria | 2137 |
| 127 | Ga0075365_10000786 | 3300006038 | Bacteria | 12956 |
| 128 | Ga0075365_10026124 | 3300006038 | Bacteria | 3704 |
| 129 | Ga0075365_10056493 | 3300006038 | Bacteria | 2609 |
| 130 | Ga0075365_10056722 | 3300006038 | Bacteria | 2604 |
| 131 | Ga0075365_10104365 | 3300006038 | Bacteria | 1943 |
| 132 | Ga0075363_100009622 | 3300006048 | Bacteria | 4551 |
| 133 | Ga0075364_10014024 | 3300006051 | Bacteria | 4942 |
| 134 | Ga0075364_10067472 | 3300006051 | Bacteria | 2351 |
| 135 | Ga0075432_10025769 | 3300006058 | Bacteria | 2017 |
| 136 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 137 | Ga0070712_100000050 | 3300006175 | Bacteria | 63870 |
| 138 | Ga0070712_100042879 | 3300006175 | Bacteria | 3112 |
| 139 | Ga0075428_100021480 | 3300006844 | Bacteria | 7144 |
| 140 | Ga0075428_100165002 | 3300006844 | Bacteria | 2403 |
| 141 | Ga0075430_100076592 | 3300006846 | Bacteria | 2804 |
| 142 | Ga0075431_100003598 | 3300006847 | Bacteria | 15020 |
| 143 | Ga0075431_100018329 | 3300006847 | Bacteria | 7127 |
| 144 | Ga0075431_100051053 | 3300006847 | Bacteria | 4266 |
| 145 | Ga0075433_10000244 | 3300006852 | Bacteria | 31446 |
| 146 | Ga0075433_10015850 | 3300006852 | Bacteria | 6195 |
| 147 | Ga0075434_100011809 | 3300006871 | Bacteria | 8252 |
| 148 | Ga0075429_100140358 | 3300006880 | Bacteria | 2115 |
| 149 | Ga0068865_100001059 | 3300006881 | Bacteria | 15817 |
| 150 | Ga0075436_100124446 | 3300006914 | Bacteria | 1806 |
| 151 | Ga0097620_100003264 | 3300006931 | Bacteria | 16511 |
| 152 | Ga0097620_100043107 | 3300006931 | Bacteria | 4534 |
| 153 | Ga0075435_100083936 | 3300007076 | Bacteria | 2620 |
| 154 | Ga0075435_100114618 | 3300007076 | Bacteria | 2243 |
| 155 | Ga0105240_10058462 | 3300009093 | Bacteria | 4814 |
| 156 | Ga0111539_10008658 | 3300009094 | Bacteria | 12914 |
| 157 | Ga0111539_10023958 | 3300009094 | Bacteria | 7499 |
| 158 | Ga0111539_10024383 | 3300009094 | Bacteria | 7423 |
| 159 | Ga0111539_10106262 | 3300009094 | Bacteria | 3293 |
| 160 | Ga0105245_10000116 | 3300009098 | Bacteria | 77303 |
| 161 | Ga0105245_10005224 | 3300009098 | Bacteria | 11408 |
| 162 | Ga0105245_10045353 | 3300009098 | Bacteria | 3926 |
| 163 | Ga0105247_10001338 | 3300009101 | Bacteria | 17979 |
| 164 | Ga0105247_10050502 | 3300009101 | Bacteria | 2559 |
| 165 | Ga0114129_10002371 | 3300009147 | Bacteria | 26160 |
| 166 | Ga0114129_10006622 | 3300009147 | Bacteria | 16448 |
| 167 | Ga0114129_10009190 | 3300009147 | Bacteria | 14093 |
| 168 | Ga0114129_10094883 | 3300009147 | Bacteria | 4131 |
| 169 | Ga0114129_10144968 | 3300009147 | Bacteria | 3253 |
| 170 | Ga0114129_10224722 | 3300009147 | Bacteria | 2531 |
| 171 | Ga0105242_10000085 | 3300009176 | Bacteria | 64353 |
| 172 | Ga0105248_10001622 | 3300009177 | Bacteria | 24979 |
| 173 | Ga0105237_10013027 | 3300009545 | Bacteria | 8731 |
| 174 | Ga0105238_10004264 | 3300009551 | Bacteria | 14206 |
| 175 | Ga0105249_10005337 | 3300009553 | Bacteria | 11088 |
| 176 | Ga0105249_10008684 | 3300009553 | Bacteria | 8854 |
| 177 | Ga0105239_10034780 | 3300010375 | Bacteria | 5534 |
| 178 | Ga0105246_10030530 | 3300011119 | Bacteria | 3561 |
| 179 | Ga0105246_10099108 | 3300011119 | Bacteria | 2118 |
| 180 | Ga0157371_10019361 | 3300013102 | Bacteria | 5021 |
| 181 | Ga0157371_10050984 | 3300013102 | Bacteria | 2940 |
| 182 | Ga0157370_10035413 | 3300013104 | Bacteria | 4852 |
| 183 | Ga0157369_10000078 | 3300013105 | Bacteria | 135173 |
| 184 | Ga0157369_10022884 | 3300013105 | Bacteria | 6968 |
| 185 | Ga0157374_10120059 | 3300013296 | Bacteria | 2536 |
| 186 | Ga0157378_10035063 | 3300013297 | Bacteria | 4436 |
| 187 | Ga0157378_10240575 | 3300013297 | Bacteria | 1729 |
| 188 | Ga0163162_10047250 | 3300013306 | Bacteria | 4314 |
| 189 | Ga0157372_10002749 | 3300013307 | Bacteria | 19018 |
| 190 | Ga0157372_10015644 | 3300013307 | Bacteria | 8135 |
| 191 | Ga0157375_10157686 | 3300013308 | Bacteria | 2409 |
| 192 | Ga0157375_10179550 | 3300013308 | Bacteria | 2268 |
| 193 | Ga0157380_10000445 | 3300014326 | Bacteria | 25326 |
| 194 | Ga0157380_10008928 | 3300014326 | Bacteria | 7163 |
| 195 | Ga0157377_10004901 | 3300014745 | Bacteria | 6230 |
| 196 | Ga0157377_10012907 | 3300014745 | Bacteria | 4213 |
| 197 | Ga0157376_10034595 | 3300014969 | Bacteria | 4081 |
| 198 | Ga0213874_10000219 | 3300021377 | Bacteria | 10689 |
| 199 | Ga0213876_10005296 | 3300021384 | Bacteria | 7098 |
| 200 | Ga0213876_10015191 | 3300021384 | Bacteria | 4078 |
| 201 | Ga0213876_10019784 | 3300021384 | Bacteria | 3556 |
| 202 | Ga0213876_10028470 | 3300021384 | Bacteria | 2946 |
| 203 | Ga0213875_10006103 | 3300021388 | Bacteria | 6372 |
| 204 | Ga0213875_10011697 | 3300021388 | Bacteria | 4356 |
| 205 | Ga0207656_10000514 | 3300025321 | Bacteria | 12807 |
| 206 | Ga0207692_10000013 | 3300025898 | Bacteria | 103819 |
| 207 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 208 | Ga0207642_10000104 | 3300025899 | Bacteria | 22584 |
| 209 | Ga0207710_10000243 | 3300025900 | Bacteria | 46286 |
| 210 | Ga0207688_10011075 | 3300025901 | Bacteria | 4907 |
| 211 | Ga0207688_10032160 | 3300025901 | Bacteria | 2898 |
| 212 | Ga0207680_10002670 | 3300025903 | Bacteria | 8340 |
| 213 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 214 | Ga0207699_10000030 | 3300025906 | Bacteria | 138384 |
| 215 | Ga0207645_10007972 | 3300025907 | Bacteria | 7430 |
| 216 | Ga0207645_10085752 | 3300025907 | Bacteria | 2022 |
| 217 | Ga0207643_10012896 | 3300025908 | Bacteria | 4520 |
| 218 | Ga0207643_10013007 | 3300025908 | Bacteria | 4498 |
| 219 | Ga0207705_10048310 | 3300025909 | Bacteria | 3060 |
| 220 | Ga0207705_10087233 | 3300025909 | Bacteria | 2281 |
| 221 | Ga0207707_10007051 | 3300025912 | Bacteria | 9798 |
| 222 | Ga0207695_10033458 | 3300025913 | Bacteria | 5605 |
| 223 | Ga0207695_10044076 | 3300025913 | Bacteria | 4748 |
| 224 | Ga0207671_10028718 | 3300025914 | Bacteria | 4155 |
| 225 | Ga0207693_10000151 | 3300025915 | Bacteria | 64033 |
| 226 | Ga0207693_10000318 | 3300025915 | Bacteria | 44789 |
| 227 | Ga0207663_10000748 | 3300025916 | Bacteria | 14481 |
| 228 | Ga0207662_10012724 | 3300025918 | Bacteria | 4691 |
| 229 | Ga0207662_10021201 | 3300025918 | Bacteria | 3711 |
| 230 | Ga0207657_10058960 | 3300025919 | Bacteria | 3301 |
| 231 | Ga0207657_10071980 | 3300025919 | Bacteria | 2926 |
| 232 | Ga0207649_10000028 | 3300025920 | Bacteria | 161482 |
| 233 | Ga0207649_10054474 | 3300025920 | Bacteria | 2489 |
| 234 | Ga0207652_10000720 | 3300025921 | Bacteria | 32059 |
| 235 | Ga0207652_10018072 | 3300025921 | Bacteria | 5780 |
| 236 | Ga0207659_10000246 | 3300025926 | Bacteria | 32971 |
| 237 | Ga0207659_10019571 | 3300025926 | Bacteria | 4459 |
| 238 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 239 | Ga0207687_10000031 | 3300025927 | Bacteria | 150246 |
| 240 | Ga0207687_10002310 | 3300025927 | Bacteria | 12979 |
| 241 | Ga0207687_10113251 | 3300025927 | Bacteria | 2017 |
| 242 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 243 | Ga0207664_10000310 | 3300025929 | Bacteria | 36142 |
| 244 | Ga0207664_10016874 | 3300025929 | Bacteria | 5338 |
| 245 | Ga0207664_10022178 | 3300025929 | Bacteria | 4737 |
| 246 | Ga0207664_10022668 | 3300025929 | Bacteria | 4693 |
| 247 | Ga0207664_10141174 | 3300025929 | Bacteria | 2038 |
| 248 | Ga0207690_10001305 | 3300025932 | Bacteria | 15653 |
| 249 | Ga0207690_10005055 | 3300025932 | Bacteria | 7788 |
| 250 | Ga0207690_10007554 | 3300025932 | Bacteria | 6452 |
| 251 | Ga0207690_10045402 | 3300025932 | Bacteria | 2902 |
| 252 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 253 | Ga0207706_10003131 | 3300025933 | Bacteria | 15890 |
| 254 | Ga0207706_10064665 | 3300025933 | Bacteria | 3221 |
| 255 | Ga0207686_10000199 | 3300025934 | Bacteria | 46373 |
| 256 | Ga0207686_10015589 | 3300025934 | Bacteria | 4252 |
| 257 | Ga0207670_10044064 | 3300025936 | Bacteria | 2950 |
| 258 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 259 | Ga0207669_10000131 | 3300025937 | Bacteria | 37319 |
| 260 | Ga0207669_10009836 | 3300025937 | Bacteria | 4574 |
| 261 | Ga0207704_10000103 | 3300025938 | Bacteria | 47628 |
| 262 | Ga0207691_10000025 | 3300025940 | Bacteria | 129424 |
| 263 | Ga0207691_10012417 | 3300025940 | Bacteria | 8165 |
| 264 | Ga0207691_10012528 | 3300025940 | Bacteria | 8129 |
| 265 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 266 | Ga0207689_10049079 | 3300025942 | Bacteria | 3482 |
| 267 | Ga0207661_10000739 | 3300025944 | Bacteria | 21204 |
| 268 | Ga0207661_10014625 | 3300025944 | Bacteria | 5755 |
| 269 | Ga0207661_10045777 | 3300025944 | Bacteria | 3465 |
| 270 | Ga0207661_10049401 | 3300025944 | Bacteria | 3348 |
| 271 | Ga0207661_10075464 | 3300025944 | Bacteria | 2766 |
| 272 | Ga0207679_10059096 | 3300025945 | Bacteria | 2844 |
| 273 | Ga0207679_10137022 | 3300025945 | Bacteria | 1972 |
| 274 | Ga0207651_10094573 | 3300025960 | Bacteria | 2198 |
| 275 | Ga0207712_10006422 | 3300025961 | Bacteria | 7417 |
| 276 | Ga0207712_10007286 | 3300025961 | Bacteria | 6977 |
| 277 | Ga0207668_10017007 | 3300025972 | Bacteria | 4551 |
| 278 | Ga0207668_10023775 | 3300025972 | Bacteria | 3945 |
| 279 | Ga0207668_10023866 | 3300025972 | Bacteria | 3939 |
| 280 | Ga0207668_10029480 | 3300025972 | Bacteria | 3597 |
| 281 | Ga0207668_10032607 | 3300025972 | Bacteria | 3444 |
| 282 | Ga0207640_10000686 | 3300025981 | Bacteria | 19687 |
| 283 | Ga0207640_10005255 | 3300025981 | Bacteria | 7047 |
| 284 | Ga0207658_10029223 | 3300025986 | Bacteria | 3890 |
| 285 | Ga0207677_10006893 | 3300026023 | Bacteria | 6245 |
| 286 | Ga0207677_10009956 | 3300026023 | Bacteria | 5362 |
| 287 | Ga0207677_10037265 | 3300026023 | Bacteria | 3177 |
| 288 | Ga0207703_10000088 | 3300026035 | Bacteria | 106080 |
| 289 | Ga0207703_10068794 | 3300026035 | Bacteria | 2918 |
| 290 | Ga0207639_10054809 | 3300026041 | Bacteria | 3049 |
| 291 | Ga0207639_10091972 | 3300026041 | Bacteria | 2430 |
| 292 | Ga0207678_10000709 | 3300026067 | Bacteria | 30420 |
| 293 | Ga0207678_10079112 | 3300026067 | Bacteria | 2815 |
| 294 | Ga0207708_10001416 | 3300026075 | Bacteria | 17970 |
| 295 | Ga0207708_10011794 | 3300026075 | Bacteria | 6510 |
| 296 | Ga0207702_10000242 | 3300026078 | Bacteria | 63808 |
| 297 | Ga0207702_10154702 | 3300026078 | Bacteria | 2089 |
| 298 | Ga0207641_10017650 | 3300026088 | Bacteria | 5845 |
| 299 | Ga0207648_10008149 | 3300026089 | Bacteria | 10188 |
| 300 | Ga0207648_10010940 | 3300026089 | Bacteria | 8573 |
| 301 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 302 | Ga0207676_10032030 | 3300026095 | Bacteria | 3958 |
| 303 | Ga0207676_10063990 | 3300026095 | Bacteria | 2923 |
| 304 | Ga0207676_10131540 | 3300026095 | Bacteria | 2128 |
| 305 | Ga0207674_10004056 | 3300026116 | Bacteria | 17754 |
| 306 | Ga0207674_10011888 | 3300026116 | Bacteria | 9758 |
| 307 | Ga0207675_100014345 | 3300026118 | Bacteria | 7388 |
| 308 | Ga0207675_100055152 | 3300026118 | Bacteria | 3707 |
| 309 | Ga0207675_100091446 | 3300026118 | Bacteria | 2861 |
| 310 | Ga0207683_10017747 | 3300026121 | Bacteria | 6069 |
| 311 | Ga0207698_10000414 | 3300026142 | Bacteria | 24644 |
| 312 | Ga0207698_10015354 | 3300026142 | Bacteria | 5125 |
| 313 | Ga0207698_10050057 | 3300026142 | Bacteria | 3185 |
| 314 | Ga0207428_10008618 | 3300027907 | Bacteria | 9207 |
| 315 | Ga0207428_10056495 | 3300027907 | Bacteria | 3119 |
| 316 | Ga0207428_10084993 | 3300027907 | Bacteria | 2465 |
| 317 | Ga0207428_10099818 | 3300027907 | Bacteria | 2244 |
| 318 | Ga0268266_10001578 | 3300028379 | Bacteria | 26646 |
| 319 | Ga0268266_10001702 | 3300028379 | Bacteria | 25200 |
| 320 | Ga0268266_10201604 | 3300028379 | Bacteria | 1821 |
| 321 | Ga0268265_10002363 | 3300028380 | Bacteria | 14287 |
| 322 | Ga0268264_10012409 | 3300028381 | Bacteria | 7013 |
| 323 | Ga0265337_1000805 | 3300028556 | Bacteria | 16508 |
| 324 | Ga0265326_10000023 | 3300028558 | Bacteria | 113142 |
| 325 | Ga0265326_10000084 | 3300028558 | Bacteria | 50129 |
| 326 | Ga0265319_1000084 | 3300028563 | Bacteria | 73879 |
| 327 | Ga0265319_1000110 | 3300028563 | Bacteria | 63277 |
| 328 | Ga0265319_1003540 | 3300028563 | Bacteria | 8105 |
| 329 | Ga0265334_10000135 | 3300028573 | Bacteria | 46602 |
| 330 | Ga0265322_10000198 | 3300028654 | Bacteria | 26588 |
| 331 | Ga0265336_10008684 | 3300028666 | Bacteria | 3547 |
| 332 | Ga0265338_10000578 | 3300028800 | Bacteria | 64450 |
| 333 | Ga0265338_10000902 | 3300028800 | Bacteria | 49948 |
| 334 | Ga0265324_10001108 | 3300029957 | Bacteria | 16206 |
| 335 | Ga0265324_10001427 | 3300029957 | Bacteria | 13711 |
| 336 | Ga0265328_10002655 | 3300031239 | Bacteria | 7996 |
| 337 | Ga0265320_10000035 | 3300031240 | Bacteria | 137855 |
| 338 | Ga0265320_10016269 | 3300031240 | Bacteria | 4173 |
| 339 | Ga0265329_10006215 | 3300031242 | Bacteria | 4758 |
| 340 | Ga0265331_10011116 | 3300031250 | Bacteria | 4938 |
| 341 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 342 | Ga0265314_10000690 | 3300031711 | Bacteria | 40955 |
| 343 | Ga0316576_10110683 | 3300031727 | Bacteria | 2058 |
| 344 | Ga0307405_10009632 | 3300031731 | Bacteria | 4962 |
| 345 | Ga0307413_10002409 | 3300031824 | Bacteria | 7591 |
| 346 | Ga0307413_10066393 | 3300031824 | Bacteria | 2251 |
| 347 | Ga0307410_10005592 | 3300031852 | Bacteria | 6676 |
| 348 | Ga0307407_10003995 | 3300031903 | Bacteria | 6169 |
| 349 | Ga0307409_100000976 | 3300031995 | Bacteria | 13349 |
| 350 | Ga0307409_100007309 | 3300031995 | Bacteria | 6596 |
| 351 | Ga0307409_100014596 | 3300031995 | Bacteria | 5118 |
| 352 | Ga0307409_100071834 | 3300031995 | Bacteria | 2753 |
| 353 | Ga0307416_100007617 | 3300032002 | Bacteria | 6907 |
| 354 | Ga0307416_100068284 | 3300032002 | Bacteria | 2936 |
| 355 | Ga0307414_10018430 | 3300032004 | Bacteria | 4298 |
| 356 | Ga0307414_10033503 | 3300032004 | Bacteria | 3397 |
| 357 | Ga0307411_10011261 | 3300032005 | Bacteria | 4817 |
| 358 | Ga0307415_100000715 | 3300032126 | Bacteria | 14842 |
| 359 | Ga0307415_100001405 | 3300032126 | Bacteria | 11505 |
| 360 | Ga0307415_100002611 | 3300032126 | Bacteria | 8988 |
| 361 | Ga0307415_100023571 | 3300032126 | Bacteria | 3823 |
| 362 | Ga0316574_0001485 | 3300035398 | Bacteria | 11177 |
| 363 | Ga0316574_0036213 | 3300035398 | Bacteria | 3020 |
| 364 | Ga0373937_0044413 | 3300036401 | Bacteria | 4058 |
| 365 | Ga0373937_0118004 | 3300036401 | Bacteria | 2471 |
| 366 | Ga0316584_0006436 | 3300036712 | Bacteria | 7950 |
| 367 | Ga0395899_0045530 | 3300037312 | Bacteria | 3269 |
| 368 | Ga0395900_0019906 | 3300037418 | Bacteria | 6841 |
| 369 | Ga0395898_0008133 | 3300037466 | Bacteria | 11104 |
| 370 | Ga0395898_0022412 | 3300037466 | Bacteria | 6397 |
| 371 | Ga0395898_0201342 | 3300037466 | Bacteria | 1901 |
| 372 | Ga0395905_0062047 | 3300037471 | Bacteria | 3496 |
| 373 | Ga0395905_0082991 | 3300037471 | Bacteria | 3003 |
| 374 | Ga0436364_0540677 | 3300037853 | Bacteria | 10501 |
| 375 | Ga0436364_0632307 | 3300037853 | Bacteria | 4747 |
| 376 | Ga0436364_0691258 | 3300037853 | Bacteria | 9089 |
| 377 | Ga0436364_0710568 | 3300037853 | Bacteria | 49951 |
| 378 | Ga0395901_0046782 | 3300038443 | Bacteria | 4494 |
| 379 | Ga0395901_0096098 | 3300038443 | Bacteria | 3105 |
| 380 | Ga0395901_0102169 | 3300038443 | Bacteria | 3008 |
| 381 | Ga0436365_0146714 | 3300039437 | Bacteria | 6706 |
| 382 | Ga0436365_0470617 | 3300039437 | Bacteria | 2277 |
| 383 | Ga0436365_0666274 | 3300039437 | Bacteria | 19604 |
| 384 | Ga0436365_0765215 | 3300039437 | Bacteria | 14228 |
| 385 | Ga0436365_0846702 | 3300039437 | Bacteria | 2406 |
| 386 | Ga0436365_0959238 | 3300039437 | Bacteria | 2365 |
| 387 | Ga0436365_1135905 | 3300039437 | Bacteria | 2186 |
| 388 | Ga0436365_1292596 | 3300039437 | Bacteria | 9373 |
| 389 | Ga0436363_1171799 | 3300039450 | Bacteria | 7388 |
| 390 | Ga0436362_0839696 | 3300039453 | Bacteria | 2679 |
| 391 | Ga0436362_0908846 | 3300039453 | Bacteria | 2479 |
| 392 | Ga0466969_0008888 | 3300044656 | Bacteria | 5328 |
| 393 | Ga0466966_0085084 | 3300044684 | Bacteria | 1966 |
| 394 | Ga0466961_0000571 | 3300044693 | Bacteria | 23411 |
| 395 | Ga0466961_0034661 | 3300044693 | Bacteria | 3240 |
| 396 | Ga0466961_0036839 | 3300044693 | Bacteria | 3139 |
| 397 | Ga0466963_0000022 | 3300044694 | Bacteria | 52600 |
| 398 | Ga0466963_0008369 | 3300044694 | Bacteria | 6197 |
| 399 | Ga0466963_0032634 | 3300044694 | Bacteria | 3374 |
| 400 | Ga0466971_0004563 | 3300044719 | Bacteria | 5989 |
| 401 | Ga0466971_0042936 | 3300044719 | Bacteria | 2032 |
| 402 | Ga0466968_0004001 | 3300044735 | Bacteria | 5478 |
| 403 | Ga0466968_0019276 | 3300044735 | Bacteria | 2746 |
| 404 | Ga0466970_0047840 | 3300044765 | Bacteria | 2280 |
| 405 | Ga0466957_0035372 | 3300044842 | Bacteria | 2997 |
| 406 | Ga0466957_0036255 | 3300044842 | Bacteria | 2964 |
| 407 | Ga0466957_0038421 | 3300044842 | Bacteria | 2884 |
| 408 | Ga0466960_0043074 | 3300044901 | Bacteria | 2145 |
| 409 | Ga0466959_0000734 | 3300045049 | Bacteria | 19135 |
| 410 | Ga0466959_0010557 | 3300045049 | Bacteria | 6610 |
| 411 | Ga0466959_0028899 | 3300045049 | Bacteria | 4108 |
| 412 | Ga0466958_0002570 | 3300045836 | Bacteria | 9161 |
| 413 | Ga0466958_0009792 | 3300045836 | Bacteria | 5347 |
| 414 | Ga0466958_0012514 | 3300045836 | Bacteria | 4810 |
| 415 | Ga0466958_0016113 | 3300045836 | Bacteria | 4300 |
| 416 | Ga0466958_0026512 | 3300045836 | Bacteria | 3425 |
| 417 | Ga0466958_0059215 | 3300045836 | Bacteria | 2330 |
| 418 | Ga0466967_0000017 | 3300045976 | Bacteria | 89904 |
| 419 | Ga0466967_0006633 | 3300045976 | Bacteria | 8229 |
| 420 | Ga0466967_0034557 | 3300045976 | Bacteria | 4293 |
| 421 | Ga0466967_0052216 | 3300045976 | Bacteria | 3587 |
| 422 | Ga0466967_0072530 | 3300045976 | Bacteria | 3086 |
| 423 | Ga0466967_0089643 | 3300045976 | Bacteria | 2792 |
| 424 | Ga0466967_0101878 | 3300045976 | Bacteria | 2625 |
| 425 | Ga0495592_0108363 | 3300046454 | Bacteria | 1969 |
| 426 | Ga0495603_0000471 | 3300046455 | Bacteria | 22167 |
| 427 | Ga0495603_0000594 | 3300046455 | Bacteria | 20327 |
| 428 | Ga0495603_0070864 | 3300046455 | Bacteria | 2049 |
| 429 | Ga0495629_0000999 | 3300046459 | Bacteria | 22693 |
| 430 | Ga0495638_0007166 | 3300046460 | Bacteria | 8030 |
| 431 | Ga0495651_0035244 | 3300046462 | Bacteria | 3898 |
| 432 | Ga0495651_0075386 | 3300046462 | Bacteria | 2557 |
| 433 | Ga0495653_0005601 | 3300046463 | Bacteria | 10245 |
| 434 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 435 | Ga0495662_0002875 | 3300046476 | Bacteria | 8712 |
| 436 | Ga0495664_0000011 | 3300046477 | Bacteria | 253351 |
| 437 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 438 | Ga0495606_0000108 | 3300046507 | Bacteria | 140473 |
| 439 | Ga0495608_0000036 | 3300046511 | Bacteria | 129609 |
| 440 | Ga0495608_0116019 | 3300046511 | Bacteria | 1718 |
| 441 | Ga0495618_0000512 | 3300046514 | Bacteria | 27479 |
| 442 | Ga0495620_0002158 | 3300046515 | Bacteria | 11431 |
| 443 | Ga0495628_0007112 | 3300046516 | Bacteria | 9694 |
| 444 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 445 | Ga0495630_0000570 | 3300046517 | Bacteria | 26861 |
| 446 | Ga0495630_0001559 | 3300046517 | Bacteria | 15919 |
| 447 | Ga0495652_0000023 | 3300046529 | Bacteria | 168049 |
| 448 | Ga0495652_0031335 | 3300046529 | Bacteria | 4657 |
| 449 | Ga0495587_0000703 | 3300046536 | Bacteria | 22378 |
| 450 | Ga0495587_0069797 | 3300046536 | Bacteria | 2045 |
| 451 | Ga0495645_0000023 | 3300046543 | Bacteria | 130982 |
| 452 | Ga0495645_0001131 | 3300046543 | Bacteria | 18053 |
| 453 | Ga0495645_0001215 | 3300046543 | Bacteria | 17592 |
| 454 | Ga0495622_0000021 | 3300046557 | Bacteria | 162267 |
| 455 | Ga0495667_0000034 | 3300046559 | Bacteria | 141464 |
| 456 | Ga0495668_0049644 | 3300046616 | Bacteria | 2327 |
| 457 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 458 | Ga0495634_0001510 | 3300046642 | Bacteria | 20589 |
| 459 | Ga0495634_0024380 | 3300046642 | Bacteria | 4245 |
| 460 | Ga0495625_0000506 | 3300046660 | Bacteria | 57832 |
| 461 | Ga0495635_0037574 | 3300046663 | Bacteria | 3352 |
| 462 | Ga0495635_0093129 | 3300046663 | Bacteria | 2060 |
| 463 | Ga0495588_0000393 | 3300046674 | Bacteria | 24845 |
| 464 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 465 | Ga0495657_0000007 | 3300046675 | Bacteria | 222471 |
| 466 | Ga0495657_0129479 | 3300046675 | Bacteria | 1582 |
| 467 | Ga0495647_0014058 | 3300046681 | Bacteria | 2784 |
| 468 | Ga0495658_0000193 | 3300046683 | Bacteria | 35142 |
| 469 | Ga0495658_0054079 | 3300046683 | Bacteria | 2282 |
| 470 | Ga0495613_0000860 | 3300046689 | Bacteria | 23282 |
| 471 | Ga0495624_0020815 | 3300046690 | Bacteria | 4358 |
| 472 | Ga0495600_0003292 | 3300046809 | Bacteria | 9474 |
| 473 | Ga0495600_0018459 | 3300046809 | Bacteria | 4445 |
| 474 | Ga0495604_0000122 | 3300047317 | Bacteria | 65938 |
| 475 | Ga0495604_0000267 | 3300047317 | Bacteria | 46398 |
| 476 | Ga0495604_0000852 | 3300047317 | Bacteria | 25474 |
| 477 | Ga0495604_0007409 | 3300047317 | Bacteria | 8692 |
| 478 | Ga0495604_0043636 | 3300047317 | Bacteria | 3509 |
| 479 | Ga0495674_0000059 | 3300047319 | Bacteria | 73353 |
| 480 | Ga0495672_0016579 | 3300047320 | Bacteria | 4959 |
| 481 | Ga0495672_0035031 | 3300047320 | Bacteria | 3094 |
| 482 | Ga0495676_0001626 | 3300047321 | Bacteria | 19533 |
| 483 | Ga0495676_0026507 | 3300047321 | Bacteria | 4988 |
| 484 | Ga0495676_0045174 | 3300047321 | Bacteria | 3588 |
| 485 | Ga0495680_0001649 | 3300047322 | Bacteria | 23717 |
| 486 | Ga0495680_0015816 | 3300047322 | Bacteria | 6495 |
| 487 | Ga0495680_0025245 | 3300047322 | Bacteria | 4921 |
| 488 | Ga0495675_0000515 | 3300047444 | Bacteria | 25086 |
| 489 | Ga0495675_0034972 | 3300047444 | Bacteria | 3209 |
| 490 | Ga0495675_0058207 | 3300047444 | Bacteria | 2451 |
| 491 | Ga0495686_0028251 | 3300047472 | Bacteria | 3653 |
| 492 | Ga0495602_0000166 | 3300048088 | Bacteria | 61220 |
| 493 | Ga0495602_0006880 | 3300048088 | Bacteria | 11952 |
| 494 | Ga0495602_0055519 | 3300048088 | Bacteria | 3488 |
| 495 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 496 | Ga0496100_0001670 | 3300048903 | Bacteria | 11011 |
| 497 | Ga0496101_0000493 | 3300048904 | Bacteria | 24897 |
| 498 | Ga0496101_0042499 | 3300048904 | Bacteria | 3244 |
| 499 | Ga0496101_0062170 | 3300048904 | Bacteria | 2714 |
| 500 | Ga0496102_0000053 | 3300048905 | Bacteria | 176385 |
| 501 | Ga0496102_0000081 | 3300048905 | Bacteria | 139266 |
| 502 | Ga0496102_0017198 | 3300048905 | Bacteria | 6331 |
| 503 | Ga0496103_0000031 | 3300048906 | Bacteria | 204016 |
| 504 | Ga0496103_0000162 | 3300048906 | Bacteria | 70675 |
| 505 | Ga0496103_0016357 | 3300048906 | Bacteria | 4427 |
| 506 | Ga0496103_0024086 | 3300048906 | Bacteria | 3672 |
| 507 | Ga0496104_0000036 | 3300048907 | Bacteria | 180472 |
| 508 | Ga0496104_0000077 | 3300048907 | Bacteria | 100848 |
| 509 | Ga0496104_0001546 | 3300048907 | Bacteria | 19843 |
| 510 | Ga0496104_0013755 | 3300048907 | Bacteria | 7298 |
| 511 | Ga0496104_0032062 | 3300048907 | Bacteria | 4890 |
| 512 | Ga0496104_0039362 | 3300048907 | Bacteria | 4427 |
| 513 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 514 | Ga0496105_0000098 | 3300048908 | Bacteria | 59301 |
| 515 | Ga0496105_0048437 | 3300048908 | Bacteria | 3508 |
| 516 | Ga0496105_0053351 | 3300048908 | Bacteria | 3339 |
| 517 | Ga0496105_0053384 | 3300048908 | Bacteria | 3338 |
| 518 | Ga0496106_0000193 | 3300048909 | Bacteria | 42951 |
| 519 | Ga0496106_0001777 | 3300048909 | Bacteria | 16096 |
| 520 | Ga0496106_0002707 | 3300048909 | Bacteria | 13148 |
| 521 | Ga0496106_0110337 | 3300048909 | Bacteria | 2141 |
| 522 | Ga0496107_0000094 | 3300048910 | Bacteria | 42797 |
| 523 | Ga0496107_0000834 | 3300048910 | Bacteria | 17990 |
| 524 | Ga0496107_0005273 | 3300048910 | Bacteria | 8829 |
| 525 | Ga0496107_0036951 | 3300048910 | Bacteria | 3504 |
| 526 | Ga0496107_0056224 | 3300048910 | Bacteria | 2843 |
| 527 | Ga0496107_0140178 | 3300048910 | Bacteria | 1787 |
| 528 | Ga0496108_0000355 | 3300048911 | Bacteria | 38685 |
| 529 | Ga0496108_0001109 | 3300048911 | Bacteria | 21079 |
| 530 | Ga0496108_0040293 | 3300048911 | Bacteria | 3893 |
| 531 | Ga0496108_0066517 | 3300048911 | Bacteria | 3039 |
| 532 | Ga0496108_0109616 | 3300048911 | Bacteria | 2359 |
| 533 | Ga0496109_0000276 | 3300048912 | Bacteria | 49120 |
| 534 | Ga0496109_0000400 | 3300048912 | Bacteria | 39194 |
| 535 | Ga0496109_0000903 | 3300048912 | Bacteria | 24701 |
| 536 | Ga0496109_0001433 | 3300048912 | Bacteria | 19779 |
| 537 | Ga0496109_0001543 | 3300048912 | Bacteria | 19146 |
| 538 | Ga0496109_0017755 | 3300048912 | Bacteria | 6241 |
| 539 | Ga0496109_0023662 | 3300048912 | Bacteria | 5452 |
| 540 | Ga0496109_0263170 | 3300048912 | Bacteria | 1624 |
| 541 | Ga0496110_0000011 | 3300048913 | Bacteria | 97293 |
| 542 | Ga0496110_0000496 | 3300048913 | Bacteria | 26770 |
| 543 | Ga0496110_0002236 | 3300048913 | Bacteria | 14470 |
| 544 | Ga0496110_0032285 | 3300048913 | Bacteria | 4521 |
| 545 | Ga0496110_0110281 | 3300048913 | Bacteria | 2472 |
| 546 | Ga0496111_0000691 | 3300048914 | Bacteria | 17813 |
| 547 | Ga0496111_0006159 | 3300048914 | Bacteria | 7765 |
| 548 | Ga0496111_0006612 | 3300048914 | Bacteria | 7543 |
| 549 | Ga0496111_0075898 | 3300048914 | Bacteria | 2449 |
| 550 | Ga0496112_0000085 | 3300048915 | Bacteria | 61255 |
| 551 | Ga0496112_0000980 | 3300048915 | Bacteria | 20831 |
| 552 | Ga0496112_0017335 | 3300048915 | Bacteria | 6764 |
| 553 | Ga0496113_0000283 | 3300048916 | Bacteria | 23978 |
| 554 | Ga0496113_0055479 | 3300048916 | Bacteria | 2970 |
| 555 | Ga0496113_0059168 | 3300048916 | Bacteria | 2886 |
| 556 | Ga0496114_0000450 | 3300048917 | Bacteria | 30262 |
| 557 | Ga0496114_0001473 | 3300048917 | Bacteria | 17863 |
| 558 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 559 | Ga0496115_0000064 | 3300048918 | Bacteria | 99309 |
| 560 | Ga0496115_0000087 | 3300048918 | Bacteria | 86513 |
| 561 | Ga0496115_0000241 | 3300048918 | Bacteria | 49730 |
| 562 | Ga0496115_0000533 | 3300048918 | Bacteria | 29638 |
| 563 | Ga0496115_0001569 | 3300048918 | Bacteria | 16428 |
| 564 | Ga0496115_0098969 | 3300048918 | Bacteria | 2389 |
| 565 | Ga0496116_0000176 | 3300048919 | Bacteria | 128426 |
| 566 | Ga0496119_0003810 | 3300048922 | Bacteria | 15414 |
| 567 | Ga0496119_0039326 | 3300048922 | Bacteria | 3041 |
| 568 | Ga0496119_0067877 | 3300048922 | Bacteria | 2101 |
| 569 | Ga0496120_0002545 | 3300048923 | Bacteria | 18180 |
| 570 | Ga0496120_0044280 | 3300048923 | Bacteria | 2587 |
| 571 | Ga0496121_0009920 | 3300048924 | Bacteria | 10841 |
| 572 | Ga0496125_0023597 | 3300048928 | Bacteria | 5674 |
| 573 | Ga0496125_0087688 | 3300048928 | Bacteria | 2349 |
| 574 | Ga0496126_0025417 | 3300048929 | Bacteria | 5697 |
| 575 | Ga0496126_0042089 | 3300048929 | Bacteria | 4221 |
| 576 | Ga0501031_0000317 | 3300049568 | Bacteria | 27571 |
| 577 | Ga0501033_0000488 | 3300049570 | Bacteria | 37325 |
| 578 | Ga0501034_0019495 | 3300049571 | Bacteria | 6937 |
| 579 | Ga0501036_0001078 | 3300049572 | Bacteria | 20682 |
| 580 | Ga0501036_0125107 | 3300049572 | Bacteria | 2171 |
| 581 | Ga0501037_0000372 | 3300049573 | Bacteria | 37292 |
| 582 | Ga0501038_0000101 | 3300049574 | Bacteria | 72459 |
| 583 | Ga0501039_0032900 | 3300049575 | Bacteria | 3999 |
| 584 | Ga0501042_0015590 | 3300049578 | Bacteria | 5206 |
| 585 | Ga0501042_0046632 | 3300049578 | Bacteria | 3090 |
| 586 | Ga0501046_0001709 | 3300049580 | Bacteria | 20963 |
| 587 | Ga0501046_0100321 | 3300049580 | Bacteria | 2222 |
| 588 | Ga0501047_0001213 | 3300049581 | Bacteria | 25583 |
| 589 | Ga0501047_0002265 | 3300049581 | Bacteria | 18413 |
| 590 | Ga0501048_0001051 | 3300049582 | Bacteria | 20671 |
| 591 | Ga0501069_0054170 | 3300049585 | Bacteria | 2234 |
| 592 | Ga0501070_0000346 | 3300049586 | Bacteria | 42122 |
| 593 | Ga0501070_0027403 | 3300049586 | Bacteria | 4780 |
| 594 | Ga0501071_0006203 | 3300049587 | Bacteria | 7753 |
| 595 | Ga0501071_0067382 | 3300049587 | Bacteria | 2603 |
| 596 | Ga0501073_0002837 | 3300049589 | Bacteria | 12987 |
| 597 | Ga0501074_0019852 | 3300049590 | Bacteria | 4881 |
| 598 | Ga0501075_0078870 | 3300049591 | Bacteria | 2493 |
| 599 | Ga0501076_0048290 | 3300049592 | Bacteria | 3365 |
| 600 | Ga0501076_0119895 | 3300049592 | Bacteria | 2130 |
| 601 | Ga0501080_0006622 | 3300049742 | Bacteria | 10420 |
| 602 | Ga0501083_0003579 | 3300049744 | Bacteria | 10891 |
| 603 | Ga0501035_0000534 | 3300049822 | Bacteria | 42484 |
| 604 | Ga0501044_0000820 | 3300049823 | Bacteria | 37419 |
| 605 | Ga0501044_0015577 | 3300049823 | Bacteria | 8192 |
| 606 | Ga0501044_0186704 | 3300049823 | Bacteria | 2037 |
| 607 | Ga0501045_0028542 | 3300049824 | Bacteria | 4026 |
| 608 | Ga0501045_0078718 | 3300049824 | Bacteria | 2430 |
| 609 | nmdc:mga03n38_21489_c1 | 3300050490 | Bacteria | 2597 |
| 610 | nmdc:mga00v17_25136_c1 | 3300050491 | Bacteria | 3459 |
| 611 | nmdc:mga00v17_50585_c1 | 3300050491 | Bacteria | 2525 |
| 612 | nmdc:mga00v17_65561_c1 | 3300050491 | Bacteria | 2241 |
| 613 | nmdc:mga0yw44_12468_c1 | 3300050492 | Bacteria | 4433 |
| 614 | nmdc:mga0yw44_5272_c1 | 3300050492 | Bacteria | 6069 |
| 615 | nmdc:mga05p37_124721_c1 | 3300050507 | Bacteria | 3163 |
| 616 | nmdc:mga05p37_19950_c1 | 3300050507 | Bacteria | 8110 |
| 617 | nmdc:mga05p37_7012_c1 | 3300050507 | Bacteria | 13281 |
| 618 | nmdc:mga05p37_99217_c1 | 3300050507 | Bacteria | 3587 |
| 619 | nmdc:mga0qj67_411_c1 | 3300050509 | Bacteria | 29303 |
| 620 | nmdc:mga06r32_112699_c1 | 3300050510 | Bacteria | 2677 |
| 621 | nmdc:mga06r32_21158_c1 | 3300050510 | Bacteria | 6002 |
| 622 | nmdc:mga06r32_2376_c1 | 3300050510 | Bacteria | 16856 |
| 623 | nmdc:mga06r32_5197_c1 | 3300050510 | Bacteria | 11698 |
| 624 | nmdc:mga06r32_77199_c1 | 3300050510 | Bacteria | 3235 |
| 625 | nmdc:mga06r32_92494_c1 | 3300050510 | Bacteria | 2957 |
| 626 | nmdc:mga08y16_119057_c1 | 3300050511 | Bacteria | 2749 |
| 627 | nmdc:mga08y16_38950_c1 | 3300050511 | Bacteria | 4989 |
| 628 | nmdc:mga08y16_97609_c1 | 3300050511 | Bacteria | 3060 |
| 629 | nmdc:mga0n895_2082_c1 | 3300050512 | Bacteria | 4347 |
| 630 | nmdc:mga0n895_47706_c1 | 3300050512 | Bacteria | 4189 |
| 631 | nmdc:mga0rr50_42089_c1 | 3300050513 | Bacteria | 3333 |
| 632 | nmdc:mga0rr50_75999_c1 | 3300050513 | Bacteria | 2577 |
| 633 | nmdc:mga0a205_45_c1 | 3300050515 | Bacteria | 68070 |
| 634 | nmdc:mga0a205_63684_c1 | 3300050515 | Bacteria | 3562 |
| 635 | nmdc:mga0a205_7640_c1 | 3300050515 | Bacteria | 9805 |
| 636 | Ga0495601_0000034 | 3300053077 | Bacteria | 93719 |
| 637 | Ga0495601_0010167 | 3300053077 | Bacteria | 5592 |
| 638 | Ga0495601_0015325 | 3300053077 | Bacteria | 4633 |
| 639 | Ga0495612_0001134 | 3300053078 | Bacteria | 10926 |
| 640 | Ga0495612_0005209 | 3300053078 | Bacteria | 5373 |
| 641 | Ga0495655_0000023 | 3300053083 | Bacteria | 39507 |
| 642 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 643 | Ga0495595_0017313 | 3300053084 | Bacteria | 3100 |
| 644 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 645 | Ga0495619_0000277 | 3300053085 | Bacteria | 36725 |
| 646 | Ga0495619_0000602 | 3300053085 | Bacteria | 23838 |
| 647 | Ga0495619_0000776 | 3300053085 | Bacteria | 20883 |
| 648 | Ga0495619_0000929 | 3300053085 | Bacteria | 19273 |
| 649 | Ga0495619_0002992 | 3300053085 | Bacteria | 10976 |
| 650 | Ga0495619_0003076 | 3300053085 | Bacteria | 10833 |
| 651 | Ga0495619_0006703 | 3300053085 | Bacteria | 7285 |
| 652 | Ga0500566_0002030 | 3300053094 | Bacteria | 11955 |
| 653 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 654 | Ga0501082_0005883 | 3300060353 | Bacteria | 10647 |
| 655 | Ga0501082_0110587 | 3300060353 | Bacteria | 2378 |
| 656 | Ga0466962_0025419 | 3300061719 | Bacteria | 2843 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0129479 | Ga0495657_0129479_213_1571 | 419 |
| 2 | 3300048905 | Ga0496102_0000053 | Ga0496102_0000053_73400_74983 | 439 |
| 3 | 3300048906 | Ga0496103_0000162 | Ga0496103_0000162_20931_22514 | 439 |
| 4 | 3300005614 | Ga0068856_100076645 | Ga0068856_1000766453 | 443 |
| 5 | 3300026078 | Ga0207702_10154702 | Ga0207702_101547021 | 443 |
| 6 | 3300005985 | Ga0081539_10002920 | Ga0081539_1000292014 | 447 |
| 7 | 3300046511 | Ga0495608_0116019 | Ga0495608_0116019_329_1708 | 449 |
| 8 | 3300005334 | Ga0068869_100160925 | Ga0068869_1001609252 | 450 |
| 9 | 3300045836 | Ga0466958_0059215 | Ga0466958_0059215_260_1855 | 451 |
| 10 | 3300005983 | Ga0081540_1002867 | Ga0081540_100286713 | 455 |
| 11 | 3300037312 | Ga0395899_0045530 | Ga0395899_0045530_1279_2847 | 458 |
| 12 | 3300038443 | Ga0395901_0102169 | Ga0395901_0102169_1047_2615 | 458 |
| 13 | 3300049568 | Ga0501031_0000317 | Ga0501031_0000317_7555_9135 | 460 |
| 14 | 3300049570 | Ga0501033_0000488 | Ga0501033_0000488_24108_25688 | 460 |
| 15 | 3300049572 | Ga0501036_0001078 | Ga0501036_0001078_11537_13117 | 460 |
| 16 | 3300049573 | Ga0501037_0000372 | Ga0501037_0000372_24112_25692 | 460 |
| 17 | 3300049574 | Ga0501038_0000101 | Ga0501038_0000101_59276_60856 | 460 |
| 18 | 3300049580 | Ga0501046_0001709 | Ga0501046_0001709_7693_9273 | 460 |
| 19 | 3300049581 | Ga0501047_0001213 | Ga0501047_0001213_16296_17876 | 460 |
| 20 | 3300049582 | Ga0501048_0001051 | Ga0501048_0001051_11538_13118 | 460 |
| 21 | 3300049586 | Ga0501070_0000346 | Ga0501070_0000346_16438_18018 | 460 |
| 22 | 3300049589 | Ga0501073_0002837 | Ga0501073_0002837_3634_5214 | 460 |
| 23 | 3300049590 | Ga0501074_0019852 | Ga0501074_0019852_3075_4655 | 460 |
| 24 | 3300049742 | Ga0501080_0006622 | Ga0501080_0006622_6149_7729 | 460 |
| 25 | 3300049744 | Ga0501083_0003579 | Ga0501083_0003579_6690_8270 | 460 |
| 26 | 3300049822 | Ga0501035_0000534 | Ga0501035_0000534_20727_22307 | 460 |
| 27 | 3300049823 | Ga0501044_0000820 | Ga0501044_0000820_11683_13263 | 460 |
| 28 | 3300049824 | Ga0501045_0028542 | Ga0501045_0028542_1884_3464 | 460 |
| 29 | 3300060353 | Ga0501082_0005883 | Ga0501082_0005883_7526_9106 | 460 |
| 30 | 3300009176 | Ga0105242_10000085 | Ga0105242_1000008516 | 461 |
| 31 | 3300021384 | Ga0213876_10015191 | Ga0213876_100151913 | 461 |
| 32 | 3300039437 | Ga0436365_0666274 | Ga0436365_0666274_6332_7924 | 461 |
| 33 | 3300048928 | Ga0496125_0087688 | Ga0496125_0087688_422_2026 | 461 |
| 34 | 3300003373 | JGI25407J50210_10008812 | JGI25407J50210_100088122 | 462 |
| 35 | 3300005981 | Ga0081538_10000235 | Ga0081538_1000023557 | 462 |
| 36 | 3300028379 | Ga0268266_10001702 | Ga0268266_100017028 | 462 |
| 37 | 3300047321 | Ga0495676_0026507 | Ga0495676_0026507_2747_4330 | 465 |
| 38 | 3300046455 | Ga0495603_0070864 | Ga0495603_0070864_168_1763 | 466 |
| 39 | 3300044656 | Ga0466969_0008888 | Ga0466969_0008888_701_2269 | 467 |
| 40 | 3300044693 | Ga0466961_0034661 | Ga0466961_0034661_1387_2955 | 467 |
| 41 | 3300045836 | Ga0466958_0009792 | Ga0466958_0009792_2504_4072 | 467 |
| 42 | 3300044684 | Ga0466966_0085084 | Ga0466966_0085084_27_1595 | 468 |
| 43 | 3300044693 | Ga0466961_0000571 | Ga0466961_0000571_7533_9101 | 468 |
| 44 | 3300045049 | Ga0466959_0010557 | Ga0466959_0010557_574_2142 | 468 |
| 45 | 3300045836 | Ga0466958_0012514 | Ga0466958_0012514_117_1685 | 468 |
| 46 | 3300005937 | Ga0081455_10007309 | Ga0081455_100073098 | 470 |
| 47 | 3300037418 | Ga0395900_0019906 | Ga0395900_0019906_4640_6211 | 471 |
| 48 | 3300044735 | Ga0466968_0004001 | Ga0466968_0004001_3057_4625 | 471 |
| 49 | 3300048918 | Ga0496115_0000064 | Ga0496115_0000064_48102_49730 | 471 |
| 50 | 3300048918 | Ga0496115_0000241 | Ga0496115_0000241_33185_34825 | 471 |
| 51 | 3300050512 | nmdc:mga0n895_47706_c1 | nmdc:mga0n895_47706_c1_707_2305 | 471 |
| 52 | 3300050513 | nmdc:mga0rr50_75999_c1 | nmdc:mga0rr50_75999_c1_338_1936 | 471 |
| 53 | 3300035398 | Ga0316574_0001485 | Ga0316574_0001485_8112_9704 | 472 |
| 54 | 3300009545 | Ga0105237_10013027 | Ga0105237_100130279 | 474 |
| 55 | 3300025914 | Ga0207671_10028718 | Ga0207671_100287183 | 474 |
| 56 | 3300044694 | Ga0466963_0032634 | Ga0466963_0032634_796_2361 | 474 |
| 57 | 3300045836 | Ga0466958_0016113 | Ga0466958_0016113_2679_4265 | 474 |
| 58 | 3300045976 | Ga0466967_0089643 | Ga0466967_0089643_626_2191 | 474 |
| 59 | 3300048911 | Ga0496108_0066517 | Ga0496108_0066517_1267_2889 | 475 |
| 60 | 3300005329 | Ga0070683_100085928 | Ga0070683_1000859282 | 478 |
| 61 | 3300005331 | Ga0070670_100041099 | Ga0070670_1000410994 | 478 |
| 62 | 3300005343 | Ga0070687_100000924 | Ga0070687_10000092411 | 478 |
| 63 | 3300005365 | Ga0070688_100039415 | Ga0070688_1000394151 | 478 |
| 64 | 3300005614 | Ga0068856_100046055 | Ga0068856_1000460554 | 478 |
| 65 | 3300009093 | Ga0105240_10058462 | Ga0105240_100584622 | 478 |
| 66 | 3300013296 | Ga0157374_10120059 | Ga0157374_101200592 | 478 |
| 67 | 3300025913 | Ga0207695_10044076 | Ga0207695_100440765 | 478 |
| 68 | 3300026075 | Ga0207708_10001416 | Ga0207708_1000141614 | 478 |
| 69 | 3300037466 | Ga0395898_0022412 | Ga0395898_0022412_582_2177 | 478 |
| 70 | 3300005615 | Ga0070702_100058822 | Ga0070702_1000588222 | 479 |
| 71 | 3300046462 | Ga0495651_0035244 | Ga0495651_0035244_1020_2606 | 479 |
| 72 | 3300049587 | Ga0501071_0006203 | Ga0501071_0006203_5840_7444 | 479 |
| 73 | 3300049823 | Ga0501044_0186704 | Ga0501044_0186704_358_1962 | 479 |
| 74 | 3300037853 | Ga0436364_0691258 | Ga0436364_0691258_6263_7849 | 481 |
| 75 | 3300039437 | Ga0436365_0959238 | Ga0436365_0959238_593_2179 | 481 |
| 76 | 3300014745 | Ga0157377_10012907 | Ga0157377_100129074 | 483 |
| 77 | 3300050491 | nmdc:mga00v17_65561_c1 | nmdc:mga00v17_65561_c1_396_1991 | 483 |
| 78 | 3300005981 | Ga0081538_10021470 | Ga0081538_100214704 | 484 |
| 79 | 3300028558 | Ga0265326_10000023 | Ga0265326_1000002376 | 485 |
| 80 | 3300028573 | Ga0265334_10000135 | Ga0265334_1000013528 | 485 |
| 81 | 3300028666 | Ga0265336_10008684 | Ga0265336_100086842 | 485 |
| 82 | 3300028800 | Ga0265338_10000902 | Ga0265338_1000090233 | 485 |
| 83 | 3300029957 | Ga0265324_10001427 | Ga0265324_100014274 | 485 |
| 84 | 3300005548 | Ga0070665_100000627 | Ga0070665_10000062733 | 486 |
| 85 | 3300025933 | Ga0207706_10064665 | Ga0207706_100646651 | 486 |
| 86 | 3300028563 | Ga0265319_1003540 | Ga0265319_10035402 | 486 |
| 87 | 3300045976 | Ga0466967_0006633 | Ga0466967_0006633_1580_3142 | 486 |
| 88 | 3300050515 | nmdc:mga0a205_63684_c1 | nmdc:mga0a205_63684_c1_1389_2987 | 486 |
| 89 | 3300037466 | Ga0395898_0008133 | Ga0395898_0008133_4646_6241 | 487 |
| 90 | 3300037471 | Ga0395905_0062047 | Ga0395905_0062047_499_2094 | 487 |
| 91 | 3300038443 | Ga0395901_0046782 | Ga0395901_0046782_2013_3608 | 487 |
| 92 | 3300038443 | Ga0395901_0096098 | Ga0395901_0096098_1031_2587 | 487 |
| 93 | 3300006880 | Ga0075429_100140358 | Ga0075429_1001403582 | 488 |
| 94 | 3300049572 | Ga0501036_0125107 | Ga0501036_0125107_40_1596 | 488 |
| 95 | 3300049587 | Ga0501071_0067382 | Ga0501071_0067382_94_1650 | 488 |
| 96 | 3300049824 | Ga0501045_0078718 | Ga0501045_0078718_817_2373 | 488 |
| 97 | 3300060353 | Ga0501082_0110587 | Ga0501082_0110587_414_1970 | 488 |
| 98 | 3300005437 | Ga0070710_10000015 | Ga0070710_1000001515 | 489 |
| 99 | 3300025898 | Ga0207692_10000013 | Ga0207692_1000001384 | 489 |
| 100 | 3300044719 | Ga0466971_0042936 | Ga0466971_0042936_269_1831 | 489 |
| 101 | 3300049580 | Ga0501046_0100321 | Ga0501046_0100321_614_2173 | 489 |
| 102 | 3300005981 | Ga0081538_10010215 | Ga0081538_100102156 | 491 |
| 103 | 3300005983 | Ga0081540_1000041 | Ga0081540_1000041122 | 491 |
| 104 | 3300046477 | Ga0495664_0000011 | Ga0495664_0000011_36190_37782 | 491 |
| 105 | 3300005406 | Ga0070703_10014907 | Ga0070703_100149071 | 492 |
| 106 | 3300025934 | Ga0207686_10000199 | Ga0207686_1000019916 | 492 |
| 107 | 3300048929 | Ga0496126_0025417 | Ga0496126_0025417_2412_4016 | 492 |
| 108 | 3300049581 | Ga0501047_0002265 | Ga0501047_0002265_4658_6238 | 492 |
| 109 | 3300053094 | Ga0500566_0002030 | Ga0500566_0002030_8112_9698 | 492 |
| 110 | 3300061719 | Ga0466962_0025419 | Ga0466962_0025419_548_2137 | 492 |
| 111 | 3300005327 | Ga0070658_10069134 | Ga0070658_100691343 | 493 |
| 112 | 3300005329 | Ga0070683_100025146 | Ga0070683_1000251463 | 493 |
| 113 | 3300005340 | Ga0070689_100054916 | Ga0070689_1000549162 | 493 |
| 114 | 3300005345 | Ga0070692_10000809 | Ga0070692_100008092 | 493 |
| 115 | 3300005347 | Ga0070668_100037922 | Ga0070668_1000379222 | 493 |
| 116 | 3300005356 | Ga0070674_100000004 | Ga0070674_100000004153 | 493 |
| 117 | 3300005366 | Ga0070659_100009454 | Ga0070659_1000094547 | 493 |
| 118 | 3300005455 | Ga0070663_100001585 | Ga0070663_10000158512 | 493 |
| 119 | 3300005459 | Ga0068867_100004390 | Ga0068867_1000043902 | 493 |
| 120 | 3300005539 | Ga0068853_100021127 | Ga0068853_1000211274 | 493 |
| 121 | 3300005543 | Ga0070672_100005111 | Ga0070672_1000051115 | 493 |
| 122 | 3300005718 | Ga0068866_10000004 | Ga0068866_10000004190 | 493 |
| 123 | 3300006038 | Ga0075365_10056722 | Ga0075365_100567222 | 493 |
| 124 | 3300006048 | Ga0075363_100009622 | Ga0075363_1000096224 | 493 |
| 125 | 3300006051 | Ga0075364_10014024 | Ga0075364_100140242 | 493 |
| 126 | 3300014326 | Ga0157380_10008928 | Ga0157380_100089285 | 493 |
| 127 | 3300014745 | Ga0157377_10004901 | Ga0157377_100049012 | 493 |
| 128 | 3300025899 | Ga0207642_10000005 | Ga0207642_1000000517 | 493 |
| 129 | 3300025901 | Ga0207688_10011075 | Ga0207688_100110754 | 493 |
| 130 | 3300025909 | Ga0207705_10048310 | Ga0207705_100483103 | 493 |
| 131 | 3300025932 | Ga0207690_10045402 | Ga0207690_100454022 | 493 |
| 132 | 3300025937 | Ga0207669_10000131 | Ga0207669_1000013115 | 493 |
| 133 | 3300025940 | Ga0207691_10012528 | Ga0207691_100125285 | 493 |
| 134 | 3300025944 | Ga0207661_10049401 | Ga0207661_100494013 | 493 |
| 135 | 3300025944 | Ga0207661_10075464 | Ga0207661_100754642 | 493 |
| 136 | 3300025945 | Ga0207679_10137022 | Ga0207679_101370221 | 493 |
| 137 | 3300025960 | Ga0207651_10094573 | Ga0207651_100945732 | 493 |
| 138 | 3300025972 | Ga0207668_10029480 | Ga0207668_100294804 | 493 |
| 139 | 3300026023 | Ga0207677_10037265 | Ga0207677_100372652 | 493 |
| 140 | 3300026041 | Ga0207639_10054809 | Ga0207639_100548092 | 493 |
| 141 | 3300026089 | Ga0207648_10008149 | Ga0207648_1000814912 | 493 |
| 142 | 3300026095 | Ga0207676_10063990 | Ga0207676_100639903 | 493 |
| 143 | 3300026142 | Ga0207698_10050057 | Ga0207698_100500573 | 493 |
| 144 | 3300044693 | Ga0466961_0036839 | Ga0466961_0036839_749_2335 | 493 |
| 145 | 3300044719 | Ga0466971_0004563 | Ga0466971_0004563_2361_3947 | 493 |
| 146 | 3300044842 | Ga0466957_0038421 | Ga0466957_0038421_619_2205 | 493 |
| 147 | 3300045049 | Ga0466959_0028899 | Ga0466959_0028899_2131_3717 | 493 |
| 148 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_204989_206575 | 493 |
| 149 | 3300046536 | Ga0495587_0069797 | Ga0495587_0069797_296_1882 | 493 |
| 150 | 3300046683 | Ga0495658_0000193 | Ga0495658_0000193_18045_19631 | 493 |
| 151 | 3300047317 | Ga0495604_0000267 | Ga0495604_0000267_15158_16744 | 493 |
| 152 | 3300048909 | Ga0496106_0110337 | Ga0496106_0110337_401_2020 | 493 |
| 153 | 3300048911 | Ga0496108_0109616 | Ga0496108_0109616_186_1805 | 493 |
| 154 | 3300048912 | Ga0496109_0001543 | Ga0496109_0001543_13827_15446 | 493 |
| 155 | 3300048913 | Ga0496110_0110281 | Ga0496110_0110281_814_2433 | 493 |
| 156 | 3300050510 | nmdc:mga06r32_21158_c1 | nmdc:mga06r32_21158_c1_209_1804 | 493 |
| 157 | 3300053083 | Ga0495655_0000023 | Ga0495655_0000023_19599_21185 | 493 |
| 158 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_421282_422868 | 493 |
| 159 | 3300006163 | Ga0070715_10000014 | Ga0070715_10000014150 | 494 |
| 160 | 3300006852 | Ga0075433_10000244 | Ga0075433_1000024417 | 494 |
| 161 | 3300025905 | Ga0207685_10000025 | Ga0207685_1000002517 | 494 |
| 162 | 3300046476 | Ga0495662_0002875 | Ga0495662_0002875_6207_7805 | 494 |
| 163 | 3300046642 | Ga0495634_0001510 | Ga0495634_0001510_15188_16774 | 494 |
| 164 | 3300050515 | nmdc:mga0a205_45_c1 | nmdc:mga0a205_45_c1_15730_17316 | 494 |
| 165 | 3300053085 | Ga0495619_0006703 | Ga0495619_0006703_3311_4897 | 494 |
| 166 | 3300048911 | Ga0496108_0001109 | Ga0496108_0001109_1788_3386 | 495 |
| 167 | 3300048912 | Ga0496109_0001433 | Ga0496109_0001433_15368_16966 | 495 |
| 168 | 3300048915 | Ga0496112_0000085 | Ga0496112_0000085_16759_18348 | 495 |
| 169 | 3300049586 | Ga0501070_0027403 | Ga0501070_0027403_244_1839 | 495 |
| 170 | 3300013104 | Ga0157370_10035413 | Ga0157370_100354132 | 496 |
| 171 | 3300028563 | Ga0265319_1000084 | Ga0265319_100008414 | 496 |
| 172 | 3300031240 | Ga0265320_10016269 | Ga0265320_100162693 | 496 |
| 173 | 3300047322 | Ga0495680_0025245 | Ga0495680_0025245_916_2502 | 496 |
| 174 | 3300048905 | Ga0496102_0000081 | Ga0496102_0000081_119732_121318 | 496 |
| 175 | 3300048906 | Ga0496103_0000031 | Ga0496103_0000031_17026_18612 | 496 |
| 176 | 3300048917 | Ga0496114_0000450 | Ga0496114_0000450_11667_13253 | 496 |
| 177 | 3300048918 | Ga0496115_0000533 | Ga0496115_0000533_11656_13242 | 496 |
| 178 | 3300021384 | Ga0213876_10019784 | Ga0213876_100197843 | 497 |
| 179 | 3300039437 | Ga0436365_0765215 | Ga0436365_0765215_100_1689 | 497 |
| 180 | 3300039453 | Ga0436362_0839696 | Ga0436362_0839696_272_1861 | 497 |
| 181 | 3300048919 | Ga0496116_0000176 | Ga0496116_0000176_114568_116172 | 497 |
| 182 | 3300048922 | Ga0496119_0039326 | Ga0496119_0039326_108_1712 | 497 |
| 183 | 3300046557 | Ga0495622_0000021 | Ga0495622_0000021_123538_125124 | 498 |
| 184 | 3300049578 | Ga0501042_0015590 | Ga0501042_0015590_1299_2894 | 498 |
| 185 | 3300005347 | Ga0070668_100037191 | Ga0070668_1000371913 | 499 |
| 186 | 3300005356 | Ga0070674_100008378 | Ga0070674_1000083782 | 499 |
| 187 | 3300005459 | Ga0068867_100051179 | Ga0068867_1000511793 | 499 |
| 188 | 3300006038 | Ga0075365_10000786 | Ga0075365_1000078614 | 499 |
| 189 | 3300006847 | Ga0075431_100003598 | Ga0075431_10000359813 | 499 |
| 190 | 3300009094 | Ga0111539_10008658 | Ga0111539_1000865811 | 499 |
| 191 | 3300009147 | Ga0114129_10094883 | Ga0114129_100948833 | 499 |
| 192 | 3300025937 | Ga0207669_10009836 | Ga0207669_100098362 | 499 |
| 193 | 3300025972 | Ga0207668_10017007 | Ga0207668_100170072 | 499 |
| 194 | 3300026118 | Ga0207675_100091446 | Ga0207675_1000914462 | 499 |
| 195 | 3300027907 | Ga0207428_10084993 | Ga0207428_100849932 | 499 |
| 196 | 3300046543 | Ga0495645_0001215 | Ga0495645_0001215_2632_4218 | 499 |
| 197 | 3300046642 | Ga0495634_0000028 | Ga0495634_0000028_97303_98889 | 499 |
| 198 | 3300050490 | nmdc:mga03n38_21489_c1 | nmdc:mga03n38_21489_c1_641_2236 | 499 |
| 199 | 3300050491 | nmdc:mga00v17_50585_c1 | nmdc:mga00v17_50585_c1_128_1723 | 499 |
| 200 | 3300050492 | nmdc:mga0yw44_5272_c1 | nmdc:mga0yw44_5272_c1_3646_5241 | 499 |
| 201 | 3300050507 | nmdc:mga05p37_99217_c1 | nmdc:mga05p37_99217_c1_516_2111 | 499 |
| 202 | 3300050510 | nmdc:mga06r32_5197_c1 | nmdc:mga06r32_5197_c1_4304_5899 | 499 |
| 203 | 3300005338 | Ga0068868_100000633 | Ga0068868_10000063317 | 500 |
| 204 | 3300005981 | Ga0081538_10000523 | Ga0081538_100005232 | 500 |
| 205 | 3300026023 | Ga0207677_10006893 | Ga0207677_100068934 | 500 |
| 206 | 3300046515 | Ga0495620_0002158 | Ga0495620_0002158_6676_8262 | 500 |
| 207 | 3300046642 | Ga0495634_0024380 | Ga0495634_0024380_2377_3963 | 500 |
| 208 | 3300048906 | Ga0496103_0024086 | Ga0496103_0024086_1143_2726 | 500 |
| 209 | 3300048912 | Ga0496109_0000276 | Ga0496109_0000276_18724_20343 | 500 |
| 210 | 3300005338 | Ga0068868_100022786 | Ga0068868_1000227862 | 501 |
| 211 | 3300005842 | Ga0068858_100000075 | Ga0068858_10000007582 | 501 |
| 212 | 3300026035 | Ga0207703_10000088 | Ga0207703_1000008882 | 501 |
| 213 | 3300048910 | Ga0496107_0140178 | Ga0496107_0140178_103_1662 | 501 |
| 214 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_288929_290527 | 501 |
| 215 | 3300014969 | Ga0157376_10034595 | Ga0157376_100345952 | 502 |
| 216 | 3300026118 | Ga0207675_100055152 | Ga0207675_1000551523 | 502 |
| 217 | 3300003373 | JGI25407J50210_10000813 | JGI25407J50210_100008134 | 503 |
| 218 | 3300005981 | Ga0081538_10000364 | Ga0081538_1000036440 | 503 |
| 219 | 3300044694 | Ga0466963_0008369 | Ga0466963_0008369_3285_4874 | 503 |
| 220 | 3300044735 | Ga0466968_0019276 | Ga0466968_0019276_1146_2735 | 503 |
| 221 | 3300044842 | Ga0466957_0035372 | Ga0466957_0035372_873_2462 | 503 |
| 222 | 3300045049 | Ga0466959_0000734 | Ga0466959_0000734_705_2294 | 503 |
| 223 | 3300045836 | Ga0466958_0002570 | Ga0466958_0002570_4183_5772 | 503 |
| 224 | 3300048088 | Ga0495602_0055519 | Ga0495602_0055519_360_1979 | 503 |
| 225 | 3300048910 | Ga0496107_0056224 | Ga0496107_0056224_114_1718 | 503 |
| 226 | 3300048922 | Ga0496119_0003810 | Ga0496119_0003810_13113_14717 | 503 |
| 227 | 3300048924 | Ga0496121_0009920 | Ga0496121_0009920_6233_7837 | 503 |
| 228 | iso_pu_bacteria | 2524614857 | 2526060492 | 503 |
| 229 | iso_pu_bacteria | 2739367875 | 2740063222 | 503 |
| 230 | 3300005329 | Ga0070683_100043036 | Ga0070683_1000430362 | 504 |
| 231 | 3300005355 | Ga0070671_100090007 | Ga0070671_1000900072 | 504 |
| 232 | 3300005366 | Ga0070659_100017917 | Ga0070659_1000179172 | 504 |
| 233 | 3300005438 | Ga0070701_10024104 | Ga0070701_100241041 | 504 |
| 234 | 3300005617 | Ga0068859_100043111 | Ga0068859_1000431112 | 504 |
| 235 | 3300006931 | Ga0097620_100043107 | Ga0097620_1000431074 | 504 |
| 236 | 3300011119 | Ga0105246_10099108 | Ga0105246_100991082 | 504 |
| 237 | 3300025908 | Ga0207643_10012896 | Ga0207643_100128962 | 504 |
| 238 | 3300025918 | Ga0207662_10021201 | Ga0207662_100212013 | 504 |
| 239 | 3300025927 | Ga0207687_10113251 | Ga0207687_101132512 | 504 |
| 240 | 3300025942 | Ga0207689_10049079 | Ga0207689_100490792 | 504 |
| 241 | 3300026041 | Ga0207639_10091972 | Ga0207639_100919722 | 504 |
| 242 | 3300026095 | Ga0207676_10032030 | Ga0207676_100320303 | 504 |
| 243 | 3300046511 | Ga0495608_0000036 | Ga0495608_0000036_111235_112830 | 504 |
| 244 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_111235_112830 | 504 |
| 245 | 3300047444 | Ga0495675_0000515 | Ga0495675_0000515_16803_18398 | 504 |
| 246 | 3300048907 | Ga0496104_0032062 | Ga0496104_0032062_2137_3708 | 504 |
| 247 | 3300048908 | Ga0496105_0053351 | Ga0496105_0053351_194_1765 | 504 |
| 248 | 3300048910 | Ga0496107_0036951 | Ga0496107_0036951_406_1977 | 504 |
| 249 | 3300048912 | Ga0496109_0023662 | Ga0496109_0023662_15_1586 | 504 |
| 250 | 3300048918 | Ga0496115_0098969 | Ga0496115_0098969_22_1593 | 504 |
| 251 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_332812_334407 | 504 |
| 252 | 3300053085 | Ga0495619_0000776 | Ga0495619_0000776_1014_2609 | 504 |
| 253 | 3300005535 | Ga0070684_100072643 | Ga0070684_1000726431 | 505 |
| 254 | 3300021388 | Ga0213875_10006103 | Ga0213875_100061032 | 505 |
| 255 | 3300028563 | Ga0265319_1000110 | Ga0265319_100011046 | 505 |
| 256 | 3300028800 | Ga0265338_10000578 | Ga0265338_1000057847 | 505 |
| 257 | 3300037853 | Ga0436364_0710568 | Ga0436364_0710568_48211_49809 | 505 |
| 258 | 3300046463 | Ga0495653_0005601 | Ga0495653_0005601_55_1599 | 505 |
| 259 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_16154_17740 | 505 |
| 260 | 3300048904 | Ga0496101_0000493 | Ga0496101_0000493_7217_8803 | 505 |
| 261 | 3300048909 | Ga0496106_0000193 | Ga0496106_0000193_16104_17690 | 505 |
| 262 | 3300048910 | Ga0496107_0000094 | Ga0496107_0000094_15973_17559 | 505 |
| 263 | 3300048928 | Ga0496125_0023597 | Ga0496125_0023597_2908_4524 | 505 |
| 264 | 3300005329 | Ga0070683_100057875 | Ga0070683_1000578752 | 506 |
| 265 | 3300005535 | Ga0070684_100052176 | Ga0070684_1000521761 | 506 |
| 266 | 3300005564 | Ga0070664_100021697 | Ga0070664_1000216971 | 506 |
| 267 | 3300005577 | Ga0068857_100014880 | Ga0068857_1000148805 | 506 |
| 268 | 3300005618 | Ga0068864_100091284 | Ga0068864_1000912842 | 506 |
| 269 | 3300025909 | Ga0207705_10087233 | Ga0207705_100872332 | 506 |
| 270 | 3300025919 | Ga0207657_10058960 | Ga0207657_100589602 | 506 |
| 271 | 3300025920 | Ga0207649_10054474 | Ga0207649_100544742 | 506 |
| 272 | 3300025945 | Ga0207679_10059096 | Ga0207679_100590961 | 506 |
| 273 | 3300026095 | Ga0207676_10131540 | Ga0207676_101315401 | 506 |
| 274 | 3300026116 | Ga0207674_10004056 | Ga0207674_1000405614 | 506 |
| 275 | 3300031824 | Ga0307413_10002409 | Ga0307413_100024093 | 506 |
| 276 | 3300031903 | Ga0307407_10003995 | Ga0307407_100039956 | 506 |
| 277 | 3300031995 | Ga0307409_100014596 | Ga0307409_1000145962 | 506 |
| 278 | 3300032002 | Ga0307416_100007617 | Ga0307416_1000076179 | 506 |
| 279 | 3300032004 | Ga0307414_10018430 | Ga0307414_100184304 | 506 |
| 280 | 3300032126 | Ga0307415_100001405 | Ga0307415_1000014057 | 506 |
| 281 | 3300046517 | Ga0495630_0000570 | Ga0495630_0000570_18012_19559 | 506 |
| 282 | 3300046675 | Ga0495657_0000007 | Ga0495657_0000007_206139_207686 | 506 |
| 283 | 3300047444 | Ga0495675_0058207 | Ga0495675_0058207_44_1696 | 506 |
| 284 | 3300048915 | Ga0496112_0017335 | Ga0496112_0017335_3513_5159 | 506 |
| 285 | 3300048916 | Ga0496113_0055479 | Ga0496113_0055479_791_2437 | 506 |
| 286 | 3300003373 | JGI25407J50210_10015480 | JGI25407J50210_100154802 | 507 |
| 287 | 3300005617 | Ga0068859_100003264 | Ga0068859_1000032642 | 507 |
| 288 | 3300006931 | Ga0097620_100003264 | Ga0097620_1000032642 | 507 |
| 289 | 3300013308 | Ga0157375_10179550 | Ga0157375_101795502 | 507 |
| 290 | 3300025908 | Ga0207643_10013007 | Ga0207643_100130072 | 507 |
| 291 | 3300025918 | Ga0207662_10012724 | Ga0207662_100127242 | 507 |
| 292 | 3300025926 | Ga0207659_10019571 | Ga0207659_100195715 | 507 |
| 293 | 3300026035 | Ga0207703_10068794 | Ga0207703_100687943 | 507 |
| 294 | 3300026116 | Ga0207674_10011888 | Ga0207674_100118882 | 507 |
| 295 | 3300049578 | Ga0501042_0046632 | Ga0501042_0046632_349_1926 | 507 |
| 296 | 3300049585 | Ga0501069_0054170 | Ga0501069_0054170_346_1950 | 507 |
| 297 | 3300049592 | Ga0501076_0119895 | Ga0501076_0119895_239_1816 | 507 |
| 298 | 3300005434 | Ga0070709_10002238 | Ga0070709_100022384 | 508 |
| 299 | 3300005436 | Ga0070713_100053985 | Ga0070713_1000539854 | 508 |
| 300 | 3300025906 | Ga0207699_10000030 | Ga0207699_10000030140 | 508 |
| 301 | 3300025929 | Ga0207664_10022668 | Ga0207664_100226683 | 508 |
| 302 | 3300031995 | Ga0307409_100007309 | Ga0307409_1000073092 | 508 |
| 303 | 3300045976 | Ga0466967_0101878 | Ga0466967_0101878_903_2558 | 508 |
| 304 | 3300046543 | Ga0495645_0000023 | Ga0495645_0000023_105412_107016 | 508 |
| 305 | 3300050510 | nmdc:mga06r32_112699_c1 | nmdc:mga06r32_112699_c1_985_2583 | 508 |
| 306 | 3300048918 | Ga0496115_0000087 | Ga0496115_0000087_64465_66063 | 509 |
| 307 | 3300005937 | Ga0081455_10011436 | Ga0081455_100114362 | 510 |
| 308 | 3300046663 | Ga0495635_0093129 | Ga0495635_0093129_170_1756 | 510 |
| 309 | 3300005937 | Ga0081455_10010376 | Ga0081455_100103765 | 511 |
| 310 | 3300005985 | Ga0081539_10037509 | Ga0081539_100375092 | 511 |
| 311 | 3300046517 | Ga0495630_0001559 | Ga0495630_0001559_112_1698 | 511 |
| 312 | 3300053077 | Ga0495601_0015325 | Ga0495601_0015325_415_2001 | 511 |
| 313 | 3300005937 | Ga0081455_10108999 | Ga0081455_101089992 | 512 |
| 314 | 3300005981 | Ga0081538_10003277 | Ga0081538_1000327712 | 512 |
| 315 | 3300006852 | Ga0075433_10015850 | Ga0075433_100158504 | 512 |
| 316 | 3300007076 | Ga0075435_100114618 | Ga0075435_1001146182 | 512 |
| 317 | 3300009094 | Ga0111539_10106262 | Ga0111539_101062623 | 512 |
| 318 | 3300009098 | Ga0105245_10045353 | Ga0105245_100453534 | 512 |
| 319 | 3300009147 | Ga0114129_10144968 | Ga0114129_101449682 | 512 |
| 320 | 3300027907 | Ga0207428_10056495 | Ga0207428_100564952 | 512 |
| 321 | 3300039437 | Ga0436365_0846702 | Ga0436365_0846702_275_1867 | 512 |
| 322 | 3300044901 | Ga0466960_0043074 | Ga0466960_0043074_501_2072 | 512 |
| 323 | 3300048912 | Ga0496109_0000400 | Ga0496109_0000400_21062_22666 | 512 |
| 324 | 3300050511 | nmdc:mga08y16_97609_c1 | nmdc:mga08y16_97609_c1_525_2078 | 512 |
| 325 | 3300050513 | nmdc:mga0rr50_42089_c1 | nmdc:mga0rr50_42089_c1_1131_2684 | 512 |
| 326 | 3300053085 | Ga0495619_0003076 | Ga0495619_0003076_3084_4670 | 512 |
| 327 | 3300025907 | Ga0207645_10085752 | Ga0207645_100857522 | 513 |
| 328 | 3300045976 | Ga0466967_0052216 | Ga0466967_0052216_288_1865 | 513 |
| 329 | 3300005981 | Ga0081538_10006379 | Ga0081538_100063799 | 514 |
| 330 | 3300005981 | Ga0081538_10014226 | Ga0081538_100142263 | 514 |
| 331 | 3300037853 | Ga0436364_0540677 | Ga0436364_0540677_6390_7982 | 514 |
| 332 | 3300046536 | Ga0495587_0000703 | Ga0495587_0000703_6876_8462 | 514 |
| 333 | 3300005354 | Ga0070675_100139275 | Ga0070675_1001392752 | 515 |
| 334 | 3300005981 | Ga0081538_10001335 | Ga0081538_1000133514 | 515 |
| 335 | 3300005983 | Ga0081540_1041199 | Ga0081540_10411992 | 515 |
| 336 | 3300006038 | Ga0075365_10056493 | Ga0075365_100564933 | 515 |
| 337 | 3300006051 | Ga0075364_10067472 | Ga0075364_100674723 | 515 |
| 338 | 3300025927 | Ga0207687_10000020 | Ga0207687_1000002015 | 515 |
| 339 | 3300025981 | Ga0207640_10005255 | Ga0207640_100052552 | 515 |
| 340 | 3300048903 | Ga0496100_0001670 | Ga0496100_0001670_8760_10379 | 515 |
| 341 | 3300048904 | Ga0496101_0062170 | Ga0496101_0062170_30_1649 | 515 |
| 342 | 3300048909 | Ga0496106_0002707 | Ga0496106_0002707_9110_10729 | 515 |
| 343 | 3300048910 | Ga0496107_0000834 | Ga0496107_0000834_7091_8710 | 515 |
| 344 | 3300050491 | nmdc:mga00v17_25136_c1 | nmdc:mga00v17_25136_c1_259_1869 | 515 |
| 345 | 3300050492 | nmdc:mga0yw44_12468_c1 | nmdc:mga0yw44_12468_c1_2025_3635 | 515 |
| 346 | 3300009147 | Ga0114129_10224722 | Ga0114129_102247222 | 516 |
| 347 | 3300025972 | Ga0207668_10023866 | Ga0207668_100238662 | 516 |
| 348 | 3300032126 | Ga0307415_100000715 | Ga0307415_1000007152 | 516 |
| 349 | 3300048907 | Ga0496104_0001546 | Ga0496104_0001546_14217_15803 | 516 |
| 350 | 3300048908 | Ga0496105_0000098 | Ga0496105_0000098_46793_48379 | 516 |
| 351 | 3300049575 | Ga0501039_0032900 | Ga0501039_0032900_2242_3810 | 516 |
| 352 | 3300049592 | Ga0501076_0048290 | Ga0501076_0048290_1214_2794 | 516 |
| 353 | 3300005981 | Ga0081538_10011526 | Ga0081538_100115266 | 517 |
| 354 | 3300005985 | Ga0081539_10002813 | Ga0081539_100028134 | 517 |
| 355 | 3300025929 | Ga0207664_10016874 | Ga0207664_100168743 | 517 |
| 356 | 3300046514 | Ga0495618_0000512 | Ga0495618_0000512_5971_7566 | 517 |
| 357 | 3300047320 | Ga0495672_0016579 | Ga0495672_0016579_2821_4413 | 517 |
| 358 | 3300005937 | Ga0081455_10018195 | Ga0081455_100181954 | 518 |
| 359 | 3300027907 | Ga0207428_10008618 | Ga0207428_100086185 | 518 |
| 360 | 3300050510 | nmdc:mga06r32_77199_c1 | nmdc:mga06r32_77199_c1_828_2402 | 518 |
| 361 | 3300005435 | Ga0070714_100000347 | Ga0070714_10000034714 | 519 |
| 362 | 3300009101 | Ga0105247_10050502 | Ga0105247_100505022 | 519 |
| 363 | 3300025929 | Ga0207664_10000310 | Ga0207664_1000031014 | 519 |
| 364 | 3300006844 | Ga0075428_100165002 | Ga0075428_1001650022 | 520 |
| 365 | 3300025913 | Ga0207695_10033458 | Ga0207695_100334583 | 520 |
| 366 | 3300001979 | JGI24740J21852_10011271 | JGI24740J21852_100112712 | 521 |
| 367 | 3300005341 | Ga0070691_10000362 | Ga0070691_100003625 | 521 |
| 368 | 3300005435 | Ga0070714_100035558 | Ga0070714_1000355584 | 521 |
| 369 | 3300005435 | Ga0070714_100120675 | Ga0070714_1001206752 | 521 |
| 370 | 3300005459 | Ga0068867_100009607 | Ga0068867_1000096072 | 521 |
| 371 | 3300005543 | Ga0070672_100112583 | Ga0070672_1001125832 | 521 |
| 372 | 3300006028 | Ga0070717_10064191 | Ga0070717_100641912 | 521 |
| 373 | 3300006028 | Ga0070717_10133380 | Ga0070717_101333801 | 521 |
| 374 | 3300006175 | Ga0070712_100042879 | Ga0070712_1000428793 | 521 |
| 375 | 3300006871 | Ga0075434_100011809 | Ga0075434_1000118095 | 521 |
| 376 | 3300006914 | Ga0075436_100124446 | Ga0075436_1001244462 | 521 |
| 377 | 3300007076 | Ga0075435_100083936 | Ga0075435_1000839361 | 521 |
| 378 | 3300009101 | Ga0105247_10001338 | Ga0105247_1000133814 | 521 |
| 379 | 3300009147 | Ga0114129_10009190 | Ga0114129_100091909 | 521 |
| 380 | 3300013297 | Ga0157378_10240575 | Ga0157378_102405752 | 521 |
| 381 | 3300013308 | Ga0157375_10157686 | Ga0157375_101576861 | 521 |
| 382 | 3300025900 | Ga0207710_10000243 | Ga0207710_1000024325 | 521 |
| 383 | 3300025915 | Ga0207693_10000318 | Ga0207693_1000031816 | 521 |
| 384 | 3300025919 | Ga0207657_10071980 | Ga0207657_100719802 | 521 |
| 385 | 3300025929 | Ga0207664_10022178 | Ga0207664_100221784 | 521 |
| 386 | 3300025929 | Ga0207664_10141174 | Ga0207664_101411742 | 521 |
| 387 | 3300025934 | Ga0207686_10015589 | Ga0207686_100155893 | 521 |
| 388 | 3300026089 | Ga0207648_10010940 | Ga0207648_100109404 | 521 |
| 389 | 3300036401 | Ga0373937_0044413 | Ga0373937_0044413_2403_3998 | 521 |
| 390 | 3300036401 | Ga0373937_0118004 | Ga0373937_0118004_79_1662 | 521 |
| 391 | 3300045836 | Ga0466958_0026512 | Ga0466958_0026512_396_1970 | 521 |
| 392 | 3300046454 | Ga0495592_0108363 | Ga0495592_0108363_328_1923 | 521 |
| 393 | 3300046460 | Ga0495638_0007166 | Ga0495638_0007166_4224_5810 | 521 |
| 394 | 3300046462 | Ga0495651_0075386 | Ga0495651_0075386_851_2446 | 521 |
| 395 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_53122_54708 | 521 |
| 396 | 3300046809 | Ga0495600_0018459 | Ga0495600_0018459_286_1881 | 521 |
| 397 | 3300047317 | Ga0495604_0043636 | Ga0495604_0043636_1232_2827 | 521 |
| 398 | 3300047320 | Ga0495672_0035031 | Ga0495672_0035031_194_1762 | 521 |
| 399 | 3300047321 | Ga0495676_0001626 | Ga0495676_0001626_7207_8793 | 521 |
| 400 | 3300047322 | Ga0495680_0015816 | Ga0495680_0015816_2931_4526 | 521 |
| 401 | 3300048088 | Ga0495602_0006880 | Ga0495602_0006880_2806_4401 | 521 |
| 402 | 3300048907 | Ga0496104_0000036 | Ga0496104_0000036_90320_91939 | 521 |
| 403 | 3300048907 | Ga0496104_0000077 | Ga0496104_0000077_19602_21188 | 521 |
| 404 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_79661_81247 | 521 |
| 405 | 3300048908 | Ga0496105_0048437 | Ga0496105_0048437_645_2240 | 521 |
| 406 | 3300048908 | Ga0496105_0053384 | Ga0496105_0053384_109_1695 | 521 |
| 407 | 3300048913 | Ga0496110_0000496 | Ga0496110_0000496_15005_16624 | 521 |
| 408 | 3300048914 | Ga0496111_0000691 | Ga0496111_0000691_1946_3565 | 521 |
| 409 | 3300048916 | Ga0496113_0059168 | Ga0496113_0059168_357_1952 | 521 |
| 410 | 3300048918 | Ga0496115_0000010 | Ga0496115_0000010_209529_211115 | 521 |
| 411 | 3300048922 | Ga0496119_0067877 | Ga0496119_0067877_153_1739 | 521 |
| 412 | 3300048923 | Ga0496120_0044280 | Ga0496120_0044280_968_2554 | 521 |
| 413 | 3300049571 | Ga0501034_0019495 | Ga0501034_0019495_4988_6574 | 521 |
| 414 | 3300049823 | Ga0501044_0015577 | Ga0501044_0015577_1387_2973 | 521 |
| 415 | 3300050507 | nmdc:mga05p37_7012_c1 | nmdc:mga05p37_7012_c1_9191_10789 | 521 |
| 416 | 3300050512 | nmdc:mga0n895_2082_c1 | nmdc:mga0n895_2082_c1_603_2201 | 521 |
| 417 | 3300053078 | Ga0495612_0001134 | Ga0495612_0001134_330_1913 | 521 |
| 418 | 3300053085 | Ga0495619_0002992 | Ga0495619_0002992_6391_7974 | 521 |
| 419 | 3300005367 | Ga0070667_100001439 | Ga0070667_10000143914 | 522 |
| 420 | 3300005844 | Ga0068862_100012267 | Ga0068862_1000122673 | 522 |
| 421 | 3300009553 | Ga0105249_10005337 | Ga0105249_100053375 | 522 |
| 422 | 3300021377 | Ga0213874_10000219 | Ga0213874_100002198 | 522 |
| 423 | 3300025961 | Ga0207712_10007286 | Ga0207712_100072862 | 522 |
| 424 | 3300025972 | Ga0207668_10032607 | Ga0207668_100326072 | 522 |
| 425 | 3300025986 | Ga0207658_10029223 | Ga0207658_100292233 | 522 |
| 426 | 3300028380 | Ga0268265_10002363 | Ga0268265_1000236311 | 522 |
| 427 | 3300037466 | Ga0395898_0201342 | Ga0395898_0201342_115_1761 | 522 |
| 428 | 3300039450 | Ga0436363_1171799 | Ga0436363_1171799_3507_5102 | 522 |
| 429 | 3300046543 | Ga0495645_0001131 | Ga0495645_0001131_4172_5761 | 522 |
| 430 | 3300048911 | Ga0496108_0040293 | Ga0496108_0040293_2006_3589 | 522 |
| 431 | 3300005356 | Ga0070674_100000012 | Ga0070674_100000012113 | 523 |
| 432 | 3300005439 | Ga0070711_100006224 | Ga0070711_1000062242 | 523 |
| 433 | 3300005455 | Ga0070663_100003097 | Ga0070663_1000030978 | 523 |
| 434 | 3300005530 | Ga0070679_100003483 | Ga0070679_1000034838 | 523 |
| 435 | 3300005547 | Ga0070693_100010237 | Ga0070693_1000102372 | 523 |
| 436 | 3300005564 | Ga0070664_100071251 | Ga0070664_1000712512 | 523 |
| 437 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015285 | 523 |
| 438 | 3300005718 | Ga0068866_10000062 | Ga0068866_100000624 | 523 |
| 439 | 3300005841 | Ga0068863_100124192 | Ga0068863_1001241922 | 523 |
| 440 | 3300005843 | Ga0068860_100010512 | Ga0068860_1000105125 | 523 |
| 441 | 3300005985 | Ga0081539_10005004 | Ga0081539_100050042 | 523 |
| 442 | 3300005985 | Ga0081539_10021343 | Ga0081539_100213433 | 523 |
| 443 | 3300013102 | Ga0157371_10050984 | Ga0157371_100509841 | 523 |
| 444 | 3300025899 | Ga0207642_10000104 | Ga0207642_100001044 | 523 |
| 445 | 3300025916 | Ga0207663_10000748 | Ga0207663_100007486 | 523 |
| 446 | 3300025921 | Ga0207652_10000720 | Ga0207652_100007202 | 523 |
| 447 | 3300025933 | Ga0207706_10000017 | Ga0207706_10000017155 | 523 |
| 448 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001798 | 523 |
| 449 | 3300026067 | Ga0207678_10000709 | Ga0207678_100007097 | 523 |
| 450 | 3300026067 | Ga0207678_10079112 | Ga0207678_100791122 | 523 |
| 451 | 3300026088 | Ga0207641_10017650 | Ga0207641_100176503 | 523 |
| 452 | 3300026095 | Ga0207676_10000018 | Ga0207676_1000001815 | 523 |
| 453 | 3300026121 | Ga0207683_10017747 | Ga0207683_100177474 | 523 |
| 454 | 3300028381 | Ga0268264_10012409 | Ga0268264_100124093 | 523 |
| 455 | 3300028556 | Ga0265337_1000805 | Ga0265337_10008055 | 523 |
| 456 | 3300028558 | Ga0265326_10000084 | Ga0265326_1000008417 | 523 |
| 457 | 3300028654 | Ga0265322_10000198 | Ga0265322_1000019817 | 523 |
| 458 | 3300029957 | Ga0265324_10001108 | Ga0265324_1000110815 | 523 |
| 459 | 3300031239 | Ga0265328_10002655 | Ga0265328_100026552 | 523 |
| 460 | 3300031240 | Ga0265320_10000035 | Ga0265320_10000035104 | 523 |
| 461 | 3300031242 | Ga0265329_10006215 | Ga0265329_100062151 | 523 |
| 462 | 3300031250 | Ga0265331_10011116 | Ga0265331_100111162 | 523 |
| 463 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015394 | 523 |
| 464 | 3300031711 | Ga0265314_10000690 | Ga0265314_1000069021 | 523 |
| 465 | 3300039437 | Ga0436365_0146714 | Ga0436365_0146714_2410_4002 | 523 |
| 466 | 3300044694 | Ga0466963_0000022 | Ga0466963_0000022_18508_20094 | 523 |
| 467 | 3300044765 | Ga0466970_0047840 | Ga0466970_0047840_39_1694 | 523 |
| 468 | 3300046455 | Ga0495603_0000471 | Ga0495603_0000471_6936_8522 | 523 |
| 469 | 3300046455 | Ga0495603_0000594 | Ga0495603_0000594_3317_4903 | 523 |
| 470 | 3300046516 | Ga0495628_0007112 | Ga0495628_0007112_7995_9581 | 523 |
| 471 | 3300046529 | Ga0495652_0000023 | Ga0495652_0000023_146154_147740 | 523 |
| 472 | 3300046529 | Ga0495652_0031335 | Ga0495652_0031335_2685_4271 | 523 |
| 473 | 3300046559 | Ga0495667_0000034 | Ga0495667_0000034_119752_121338 | 523 |
| 474 | 3300046616 | Ga0495668_0049644 | Ga0495668_0049644_322_1908 | 523 |
| 475 | 3300046660 | Ga0495625_0000506 | Ga0495625_0000506_35718_37313 | 523 |
| 476 | 3300046663 | Ga0495635_0037574 | Ga0495635_0037574_1638_3224 | 523 |
| 477 | 3300047317 | Ga0495604_0000852 | Ga0495604_0000852_14673_16316 | 523 |
| 478 | 3300047319 | Ga0495674_0000059 | Ga0495674_0000059_7367_8953 | 523 |
| 479 | 3300047322 | Ga0495680_0001649 | Ga0495680_0001649_5588_7174 | 523 |
| 480 | 3300047444 | Ga0495675_0034972 | Ga0495675_0034972_973_2559 | 523 |
| 481 | 3300048904 | Ga0496101_0042499 | Ga0496101_0042499_385_2019 | 523 |
| 482 | 3300048912 | Ga0496109_0263170 | Ga0496109_0263170_16_1605 | 523 |
| 483 | 3300048913 | Ga0496110_0002236 | Ga0496110_0002236_11664_13253 | 523 |
| 484 | 3300048914 | Ga0496111_0006612 | Ga0496111_0006612_4335_5924 | 523 |
| 485 | 3300048918 | Ga0496115_0001569 | Ga0496115_0001569_4662_6248 | 523 |
| 486 | 3300048923 | Ga0496120_0002545 | Ga0496120_0002545_4683_6293 | 523 |
| 487 | 3300048929 | Ga0496126_0042089 | Ga0496126_0042089_488_2092 | 523 |
| 488 | 3300050515 | nmdc:mga0a205_7640_c1 | nmdc:mga0a205_7640_c1_2687_4276 | 523 |
| 489 | 3300053077 | Ga0495601_0010167 | Ga0495601_0010167_203_1789 | 523 |
| 490 | 3300053085 | Ga0495619_0000602 | Ga0495619_0000602_8097_9683 | 523 |
| 491 | 3300053085 | Ga0495619_0000929 | Ga0495619_0000929_13650_15236 | 523 |
| 492 | 3300005329 | Ga0070683_100039766 | Ga0070683_1000397663 | 524 |
| 493 | 3300005329 | Ga0070683_100074051 | Ga0070683_1000740513 | 524 |
| 494 | 3300005337 | Ga0070682_100000171 | Ga0070682_1000001714 | 524 |
| 495 | 3300005338 | Ga0068868_100001000 | Ga0068868_1000010002 | 524 |
| 496 | 3300005354 | Ga0070675_100000377 | Ga0070675_10000037713 | 524 |
| 497 | 3300005365 | Ga0070688_100000285 | Ga0070688_10000028521 | 524 |
| 498 | 3300005365 | Ga0070688_100000428 | Ga0070688_10000042816 | 524 |
| 499 | 3300005436 | Ga0070713_100000380 | Ga0070713_10000038014 | 524 |
| 500 | 3300005466 | Ga0070685_10000159 | Ga0070685_100001594 | 524 |
| 501 | 3300005466 | Ga0070685_10000174 | Ga0070685_1000017423 | 524 |
| 502 | 3300005539 | Ga0068853_100134353 | Ga0068853_1001343531 | 524 |
| 503 | 3300005543 | Ga0070672_100000006 | Ga0070672_100000006107 | 524 |
| 504 | 3300005548 | Ga0070665_100007718 | Ga0070665_1000077187 | 524 |
| 505 | 3300005548 | Ga0070665_100202457 | Ga0070665_1002024571 | 524 |
| 506 | 3300005578 | Ga0068854_100012127 | Ga0068854_1000121273 | 524 |
| 507 | 3300005616 | Ga0068852_100006635 | Ga0068852_1000066353 | 524 |
| 508 | 3300005834 | Ga0068851_10000945 | Ga0068851_1000094510 | 524 |
| 509 | 3300005981 | Ga0081538_10006612 | Ga0081538_100066124 | 524 |
| 510 | 3300005981 | Ga0081538_10022785 | Ga0081538_100227854 | 524 |
| 511 | 3300006038 | Ga0075365_10026124 | Ga0075365_100261242 | 524 |
| 512 | 3300006881 | Ga0068865_100001059 | Ga0068865_10000105913 | 524 |
| 513 | 3300009098 | Ga0105245_10000116 | Ga0105245_1000011660 | 524 |
| 514 | 3300009177 | Ga0105248_10001622 | Ga0105248_100016228 | 524 |
| 515 | 3300013102 | Ga0157371_10019361 | Ga0157371_100193614 | 524 |
| 516 | 3300013105 | Ga0157369_10000078 | Ga0157369_10000078123 | 524 |
| 517 | 3300013297 | Ga0157378_10035063 | Ga0157378_100350634 | 524 |
| 518 | 3300013307 | Ga0157372_10002749 | Ga0157372_1000274917 | 524 |
| 519 | 3300014326 | Ga0157380_10000445 | Ga0157380_1000044517 | 524 |
| 520 | 3300021384 | Ga0213876_10005296 | Ga0213876_100052966 | 524 |
| 521 | 3300021384 | Ga0213876_10028470 | Ga0213876_100284702 | 524 |
| 522 | 3300025321 | Ga0207656_10000514 | Ga0207656_100005145 | 524 |
| 523 | 3300025901 | Ga0207688_10032160 | Ga0207688_100321602 | 524 |
| 524 | 3300025903 | Ga0207680_10002670 | Ga0207680_100026704 | 524 |
| 525 | 3300025907 | Ga0207645_10007972 | Ga0207645_100079723 | 524 |
| 526 | 3300025920 | Ga0207649_10000028 | Ga0207649_10000028143 | 524 |
| 527 | 3300025926 | Ga0207659_10000246 | Ga0207659_1000024617 | 524 |
| 528 | 3300025927 | Ga0207687_10000031 | Ga0207687_10000031139 | 524 |
| 529 | 3300025927 | Ga0207687_10002310 | Ga0207687_100023102 | 524 |
| 530 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003316 | 524 |
| 531 | 3300025932 | Ga0207690_10005055 | Ga0207690_100050556 | 524 |
| 532 | 3300025936 | Ga0207670_10044064 | Ga0207670_100440643 | 524 |
| 533 | 3300025938 | Ga0207704_10000103 | Ga0207704_1000010315 | 524 |
| 534 | 3300025940 | Ga0207691_10000025 | Ga0207691_1000002517 | 524 |
| 535 | 3300025940 | Ga0207691_10012417 | Ga0207691_100124172 | 524 |
| 536 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006391 | 524 |
| 537 | 3300025944 | Ga0207661_10000739 | Ga0207661_100007394 | 524 |
| 538 | 3300025944 | Ga0207661_10014625 | Ga0207661_100146252 | 524 |
| 539 | 3300025972 | Ga0207668_10023775 | Ga0207668_100237752 | 524 |
| 540 | 3300025981 | Ga0207640_10000686 | Ga0207640_100006863 | 524 |
| 541 | 3300026023 | Ga0207677_10009956 | Ga0207677_100099564 | 524 |
| 542 | 3300026078 | Ga0207702_10000242 | Ga0207702_1000024243 | 524 |
| 543 | 3300026142 | Ga0207698_10000414 | Ga0207698_1000041417 | 524 |
| 544 | 3300028379 | Ga0268266_10001578 | Ga0268266_1000157817 | 524 |
| 545 | 3300028379 | Ga0268266_10201604 | Ga0268266_102016041 | 524 |
| 546 | 3300031727 | Ga0316576_10110683 | Ga0316576_101106831 | 524 |
| 547 | 3300035398 | Ga0316574_0036213 | Ga0316574_0036213_391_1983 | 524 |
| 548 | 3300036712 | Ga0316584_0006436 | Ga0316584_0006436_4796_6388 | 524 |
| 549 | 3300037471 | Ga0395905_0082991 | Ga0395905_0082991_1061_2707 | 524 |
| 550 | 3300039437 | Ga0436365_0470617 | Ga0436365_0470617_382_1983 | 524 |
| 551 | 3300039437 | Ga0436365_1135905 | Ga0436365_1135905_64_1656 | 524 |
| 552 | 3300039437 | Ga0436365_1292596 | Ga0436365_1292596_6873_8465 | 524 |
| 553 | 3300039453 | Ga0436362_0908846 | Ga0436362_0908846_449_2050 | 524 |
| 554 | 3300044842 | Ga0466957_0036255 | Ga0466957_0036255_661_2256 | 524 |
| 555 | 3300045976 | Ga0466967_0000017 | Ga0466967_0000017_779_2374 | 524 |
| 556 | 3300045976 | Ga0466967_0034557 | Ga0466967_0034557_2156_3778 | 524 |
| 557 | 3300046459 | Ga0495629_0000999 | Ga0495629_0000999_4783_6381 | 524 |
| 558 | 3300046507 | Ga0495606_0000108 | Ga0495606_0000108_137655_139253 | 524 |
| 559 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_221079_222680 | 524 |
| 560 | 3300046674 | Ga0495588_0000393 | Ga0495588_0000393_18066_19664 | 524 |
| 561 | 3300046681 | Ga0495647_0014058 | Ga0495647_0014058_40_1641 | 524 |
| 562 | 3300046683 | Ga0495658_0054079 | Ga0495658_0054079_65_1669 | 524 |
| 563 | 3300046689 | Ga0495613_0000860 | Ga0495613_0000860_5550_7145 | 524 |
| 564 | 3300046690 | Ga0495624_0020815 | Ga0495624_0020815_1536_3140 | 524 |
| 565 | 3300046809 | Ga0495600_0003292 | Ga0495600_0003292_6299_7894 | 524 |
| 566 | 3300047317 | Ga0495604_0000122 | Ga0495604_0000122_18880_20475 | 524 |
| 567 | 3300047317 | Ga0495604_0007409 | Ga0495604_0007409_3293_4888 | 524 |
| 568 | 3300047321 | Ga0495676_0045174 | Ga0495676_0045174_428_2023 | 524 |
| 569 | 3300047472 | Ga0495686_0028251 | Ga0495686_0028251_1653_3248 | 524 |
| 570 | 3300048088 | Ga0495602_0000166 | Ga0495602_0000166_17267_18862 | 524 |
| 571 | 3300048905 | Ga0496102_0017198 | Ga0496102_0017198_2302_3897 | 524 |
| 572 | 3300048906 | Ga0496103_0016357 | Ga0496103_0016357_31_1626 | 524 |
| 573 | 3300048907 | Ga0496104_0013755 | Ga0496104_0013755_2436_4031 | 524 |
| 574 | 3300048907 | Ga0496104_0039362 | Ga0496104_0039362_373_1968 | 524 |
| 575 | 3300048909 | Ga0496106_0001777 | Ga0496106_0001777_8688_10283 | 524 |
| 576 | 3300048910 | Ga0496107_0005273 | Ga0496107_0005273_4187_5782 | 524 |
| 577 | 3300048911 | Ga0496108_0000355 | Ga0496108_0000355_16457_18055 | 524 |
| 578 | 3300048912 | Ga0496109_0000903 | Ga0496109_0000903_16337_17935 | 524 |
| 579 | 3300048912 | Ga0496109_0017755 | Ga0496109_0017755_2737_4332 | 524 |
| 580 | 3300048913 | Ga0496110_0000011 | Ga0496110_0000011_16159_17757 | 524 |
| 581 | 3300048913 | Ga0496110_0032285 | Ga0496110_0032285_2208_3806 | 524 |
| 582 | 3300048914 | Ga0496111_0006159 | Ga0496111_0006159_6111_7709 | 524 |
| 583 | 3300048914 | Ga0496111_0075898 | Ga0496111_0075898_783_2381 | 524 |
| 584 | 3300048915 | Ga0496112_0000980 | Ga0496112_0000980_2977_4575 | 524 |
| 585 | 3300048916 | Ga0496113_0000283 | Ga0496113_0000283_6145_7743 | 524 |
| 586 | 3300048917 | Ga0496114_0001473 | Ga0496114_0001473_6981_8576 | 524 |
| 587 | 3300053077 | Ga0495601_0000034 | Ga0495601_0000034_65282_66877 | 524 |
| 588 | 3300053078 | Ga0495612_0005209 | Ga0495612_0005209_2627_4231 | 524 |
| 589 | 3300053084 | Ga0495595_0017313 | Ga0495595_0017313_337_1932 | 524 |
| 590 | 3300053085 | Ga0495619_0000277 | Ga0495619_0000277_18069_19667 | 524 |
| 591 | 3300005347 | Ga0070668_100004996 | Ga0070668_1000049967 | 525 |
| 592 | 3300005366 | Ga0070659_100000132 | Ga0070659_10000013214 | 525 |
| 593 | 3300005435 | Ga0070714_100005669 | Ga0070714_1000056693 | 525 |
| 594 | 3300005440 | Ga0070705_100002087 | Ga0070705_1000020874 | 525 |
| 595 | 3300005441 | Ga0070700_100016626 | Ga0070700_1000166262 | 525 |
| 596 | 3300005457 | Ga0070662_100002985 | Ga0070662_1000029854 | 525 |
| 597 | 3300005719 | Ga0068861_100042924 | Ga0068861_1000429242 | 525 |
| 598 | 3300005981 | Ga0081538_10000487 | Ga0081538_1000048719 | 525 |
| 599 | 3300006028 | Ga0070717_10000059 | Ga0070717_1000005970 | 525 |
| 600 | 3300006038 | Ga0075365_10104365 | Ga0075365_101043652 | 525 |
| 601 | 3300006058 | Ga0075432_10025769 | Ga0075432_100257692 | 525 |
| 602 | 3300006175 | Ga0070712_100000050 | Ga0070712_10000005018 | 525 |
| 603 | 3300006846 | Ga0075430_100076592 | Ga0075430_1000765922 | 525 |
| 604 | 3300006847 | Ga0075431_100051053 | Ga0075431_1000510533 | 525 |
| 605 | 3300009094 | Ga0111539_10023958 | Ga0111539_100239584 | 525 |
| 606 | 3300009094 | Ga0111539_10024383 | Ga0111539_100243835 | 525 |
| 607 | 3300009098 | Ga0105245_10005224 | Ga0105245_100052243 | 525 |
| 608 | 3300009147 | Ga0114129_10006622 | Ga0114129_1000662215 | 525 |
| 609 | 3300009553 | Ga0105249_10008684 | Ga0105249_100086843 | 525 |
| 610 | 3300010375 | Ga0105239_10034780 | Ga0105239_100347803 | 525 |
| 611 | 3300011119 | Ga0105246_10030530 | Ga0105246_100305303 | 525 |
| 612 | 3300013306 | Ga0163162_10047250 | Ga0163162_100472503 | 525 |
| 613 | 3300021388 | Ga0213875_10011697 | Ga0213875_100116972 | 525 |
| 614 | 3300025915 | Ga0207693_10000151 | Ga0207693_1000015117 | 525 |
| 615 | 3300025932 | Ga0207690_10001305 | Ga0207690_1000130514 | 525 |
| 616 | 3300025933 | Ga0207706_10003131 | Ga0207706_100031319 | 525 |
| 617 | 3300025961 | Ga0207712_10006422 | Ga0207712_100064222 | 525 |
| 618 | 3300026075 | Ga0207708_10011794 | Ga0207708_100117942 | 525 |
| 619 | 3300026118 | Ga0207675_100014345 | Ga0207675_1000143454 | 525 |
| 620 | 3300027907 | Ga0207428_10099818 | Ga0207428_100998182 | 525 |
| 621 | 3300031995 | Ga0307409_100071834 | Ga0307409_1000718342 | 525 |
| 622 | 3300032002 | Ga0307416_100068284 | Ga0307416_1000682841 | 525 |
| 623 | 3300032005 | Ga0307411_10011261 | Ga0307411_100112612 | 525 |
| 624 | 3300032126 | Ga0307415_100023571 | Ga0307415_1000235712 | 525 |
| 625 | 3300037853 | Ga0436364_0632307 | Ga0436364_0632307_2320_3942 | 525 |
| 626 | 3300049591 | Ga0501075_0078870 | Ga0501075_0078870_281_1861 | 525 |
| 627 | 3300050507 | nmdc:mga05p37_124721_c1 | nmdc:mga05p37_124721_c1_1234_2814 | 525 |
| 628 | 3300050510 | nmdc:mga06r32_92494_c1 | nmdc:mga06r32_92494_c1_528_2108 | 525 |
| 629 | 3300050511 | nmdc:mga08y16_119057_c1 | nmdc:mga08y16_119057_c1_455_2035 | 525 |
| 630 | 3300050511 | nmdc:mga08y16_38950_c1 | nmdc:mga08y16_38950_c1_673_2253 | 525 |
| 631 | 3300031731 | Ga0307405_10009632 | Ga0307405_100096325 | 526 |
| 632 | 3300031824 | Ga0307413_10066393 | Ga0307413_100663932 | 526 |
| 633 | 3300031852 | Ga0307410_10005592 | Ga0307410_100055926 | 526 |
| 634 | 3300031995 | Ga0307409_100000976 | Ga0307409_1000009765 | 526 |
| 635 | 3300032004 | Ga0307414_10033503 | Ga0307414_100335033 | 526 |
| 636 | 3300032126 | Ga0307415_100002611 | Ga0307415_1000026114 | 526 |
| 637 | 3300000549 | LJQas_1001017 | LJQas_10010172 | 529 |
| 638 | 3300005366 | Ga0070659_100006257 | Ga0070659_1000062576 | 529 |
| 639 | 3300005458 | Ga0070681_10083993 | Ga0070681_100839932 | 529 |
| 640 | 3300005530 | Ga0070679_100025361 | Ga0070679_1000253615 | 529 |
| 641 | 3300005535 | Ga0070684_100118508 | Ga0070684_1001185082 | 529 |
| 642 | 3300005614 | Ga0068856_100161960 | Ga0068856_1001619601 | 529 |
| 643 | 3300005616 | Ga0068852_100010424 | Ga0068852_1000104245 | 529 |
| 644 | 3300006844 | Ga0075428_100021480 | Ga0075428_1000214805 | 529 |
| 645 | 3300006847 | Ga0075431_100018329 | Ga0075431_1000183294 | 529 |
| 646 | 3300009147 | Ga0114129_10002371 | Ga0114129_100023718 | 529 |
| 647 | 3300009551 | Ga0105238_10004264 | Ga0105238_1000426410 | 529 |
| 648 | 3300013105 | Ga0157369_10022884 | Ga0157369_100228842 | 529 |
| 649 | 3300013307 | Ga0157372_10015644 | Ga0157372_100156445 | 529 |
| 650 | 3300025912 | Ga0207707_10007051 | Ga0207707_100070512 | 529 |
| 651 | 3300025921 | Ga0207652_10018072 | Ga0207652_100180722 | 529 |
| 652 | 3300025932 | Ga0207690_10007554 | Ga0207690_100075542 | 529 |
| 653 | 3300025944 | Ga0207661_10045777 | Ga0207661_100457772 | 529 |
| 654 | 3300026142 | Ga0207698_10015354 | Ga0207698_100153543 | 529 |
| 655 | 3300045976 | Ga0466967_0072530 | Ga0466967_0072530_182_1780 | 529 |
| 656 | 3300050507 | nmdc:mga05p37_19950_c1 | nmdc:mga05p37_19950_c1_5699_7348 | 529 |
| 657 | 3300050509 | nmdc:mga0qj67_411_c1 | nmdc:mga0qj67_411_c1_822_2465 | 529 |
| 658 | 3300050510 | nmdc:mga06r32_2376_c1 | nmdc:mga06r32_2376_c1_6972_8615 | 529 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ewb-assembly1.cif.gz_X-2 | crystal structure of n-terminal domain of putative 2-isopropylmalate synthase from listeria monocytogenes | 0.9752 | 11 | 283 |
| 3rmj-assembly1.cif.gz_A | crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis | 0.9646 | 11 | 328 |
| 3rmj-assembly1.cif.gz_B | crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis | 0.9627 | 11 | 328 |
| 3eeg-assembly1.cif.gz_A | crystal structure of a 2-isopropylmalate synthase from cytophaga hutchinsonii | 0.9617 | 11 | 287 |
| 3ewb-assembly1.cif.gz_X-2 | crystal structure of n-terminal domain of putative 2-isopropylmalate synthase from listeria monocytogenes | 0.9611 | 11 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ewbX00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.975 | 11 | 283 | 3.20.20.70 |
| af_I1NJA3_77_365_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9731 | 9 | 287 | 3.20.20.70 |
| 3rmjB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9627 | 11 | 328 | 3.20.20.70 |
| af_P09151_393_501_3.30.160.270 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain | 0.9616 | 400 | 506 | 3.30.160.270 |
| 3ewbX00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9607 | 11 | 283 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8K502-F1-model_v4 | deleted | 0.988 | 34 | 155 |
|
| AF-T1CKX2-F1-model_v4 | Pyruvate carboxyltransferase domain protein (EC 6.4.1.1) | 0.9865 | 53 | 169 |
GO:0003852
GO:0004736 GO:0009098 |
| AF-X1I4H9-F1-model_v4 | 2-isopropylmalate synthase (EC 2.3.3.13) | 0.981 | 67 | 265 |
GO:0003852
GO:0009098 |
| AF-A0A357AGP8-F1-model_v4 | 2-isopropylmalate synthase (EC 2.3.3.13) | 0.9793 | 53 | 221 |
GO:0003852
GO:0009098 |
| AF-A0A6P0AYC6-F1-model_v4 | deleted | 0.9788 | 79 | 217 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar