F473197

General Info

Members Datasets Scaffolds Average Seq Length
658 313 656 516

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0047840|Ga0466970_0047840_39_1694
Length 551
Sequence VAAAKPHPEHEKESDEAEREHPMQDDRVIIFDTTLRDGEQSPGISLNTAEKLEIAHQLARLGVDVIEAGFPIASPGDFEAVQAIAREVQGPIIAGLARAHAGDIDRAFDAVRDAERAGGARIHTFISTSDIHIEHQLQSTRADVLGQARAAVAHARELVEDVEFSPMDATRADIEYTAEVLQVALDEGATTINVPDTVGYATPDEYARFLGRLYELVPGLRDVVLSVHCHDDLGLAVANSLAGLSVGARQVECAINGLGERAGNASLEEIVMVLRTREDAVGLTTGVNTREIARTSRLVSRLTGYPEQPNKAIIGRNAFSHESGIHQDGVLKERSTYEIMDAASVGVDDANQLVLGKHSGRHALKSALAELGFEVEGHALNTAFKRFKEIADKKKQVTAMDLEALVVDELRSELAAYTLVWFDVEASSRRPPHATVELTNPEGETVRGDFTGDGPVDAIFRAINSATRREARLREFRVDAVTSGQDALGEASVVLELSXXTAAGQGVSTDIIEAAAQAYTRALSNAERKVVLAAGAAERGESSERQLAGAP

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 10.64
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001017 3300000549 Bacteria 4286
2 JGI24740J21852_10011271 3300001979 Bacteria 3408
3 JGI25407J50210_10000813 3300003373 Bacteria 6659
4 JGI25407J50210_10008812 3300003373 Bacteria 2547
5 JGI25407J50210_10015480 3300003373 Bacteria 1970
6 Ga0070658_10069134 3300005327 Bacteria 2889
7 Ga0070683_100025146 3300005329 Bacteria 5344
8 Ga0070683_100039766 3300005329 Bacteria 4320
9 Ga0070683_100043036 3300005329 Bacteria 4161
10 Ga0070683_100057875 3300005329 Bacteria 3601
11 Ga0070683_100074051 3300005329 Bacteria 3180
12 Ga0070683_100085928 3300005329 Bacteria 2950
13 Ga0070670_100041099 3300005331 Bacteria 3974
14 Ga0068869_100160925 3300005334 Bacteria 1748
15 Ga0070682_100000171 3300005337 Bacteria 48470
16 Ga0068868_100000633 3300005338 Bacteria 23661
17 Ga0068868_100001000 3300005338 Bacteria 19303
18 Ga0068868_100022786 3300005338 Bacteria 4733
19 Ga0070689_100054916 3300005340 Bacteria 3084
20 Ga0070691_10000362 3300005341 Bacteria 16367
21 Ga0070687_100000924 3300005343 Bacteria 9926
22 Ga0070692_10000809 3300005345 Bacteria 10396
23 Ga0070668_100004996 3300005347 Bacteria 9824
24 Ga0070668_100037191 3300005347 Bacteria 3716
25 Ga0070668_100037922 3300005347 Bacteria 3682
26 Ga0070675_100000377 3300005354 Bacteria 30146
27 Ga0070675_100139275 3300005354 Bacteria 2073
28 Ga0070671_100090007 3300005355 Bacteria 2569
29 Ga0070674_100000004 3300005356 Bacteria 169446
30 Ga0070674_100000012 3300005356 Bacteria 130773
31 Ga0070674_100008378 3300005356 Bacteria 6155
32 Ga0070688_100000285 3300005365 Bacteria 26015
33 Ga0070688_100000428 3300005365 Bacteria 21246
34 Ga0070688_100039415 3300005365 Bacteria 2890
35 Ga0070659_100000132 3300005366 Bacteria 56931
36 Ga0070659_100006257 3300005366 Bacteria 8605
37 Ga0070659_100009454 3300005366 Bacteria 7161
38 Ga0070659_100017917 3300005366 Bacteria 5336
39 Ga0070667_100001439 3300005367 Bacteria 21347
40 Ga0070703_10014907 3300005406 Bacteria 2219
41 Ga0070709_10002238 3300005434 Bacteria 10487
42 Ga0070714_100000347 3300005435 Bacteria 34714
43 Ga0070714_100005669 3300005435 Bacteria 9554
44 Ga0070714_100035558 3300005435 Bacteria 4176
45 Ga0070714_100120675 3300005435 Bacteria 2331
46 Ga0070713_100000380 3300005436 Bacteria 28361
47 Ga0070713_100053985 3300005436 Bacteria 3332
48 Ga0070710_10000015 3300005437 Bacteria 103891
49 Ga0070701_10024104 3300005438 Bacteria 2940
50 Ga0070711_100006224 3300005439 Bacteria 7184
51 Ga0070705_100002087 3300005440 Bacteria 10198
52 Ga0070700_100016626 3300005441 Bacteria 4194
53 Ga0070663_100001585 3300005455 Bacteria 12522
54 Ga0070663_100003097 3300005455 Bacteria 9512
55 Ga0070662_100002985 3300005457 Bacteria 10516
56 Ga0070681_10083993 3300005458 Bacteria 3136
57 Ga0068867_100004390 3300005459 Bacteria 9921
58 Ga0068867_100009607 3300005459 Bacteria 6820
59 Ga0068867_100051179 3300005459 Bacteria 3046
60 Ga0070685_10000159 3300005466 Bacteria 43951
61 Ga0070685_10000174 3300005466 Bacteria 42617
62 Ga0070679_100003483 3300005530 Bacteria 14409
63 Ga0070679_100025361 3300005530 Bacteria 5817
64 Ga0070684_100052176 3300005535 Bacteria 3555
65 Ga0070684_100072643 3300005535 Bacteria 3029
66 Ga0070684_100118508 3300005535 Bacteria 2379
67 Ga0068853_100021127 3300005539 Bacteria 5420
68 Ga0068853_100134353 3300005539 Bacteria 2217
69 Ga0070672_100000006 3300005543 Bacteria 117060
70 Ga0070672_100005111 3300005543 Bacteria 8655
71 Ga0070672_100112583 3300005543 Bacteria 2220
72 Ga0070693_100010237 3300005547 Bacteria 4692
73 Ga0070665_100000627 3300005548 Bacteria 48156
74 Ga0070665_100007718 3300005548 Bacteria 10923
75 Ga0070665_100202457 3300005548 Bacteria 1986
76 Ga0070664_100021697 3300005564 Bacteria 5296
77 Ga0070664_100071251 3300005564 Bacteria 2978
78 Ga0068857_100014880 3300005577 Bacteria 6785
79 Ga0068854_100012127 3300005578 Bacteria 5638
80 Ga0068856_100046055 3300005614 Bacteria 4295
81 Ga0068856_100076645 3300005614 Bacteria 3313
82 Ga0068856_100161960 3300005614 Bacteria 2248
83 Ga0070702_100058822 3300005615 Bacteria 2228
84 Ga0068852_100006635 3300005616 Bacteria 8385
85 Ga0068852_100010424 3300005616 Bacteria 6946
86 Ga0068859_100003264 3300005617 Bacteria 16511
87 Ga0068859_100043111 3300005617 Bacteria 4534
88 Ga0068864_100000015 3300005618 Bacteria 303368
89 Ga0068864_100091284 3300005618 Bacteria 2687
90 Ga0068866_10000004 3300005718 Bacteria 202810
91 Ga0068866_10000062 3300005718 Bacteria 42082
92 Ga0068861_100042924 3300005719 Bacteria 3391
93 Ga0068851_10000945 3300005834 Bacteria 12571
94 Ga0068863_100124192 3300005841 Bacteria 2462
95 Ga0068858_100000075 3300005842 Bacteria 104349
96 Ga0068860_100010512 3300005843 Bacteria 9150
97 Ga0068862_100012267 3300005844 Bacteria 7086
98 Ga0081455_10007309 3300005937 Bacteria 11650
99 Ga0081455_10010376 3300005937 Bacteria 9464
100 Ga0081455_10011436 3300005937 Bacteria 8918
101 Ga0081455_10018195 3300005937 Bacteria 6707
102 Ga0081455_10108999 3300005937 Bacteria 2204
103 Ga0081538_10000235 3300005981 Bacteria 62346
104 Ga0081538_10000364 3300005981 Bacteria 51665
105 Ga0081538_10000487 3300005981 Bacteria 44314
106 Ga0081538_10000523 3300005981 Bacteria 42849
107 Ga0081538_10001335 3300005981 Bacteria 25371
108 Ga0081538_10003277 3300005981 Bacteria 15371
109 Ga0081538_10006379 3300005981 Bacteria 10398
110 Ga0081538_10006612 3300005981 Bacteria 10165
111 Ga0081538_10010215 3300005981 Bacteria 7712
112 Ga0081538_10011526 3300005981 Bacteria 7157
113 Ga0081538_10014226 3300005981 Bacteria 6243
114 Ga0081538_10021470 3300005981 Bacteria 4712
115 Ga0081538_10022785 3300005981 Bacteria 4524
116 Ga0081540_1000041 3300005983 Bacteria 136874
117 Ga0081540_1002867 3300005983 Bacteria 13938
118 Ga0081540_1041199 3300005983 Bacteria 2397
119 Ga0081539_10002813 3300005985 Bacteria 23253
120 Ga0081539_10002920 3300005985 Bacteria 22553
121 Ga0081539_10005004 3300005985 Bacteria 13998
122 Ga0081539_10021343 3300005985 Bacteria 4332
123 Ga0081539_10037509 3300005985 Bacteria 2887
124 Ga0070717_10000059 3300006028 Bacteria 92958
125 Ga0070717_10064191 3300006028 Bacteria 3049
126 Ga0070717_10133380 3300006028 Bacteria 2137
127 Ga0075365_10000786 3300006038 Bacteria 12956
128 Ga0075365_10026124 3300006038 Bacteria 3704
129 Ga0075365_10056493 3300006038 Bacteria 2609
130 Ga0075365_10056722 3300006038 Bacteria 2604
131 Ga0075365_10104365 3300006038 Bacteria 1943
132 Ga0075363_100009622 3300006048 Bacteria 4551
133 Ga0075364_10014024 3300006051 Bacteria 4942
134 Ga0075364_10067472 3300006051 Bacteria 2351
135 Ga0075432_10025769 3300006058 Bacteria 2017
136 Ga0070715_10000014 3300006163 Bacteria 154272
137 Ga0070712_100000050 3300006175 Bacteria 63870
138 Ga0070712_100042879 3300006175 Bacteria 3112
139 Ga0075428_100021480 3300006844 Bacteria 7144
140 Ga0075428_100165002 3300006844 Bacteria 2403
141 Ga0075430_100076592 3300006846 Bacteria 2804
142 Ga0075431_100003598 3300006847 Bacteria 15020
143 Ga0075431_100018329 3300006847 Bacteria 7127
144 Ga0075431_100051053 3300006847 Bacteria 4266
145 Ga0075433_10000244 3300006852 Bacteria 31446
146 Ga0075433_10015850 3300006852 Bacteria 6195
147 Ga0075434_100011809 3300006871 Bacteria 8252
148 Ga0075429_100140358 3300006880 Bacteria 2115
149 Ga0068865_100001059 3300006881 Bacteria 15817
150 Ga0075436_100124446 3300006914 Bacteria 1806
151 Ga0097620_100003264 3300006931 Bacteria 16511
152 Ga0097620_100043107 3300006931 Bacteria 4534
153 Ga0075435_100083936 3300007076 Bacteria 2620
154 Ga0075435_100114618 3300007076 Bacteria 2243
155 Ga0105240_10058462 3300009093 Bacteria 4814
156 Ga0111539_10008658 3300009094 Bacteria 12914
157 Ga0111539_10023958 3300009094 Bacteria 7499
158 Ga0111539_10024383 3300009094 Bacteria 7423
159 Ga0111539_10106262 3300009094 Bacteria 3293
160 Ga0105245_10000116 3300009098 Bacteria 77303
161 Ga0105245_10005224 3300009098 Bacteria 11408
162 Ga0105245_10045353 3300009098 Bacteria 3926
163 Ga0105247_10001338 3300009101 Bacteria 17979
164 Ga0105247_10050502 3300009101 Bacteria 2559
165 Ga0114129_10002371 3300009147 Bacteria 26160
166 Ga0114129_10006622 3300009147 Bacteria 16448
167 Ga0114129_10009190 3300009147 Bacteria 14093
168 Ga0114129_10094883 3300009147 Bacteria 4131
169 Ga0114129_10144968 3300009147 Bacteria 3253
170 Ga0114129_10224722 3300009147 Bacteria 2531
171 Ga0105242_10000085 3300009176 Bacteria 64353
172 Ga0105248_10001622 3300009177 Bacteria 24979
173 Ga0105237_10013027 3300009545 Bacteria 8731
174 Ga0105238_10004264 3300009551 Bacteria 14206
175 Ga0105249_10005337 3300009553 Bacteria 11088
176 Ga0105249_10008684 3300009553 Bacteria 8854
177 Ga0105239_10034780 3300010375 Bacteria 5534
178 Ga0105246_10030530 3300011119 Bacteria 3561
179 Ga0105246_10099108 3300011119 Bacteria 2118
180 Ga0157371_10019361 3300013102 Bacteria 5021
181 Ga0157371_10050984 3300013102 Bacteria 2940
182 Ga0157370_10035413 3300013104 Bacteria 4852
183 Ga0157369_10000078 3300013105 Bacteria 135173
184 Ga0157369_10022884 3300013105 Bacteria 6968
185 Ga0157374_10120059 3300013296 Bacteria 2536
186 Ga0157378_10035063 3300013297 Bacteria 4436
187 Ga0157378_10240575 3300013297 Bacteria 1729
188 Ga0163162_10047250 3300013306 Bacteria 4314
189 Ga0157372_10002749 3300013307 Bacteria 19018
190 Ga0157372_10015644 3300013307 Bacteria 8135
191 Ga0157375_10157686 3300013308 Bacteria 2409
192 Ga0157375_10179550 3300013308 Bacteria 2268
193 Ga0157380_10000445 3300014326 Bacteria 25326
194 Ga0157380_10008928 3300014326 Bacteria 7163
195 Ga0157377_10004901 3300014745 Bacteria 6230
196 Ga0157377_10012907 3300014745 Bacteria 4213
197 Ga0157376_10034595 3300014969 Bacteria 4081
198 Ga0213874_10000219 3300021377 Bacteria 10689
199 Ga0213876_10005296 3300021384 Bacteria 7098
200 Ga0213876_10015191 3300021384 Bacteria 4078
201 Ga0213876_10019784 3300021384 Bacteria 3556
202 Ga0213876_10028470 3300021384 Bacteria 2946
203 Ga0213875_10006103 3300021388 Bacteria 6372
204 Ga0213875_10011697 3300021388 Bacteria 4356
205 Ga0207656_10000514 3300025321 Bacteria 12807
206 Ga0207692_10000013 3300025898 Bacteria 103819
207 Ga0207642_10000005 3300025899 Bacteria 401934
208 Ga0207642_10000104 3300025899 Bacteria 22584
209 Ga0207710_10000243 3300025900 Bacteria 46286
210 Ga0207688_10011075 3300025901 Bacteria 4907
211 Ga0207688_10032160 3300025901 Bacteria 2898
212 Ga0207680_10002670 3300025903 Bacteria 8340
213 Ga0207685_10000025 3300025905 Bacteria 110358
214 Ga0207699_10000030 3300025906 Bacteria 138384
215 Ga0207645_10007972 3300025907 Bacteria 7430
216 Ga0207645_10085752 3300025907 Bacteria 2022
217 Ga0207643_10012896 3300025908 Bacteria 4520
218 Ga0207643_10013007 3300025908 Bacteria 4498
219 Ga0207705_10048310 3300025909 Bacteria 3060
220 Ga0207705_10087233 3300025909 Bacteria 2281
221 Ga0207707_10007051 3300025912 Bacteria 9798
222 Ga0207695_10033458 3300025913 Bacteria 5605
223 Ga0207695_10044076 3300025913 Bacteria 4748
224 Ga0207671_10028718 3300025914 Bacteria 4155
225 Ga0207693_10000151 3300025915 Bacteria 64033
226 Ga0207693_10000318 3300025915 Bacteria 44789
227 Ga0207663_10000748 3300025916 Bacteria 14481
228 Ga0207662_10012724 3300025918 Bacteria 4691
229 Ga0207662_10021201 3300025918 Bacteria 3711
230 Ga0207657_10058960 3300025919 Bacteria 3301
231 Ga0207657_10071980 3300025919 Bacteria 2926
232 Ga0207649_10000028 3300025920 Bacteria 161482
233 Ga0207649_10054474 3300025920 Bacteria 2489
234 Ga0207652_10000720 3300025921 Bacteria 32059
235 Ga0207652_10018072 3300025921 Bacteria 5780
236 Ga0207659_10000246 3300025926 Bacteria 32971
237 Ga0207659_10019571 3300025926 Bacteria 4459
238 Ga0207687_10000020 3300025927 Bacteria 228407
239 Ga0207687_10000031 3300025927 Bacteria 150246
240 Ga0207687_10002310 3300025927 Bacteria 12979
241 Ga0207687_10113251 3300025927 Bacteria 2017
242 Ga0207700_10000033 3300025928 Bacteria 123113
243 Ga0207664_10000310 3300025929 Bacteria 36142
244 Ga0207664_10016874 3300025929 Bacteria 5338
245 Ga0207664_10022178 3300025929 Bacteria 4737
246 Ga0207664_10022668 3300025929 Bacteria 4693
247 Ga0207664_10141174 3300025929 Bacteria 2038
248 Ga0207690_10001305 3300025932 Bacteria 15653
249 Ga0207690_10005055 3300025932 Bacteria 7788
250 Ga0207690_10007554 3300025932 Bacteria 6452
251 Ga0207690_10045402 3300025932 Bacteria 2902
252 Ga0207706_10000017 3300025933 Bacteria 169589
253 Ga0207706_10003131 3300025933 Bacteria 15890
254 Ga0207706_10064665 3300025933 Bacteria 3221
255 Ga0207686_10000199 3300025934 Bacteria 46373
256 Ga0207686_10015589 3300025934 Bacteria 4252
257 Ga0207670_10044064 3300025936 Bacteria 2950
258 Ga0207669_10000017 3300025937 Bacteria 119878
259 Ga0207669_10000131 3300025937 Bacteria 37319
260 Ga0207669_10009836 3300025937 Bacteria 4574
261 Ga0207704_10000103 3300025938 Bacteria 47628
262 Ga0207691_10000025 3300025940 Bacteria 129424
263 Ga0207691_10012417 3300025940 Bacteria 8165
264 Ga0207691_10012528 3300025940 Bacteria 8129
265 Ga0207711_10000006 3300025941 Bacteria 792692
266 Ga0207689_10049079 3300025942 Bacteria 3482
267 Ga0207661_10000739 3300025944 Bacteria 21204
268 Ga0207661_10014625 3300025944 Bacteria 5755
269 Ga0207661_10045777 3300025944 Bacteria 3465
270 Ga0207661_10049401 3300025944 Bacteria 3348
271 Ga0207661_10075464 3300025944 Bacteria 2766
272 Ga0207679_10059096 3300025945 Bacteria 2844
273 Ga0207679_10137022 3300025945 Bacteria 1972
274 Ga0207651_10094573 3300025960 Bacteria 2198
275 Ga0207712_10006422 3300025961 Bacteria 7417
276 Ga0207712_10007286 3300025961 Bacteria 6977
277 Ga0207668_10017007 3300025972 Bacteria 4551
278 Ga0207668_10023775 3300025972 Bacteria 3945
279 Ga0207668_10023866 3300025972 Bacteria 3939
280 Ga0207668_10029480 3300025972 Bacteria 3597
281 Ga0207668_10032607 3300025972 Bacteria 3444
282 Ga0207640_10000686 3300025981 Bacteria 19687
283 Ga0207640_10005255 3300025981 Bacteria 7047
284 Ga0207658_10029223 3300025986 Bacteria 3890
285 Ga0207677_10006893 3300026023 Bacteria 6245
286 Ga0207677_10009956 3300026023 Bacteria 5362
287 Ga0207677_10037265 3300026023 Bacteria 3177
288 Ga0207703_10000088 3300026035 Bacteria 106080
289 Ga0207703_10068794 3300026035 Bacteria 2918
290 Ga0207639_10054809 3300026041 Bacteria 3049
291 Ga0207639_10091972 3300026041 Bacteria 2430
292 Ga0207678_10000709 3300026067 Bacteria 30420
293 Ga0207678_10079112 3300026067 Bacteria 2815
294 Ga0207708_10001416 3300026075 Bacteria 17970
295 Ga0207708_10011794 3300026075 Bacteria 6510
296 Ga0207702_10000242 3300026078 Bacteria 63808
297 Ga0207702_10154702 3300026078 Bacteria 2089
298 Ga0207641_10017650 3300026088 Bacteria 5845
299 Ga0207648_10008149 3300026089 Bacteria 10188
300 Ga0207648_10010940 3300026089 Bacteria 8573
301 Ga0207676_10000018 3300026095 Bacteria 306375
302 Ga0207676_10032030 3300026095 Bacteria 3958
303 Ga0207676_10063990 3300026095 Bacteria 2923
304 Ga0207676_10131540 3300026095 Bacteria 2128
305 Ga0207674_10004056 3300026116 Bacteria 17754
306 Ga0207674_10011888 3300026116 Bacteria 9758
307 Ga0207675_100014345 3300026118 Bacteria 7388
308 Ga0207675_100055152 3300026118 Bacteria 3707
309 Ga0207675_100091446 3300026118 Bacteria 2861
310 Ga0207683_10017747 3300026121 Bacteria 6069
311 Ga0207698_10000414 3300026142 Bacteria 24644
312 Ga0207698_10015354 3300026142 Bacteria 5125
313 Ga0207698_10050057 3300026142 Bacteria 3185
314 Ga0207428_10008618 3300027907 Bacteria 9207
315 Ga0207428_10056495 3300027907 Bacteria 3119
316 Ga0207428_10084993 3300027907 Bacteria 2465
317 Ga0207428_10099818 3300027907 Bacteria 2244
318 Ga0268266_10001578 3300028379 Bacteria 26646
319 Ga0268266_10001702 3300028379 Bacteria 25200
320 Ga0268266_10201604 3300028379 Bacteria 1821
321 Ga0268265_10002363 3300028380 Bacteria 14287
322 Ga0268264_10012409 3300028381 Bacteria 7013
323 Ga0265337_1000805 3300028556 Bacteria 16508
324 Ga0265326_10000023 3300028558 Bacteria 113142
325 Ga0265326_10000084 3300028558 Bacteria 50129
326 Ga0265319_1000084 3300028563 Bacteria 73879
327 Ga0265319_1000110 3300028563 Bacteria 63277
328 Ga0265319_1003540 3300028563 Bacteria 8105
329 Ga0265334_10000135 3300028573 Bacteria 46602
330 Ga0265322_10000198 3300028654 Bacteria 26588
331 Ga0265336_10008684 3300028666 Bacteria 3547
332 Ga0265338_10000578 3300028800 Bacteria 64450
333 Ga0265338_10000902 3300028800 Bacteria 49948
334 Ga0265324_10001108 3300029957 Bacteria 16206
335 Ga0265324_10001427 3300029957 Bacteria 13711
336 Ga0265328_10002655 3300031239 Bacteria 7996
337 Ga0265320_10000035 3300031240 Bacteria 137855
338 Ga0265320_10016269 3300031240 Bacteria 4173
339 Ga0265329_10006215 3300031242 Bacteria 4758
340 Ga0265331_10011116 3300031250 Bacteria 4938
341 Ga0265327_10000015 3300031251 Bacteria 496677
342 Ga0265314_10000690 3300031711 Bacteria 40955
343 Ga0316576_10110683 3300031727 Bacteria 2058
344 Ga0307405_10009632 3300031731 Bacteria 4962
345 Ga0307413_10002409 3300031824 Bacteria 7591
346 Ga0307413_10066393 3300031824 Bacteria 2251
347 Ga0307410_10005592 3300031852 Bacteria 6676
348 Ga0307407_10003995 3300031903 Bacteria 6169
349 Ga0307409_100000976 3300031995 Bacteria 13349
350 Ga0307409_100007309 3300031995 Bacteria 6596
351 Ga0307409_100014596 3300031995 Bacteria 5118
352 Ga0307409_100071834 3300031995 Bacteria 2753
353 Ga0307416_100007617 3300032002 Bacteria 6907
354 Ga0307416_100068284 3300032002 Bacteria 2936
355 Ga0307414_10018430 3300032004 Bacteria 4298
356 Ga0307414_10033503 3300032004 Bacteria 3397
357 Ga0307411_10011261 3300032005 Bacteria 4817
358 Ga0307415_100000715 3300032126 Bacteria 14842
359 Ga0307415_100001405 3300032126 Bacteria 11505
360 Ga0307415_100002611 3300032126 Bacteria 8988
361 Ga0307415_100023571 3300032126 Bacteria 3823
362 Ga0316574_0001485 3300035398 Bacteria 11177
363 Ga0316574_0036213 3300035398 Bacteria 3020
364 Ga0373937_0044413 3300036401 Bacteria 4058
365 Ga0373937_0118004 3300036401 Bacteria 2471
366 Ga0316584_0006436 3300036712 Bacteria 7950
367 Ga0395899_0045530 3300037312 Bacteria 3269
368 Ga0395900_0019906 3300037418 Bacteria 6841
369 Ga0395898_0008133 3300037466 Bacteria 11104
370 Ga0395898_0022412 3300037466 Bacteria 6397
371 Ga0395898_0201342 3300037466 Bacteria 1901
372 Ga0395905_0062047 3300037471 Bacteria 3496
373 Ga0395905_0082991 3300037471 Bacteria 3003
374 Ga0436364_0540677 3300037853 Bacteria 10501
375 Ga0436364_0632307 3300037853 Bacteria 4747
376 Ga0436364_0691258 3300037853 Bacteria 9089
377 Ga0436364_0710568 3300037853 Bacteria 49951
378 Ga0395901_0046782 3300038443 Bacteria 4494
379 Ga0395901_0096098 3300038443 Bacteria 3105
380 Ga0395901_0102169 3300038443 Bacteria 3008
381 Ga0436365_0146714 3300039437 Bacteria 6706
382 Ga0436365_0470617 3300039437 Bacteria 2277
383 Ga0436365_0666274 3300039437 Bacteria 19604
384 Ga0436365_0765215 3300039437 Bacteria 14228
385 Ga0436365_0846702 3300039437 Bacteria 2406
386 Ga0436365_0959238 3300039437 Bacteria 2365
387 Ga0436365_1135905 3300039437 Bacteria 2186
388 Ga0436365_1292596 3300039437 Bacteria 9373
389 Ga0436363_1171799 3300039450 Bacteria 7388
390 Ga0436362_0839696 3300039453 Bacteria 2679
391 Ga0436362_0908846 3300039453 Bacteria 2479
392 Ga0466969_0008888 3300044656 Bacteria 5328
393 Ga0466966_0085084 3300044684 Bacteria 1966
394 Ga0466961_0000571 3300044693 Bacteria 23411
395 Ga0466961_0034661 3300044693 Bacteria 3240
396 Ga0466961_0036839 3300044693 Bacteria 3139
397 Ga0466963_0000022 3300044694 Bacteria 52600
398 Ga0466963_0008369 3300044694 Bacteria 6197
399 Ga0466963_0032634 3300044694 Bacteria 3374
400 Ga0466971_0004563 3300044719 Bacteria 5989
401 Ga0466971_0042936 3300044719 Bacteria 2032
402 Ga0466968_0004001 3300044735 Bacteria 5478
403 Ga0466968_0019276 3300044735 Bacteria 2746
404 Ga0466970_0047840 3300044765 Bacteria 2280
405 Ga0466957_0035372 3300044842 Bacteria 2997
406 Ga0466957_0036255 3300044842 Bacteria 2964
407 Ga0466957_0038421 3300044842 Bacteria 2884
408 Ga0466960_0043074 3300044901 Bacteria 2145
409 Ga0466959_0000734 3300045049 Bacteria 19135
410 Ga0466959_0010557 3300045049 Bacteria 6610
411 Ga0466959_0028899 3300045049 Bacteria 4108
412 Ga0466958_0002570 3300045836 Bacteria 9161
413 Ga0466958_0009792 3300045836 Bacteria 5347
414 Ga0466958_0012514 3300045836 Bacteria 4810
415 Ga0466958_0016113 3300045836 Bacteria 4300
416 Ga0466958_0026512 3300045836 Bacteria 3425
417 Ga0466958_0059215 3300045836 Bacteria 2330
418 Ga0466967_0000017 3300045976 Bacteria 89904
419 Ga0466967_0006633 3300045976 Bacteria 8229
420 Ga0466967_0034557 3300045976 Bacteria 4293
421 Ga0466967_0052216 3300045976 Bacteria 3587
422 Ga0466967_0072530 3300045976 Bacteria 3086
423 Ga0466967_0089643 3300045976 Bacteria 2792
424 Ga0466967_0101878 3300045976 Bacteria 2625
425 Ga0495592_0108363 3300046454 Bacteria 1969
426 Ga0495603_0000471 3300046455 Bacteria 22167
427 Ga0495603_0000594 3300046455 Bacteria 20327
428 Ga0495603_0070864 3300046455 Bacteria 2049
429 Ga0495629_0000999 3300046459 Bacteria 22693
430 Ga0495638_0007166 3300046460 Bacteria 8030
431 Ga0495651_0035244 3300046462 Bacteria 3898
432 Ga0495651_0075386 3300046462 Bacteria 2557
433 Ga0495653_0005601 3300046463 Bacteria 10245
434 Ga0495582_0000001 3300046473 Bacteria 252434
435 Ga0495662_0002875 3300046476 Bacteria 8712
436 Ga0495664_0000011 3300046477 Bacteria 253351
437 Ga0495594_0000011 3300046499 Bacteria 118444
438 Ga0495606_0000108 3300046507 Bacteria 140473
439 Ga0495608_0000036 3300046511 Bacteria 129609
440 Ga0495608_0116019 3300046511 Bacteria 1718
441 Ga0495618_0000512 3300046514 Bacteria 27479
442 Ga0495620_0002158 3300046515 Bacteria 11431
443 Ga0495628_0007112 3300046516 Bacteria 9694
444 Ga0495630_0000012 3300046517 Bacteria 223330
445 Ga0495630_0000570 3300046517 Bacteria 26861
446 Ga0495630_0001559 3300046517 Bacteria 15919
447 Ga0495652_0000023 3300046529 Bacteria 168049
448 Ga0495652_0031335 3300046529 Bacteria 4657
449 Ga0495587_0000703 3300046536 Bacteria 22378
450 Ga0495587_0069797 3300046536 Bacteria 2045
451 Ga0495645_0000023 3300046543 Bacteria 130982
452 Ga0495645_0001131 3300046543 Bacteria 18053
453 Ga0495645_0001215 3300046543 Bacteria 17592
454 Ga0495622_0000021 3300046557 Bacteria 162267
455 Ga0495667_0000034 3300046559 Bacteria 141464
456 Ga0495668_0049644 3300046616 Bacteria 2327
457 Ga0495634_0000028 3300046642 Bacteria 114075
458 Ga0495634_0001510 3300046642 Bacteria 20589
459 Ga0495634_0024380 3300046642 Bacteria 4245
460 Ga0495625_0000506 3300046660 Bacteria 57832
461 Ga0495635_0037574 3300046663 Bacteria 3352
462 Ga0495635_0093129 3300046663 Bacteria 2060
463 Ga0495588_0000393 3300046674 Bacteria 24845
464 Ga0495657_0000001 3300046675 Bacteria 445641
465 Ga0495657_0000007 3300046675 Bacteria 222471
466 Ga0495657_0129479 3300046675 Bacteria 1582
467 Ga0495647_0014058 3300046681 Bacteria 2784
468 Ga0495658_0000193 3300046683 Bacteria 35142
469 Ga0495658_0054079 3300046683 Bacteria 2282
470 Ga0495613_0000860 3300046689 Bacteria 23282
471 Ga0495624_0020815 3300046690 Bacteria 4358
472 Ga0495600_0003292 3300046809 Bacteria 9474
473 Ga0495600_0018459 3300046809 Bacteria 4445
474 Ga0495604_0000122 3300047317 Bacteria 65938
475 Ga0495604_0000267 3300047317 Bacteria 46398
476 Ga0495604_0000852 3300047317 Bacteria 25474
477 Ga0495604_0007409 3300047317 Bacteria 8692
478 Ga0495604_0043636 3300047317 Bacteria 3509
479 Ga0495674_0000059 3300047319 Bacteria 73353
480 Ga0495672_0016579 3300047320 Bacteria 4959
481 Ga0495672_0035031 3300047320 Bacteria 3094
482 Ga0495676_0001626 3300047321 Bacteria 19533
483 Ga0495676_0026507 3300047321 Bacteria 4988
484 Ga0495676_0045174 3300047321 Bacteria 3588
485 Ga0495680_0001649 3300047322 Bacteria 23717
486 Ga0495680_0015816 3300047322 Bacteria 6495
487 Ga0495680_0025245 3300047322 Bacteria 4921
488 Ga0495675_0000515 3300047444 Bacteria 25086
489 Ga0495675_0034972 3300047444 Bacteria 3209
490 Ga0495675_0058207 3300047444 Bacteria 2451
491 Ga0495686_0028251 3300047472 Bacteria 3653
492 Ga0495602_0000166 3300048088 Bacteria 61220
493 Ga0495602_0006880 3300048088 Bacteria 11952
494 Ga0495602_0055519 3300048088 Bacteria 3488
495 Ga0496100_0000005 3300048903 Bacteria 312112
496 Ga0496100_0001670 3300048903 Bacteria 11011
497 Ga0496101_0000493 3300048904 Bacteria 24897
498 Ga0496101_0042499 3300048904 Bacteria 3244
499 Ga0496101_0062170 3300048904 Bacteria 2714
500 Ga0496102_0000053 3300048905 Bacteria 176385
501 Ga0496102_0000081 3300048905 Bacteria 139266
502 Ga0496102_0017198 3300048905 Bacteria 6331
503 Ga0496103_0000031 3300048906 Bacteria 204016
504 Ga0496103_0000162 3300048906 Bacteria 70675
505 Ga0496103_0016357 3300048906 Bacteria 4427
506 Ga0496103_0024086 3300048906 Bacteria 3672
507 Ga0496104_0000036 3300048907 Bacteria 180472
508 Ga0496104_0000077 3300048907 Bacteria 100848
509 Ga0496104_0001546 3300048907 Bacteria 19843
510 Ga0496104_0013755 3300048907 Bacteria 7298
511 Ga0496104_0032062 3300048907 Bacteria 4890
512 Ga0496104_0039362 3300048907 Bacteria 4427
513 Ga0496105_0000004 3300048908 Bacteria 475798
514 Ga0496105_0000098 3300048908 Bacteria 59301
515 Ga0496105_0048437 3300048908 Bacteria 3508
516 Ga0496105_0053351 3300048908 Bacteria 3339
517 Ga0496105_0053384 3300048908 Bacteria 3338
518 Ga0496106_0000193 3300048909 Bacteria 42951
519 Ga0496106_0001777 3300048909 Bacteria 16096
520 Ga0496106_0002707 3300048909 Bacteria 13148
521 Ga0496106_0110337 3300048909 Bacteria 2141
522 Ga0496107_0000094 3300048910 Bacteria 42797
523 Ga0496107_0000834 3300048910 Bacteria 17990
524 Ga0496107_0005273 3300048910 Bacteria 8829
525 Ga0496107_0036951 3300048910 Bacteria 3504
526 Ga0496107_0056224 3300048910 Bacteria 2843
527 Ga0496107_0140178 3300048910 Bacteria 1787
528 Ga0496108_0000355 3300048911 Bacteria 38685
529 Ga0496108_0001109 3300048911 Bacteria 21079
530 Ga0496108_0040293 3300048911 Bacteria 3893
531 Ga0496108_0066517 3300048911 Bacteria 3039
532 Ga0496108_0109616 3300048911 Bacteria 2359
533 Ga0496109_0000276 3300048912 Bacteria 49120
534 Ga0496109_0000400 3300048912 Bacteria 39194
535 Ga0496109_0000903 3300048912 Bacteria 24701
536 Ga0496109_0001433 3300048912 Bacteria 19779
537 Ga0496109_0001543 3300048912 Bacteria 19146
538 Ga0496109_0017755 3300048912 Bacteria 6241
539 Ga0496109_0023662 3300048912 Bacteria 5452
540 Ga0496109_0263170 3300048912 Bacteria 1624
541 Ga0496110_0000011 3300048913 Bacteria 97293
542 Ga0496110_0000496 3300048913 Bacteria 26770
543 Ga0496110_0002236 3300048913 Bacteria 14470
544 Ga0496110_0032285 3300048913 Bacteria 4521
545 Ga0496110_0110281 3300048913 Bacteria 2472
546 Ga0496111_0000691 3300048914 Bacteria 17813
547 Ga0496111_0006159 3300048914 Bacteria 7765
548 Ga0496111_0006612 3300048914 Bacteria 7543
549 Ga0496111_0075898 3300048914 Bacteria 2449
550 Ga0496112_0000085 3300048915 Bacteria 61255
551 Ga0496112_0000980 3300048915 Bacteria 20831
552 Ga0496112_0017335 3300048915 Bacteria 6764
553 Ga0496113_0000283 3300048916 Bacteria 23978
554 Ga0496113_0055479 3300048916 Bacteria 2970
555 Ga0496113_0059168 3300048916 Bacteria 2886
556 Ga0496114_0000450 3300048917 Bacteria 30262
557 Ga0496114_0001473 3300048917 Bacteria 17863
558 Ga0496115_0000010 3300048918 Bacteria 227112
559 Ga0496115_0000064 3300048918 Bacteria 99309
560 Ga0496115_0000087 3300048918 Bacteria 86513
561 Ga0496115_0000241 3300048918 Bacteria 49730
562 Ga0496115_0000533 3300048918 Bacteria 29638
563 Ga0496115_0001569 3300048918 Bacteria 16428
564 Ga0496115_0098969 3300048918 Bacteria 2389
565 Ga0496116_0000176 3300048919 Bacteria 128426
566 Ga0496119_0003810 3300048922 Bacteria 15414
567 Ga0496119_0039326 3300048922 Bacteria 3041
568 Ga0496119_0067877 3300048922 Bacteria 2101
569 Ga0496120_0002545 3300048923 Bacteria 18180
570 Ga0496120_0044280 3300048923 Bacteria 2587
571 Ga0496121_0009920 3300048924 Bacteria 10841
572 Ga0496125_0023597 3300048928 Bacteria 5674
573 Ga0496125_0087688 3300048928 Bacteria 2349
574 Ga0496126_0025417 3300048929 Bacteria 5697
575 Ga0496126_0042089 3300048929 Bacteria 4221
576 Ga0501031_0000317 3300049568 Bacteria 27571
577 Ga0501033_0000488 3300049570 Bacteria 37325
578 Ga0501034_0019495 3300049571 Bacteria 6937
579 Ga0501036_0001078 3300049572 Bacteria 20682
580 Ga0501036_0125107 3300049572 Bacteria 2171
581 Ga0501037_0000372 3300049573 Bacteria 37292
582 Ga0501038_0000101 3300049574 Bacteria 72459
583 Ga0501039_0032900 3300049575 Bacteria 3999
584 Ga0501042_0015590 3300049578 Bacteria 5206
585 Ga0501042_0046632 3300049578 Bacteria 3090
586 Ga0501046_0001709 3300049580 Bacteria 20963
587 Ga0501046_0100321 3300049580 Bacteria 2222
588 Ga0501047_0001213 3300049581 Bacteria 25583
589 Ga0501047_0002265 3300049581 Bacteria 18413
590 Ga0501048_0001051 3300049582 Bacteria 20671
591 Ga0501069_0054170 3300049585 Bacteria 2234
592 Ga0501070_0000346 3300049586 Bacteria 42122
593 Ga0501070_0027403 3300049586 Bacteria 4780
594 Ga0501071_0006203 3300049587 Bacteria 7753
595 Ga0501071_0067382 3300049587 Bacteria 2603
596 Ga0501073_0002837 3300049589 Bacteria 12987
597 Ga0501074_0019852 3300049590 Bacteria 4881
598 Ga0501075_0078870 3300049591 Bacteria 2493
599 Ga0501076_0048290 3300049592 Bacteria 3365
600 Ga0501076_0119895 3300049592 Bacteria 2130
601 Ga0501080_0006622 3300049742 Bacteria 10420
602 Ga0501083_0003579 3300049744 Bacteria 10891
603 Ga0501035_0000534 3300049822 Bacteria 42484
604 Ga0501044_0000820 3300049823 Bacteria 37419
605 Ga0501044_0015577 3300049823 Bacteria 8192
606 Ga0501044_0186704 3300049823 Bacteria 2037
607 Ga0501045_0028542 3300049824 Bacteria 4026
608 Ga0501045_0078718 3300049824 Bacteria 2430
609 nmdc:mga03n38_21489_c1 3300050490 Bacteria 2597
610 nmdc:mga00v17_25136_c1 3300050491 Bacteria 3459
611 nmdc:mga00v17_50585_c1 3300050491 Bacteria 2525
612 nmdc:mga00v17_65561_c1 3300050491 Bacteria 2241
613 nmdc:mga0yw44_12468_c1 3300050492 Bacteria 4433
614 nmdc:mga0yw44_5272_c1 3300050492 Bacteria 6069
615 nmdc:mga05p37_124721_c1 3300050507 Bacteria 3163
616 nmdc:mga05p37_19950_c1 3300050507 Bacteria 8110
617 nmdc:mga05p37_7012_c1 3300050507 Bacteria 13281
618 nmdc:mga05p37_99217_c1 3300050507 Bacteria 3587
619 nmdc:mga0qj67_411_c1 3300050509 Bacteria 29303
620 nmdc:mga06r32_112699_c1 3300050510 Bacteria 2677
621 nmdc:mga06r32_21158_c1 3300050510 Bacteria 6002
622 nmdc:mga06r32_2376_c1 3300050510 Bacteria 16856
623 nmdc:mga06r32_5197_c1 3300050510 Bacteria 11698
624 nmdc:mga06r32_77199_c1 3300050510 Bacteria 3235
625 nmdc:mga06r32_92494_c1 3300050510 Bacteria 2957
626 nmdc:mga08y16_119057_c1 3300050511 Bacteria 2749
627 nmdc:mga08y16_38950_c1 3300050511 Bacteria 4989
628 nmdc:mga08y16_97609_c1 3300050511 Bacteria 3060
629 nmdc:mga0n895_2082_c1 3300050512 Bacteria 4347
630 nmdc:mga0n895_47706_c1 3300050512 Bacteria 4189
631 nmdc:mga0rr50_42089_c1 3300050513 Bacteria 3333
632 nmdc:mga0rr50_75999_c1 3300050513 Bacteria 2577
633 nmdc:mga0a205_45_c1 3300050515 Bacteria 68070
634 nmdc:mga0a205_63684_c1 3300050515 Bacteria 3562
635 nmdc:mga0a205_7640_c1 3300050515 Bacteria 9805
636 Ga0495601_0000034 3300053077 Bacteria 93719
637 Ga0495601_0010167 3300053077 Bacteria 5592
638 Ga0495601_0015325 3300053077 Bacteria 4633
639 Ga0495612_0001134 3300053078 Bacteria 10926
640 Ga0495612_0005209 3300053078 Bacteria 5373
641 Ga0495655_0000023 3300053083 Bacteria 39507
642 Ga0495595_0000002 3300053084 Bacteria 445641
643 Ga0495595_0017313 3300053084 Bacteria 3100
644 Ga0495619_0000008 3300053085 Bacteria 305999
645 Ga0495619_0000277 3300053085 Bacteria 36725
646 Ga0495619_0000602 3300053085 Bacteria 23838
647 Ga0495619_0000776 3300053085 Bacteria 20883
648 Ga0495619_0000929 3300053085 Bacteria 19273
649 Ga0495619_0002992 3300053085 Bacteria 10976
650 Ga0495619_0003076 3300053085 Bacteria 10833
651 Ga0495619_0006703 3300053085 Bacteria 7285
652 Ga0500566_0002030 3300053094 Bacteria 11955
653 Ga0500628_000001 3300053129 Bacteria 564074
654 Ga0501082_0005883 3300060353 Bacteria 10647
655 Ga0501082_0110587 3300060353 Bacteria 2378
656 Ga0466962_0025419 3300061719 Bacteria 2843

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0129479 Ga0495657_0129479_213_1571 419
2 3300048905 Ga0496102_0000053 Ga0496102_0000053_73400_74983 439
3 3300048906 Ga0496103_0000162 Ga0496103_0000162_20931_22514 439
4 3300005614 Ga0068856_100076645 Ga0068856_1000766453 443
5 3300026078 Ga0207702_10154702 Ga0207702_101547021 443
6 3300005985 Ga0081539_10002920 Ga0081539_1000292014 447
7 3300046511 Ga0495608_0116019 Ga0495608_0116019_329_1708 449
8 3300005334 Ga0068869_100160925 Ga0068869_1001609252 450
9 3300045836 Ga0466958_0059215 Ga0466958_0059215_260_1855 451
10 3300005983 Ga0081540_1002867 Ga0081540_100286713 455
11 3300037312 Ga0395899_0045530 Ga0395899_0045530_1279_2847 458
12 3300038443 Ga0395901_0102169 Ga0395901_0102169_1047_2615 458
13 3300049568 Ga0501031_0000317 Ga0501031_0000317_7555_9135 460
14 3300049570 Ga0501033_0000488 Ga0501033_0000488_24108_25688 460
15 3300049572 Ga0501036_0001078 Ga0501036_0001078_11537_13117 460
16 3300049573 Ga0501037_0000372 Ga0501037_0000372_24112_25692 460
17 3300049574 Ga0501038_0000101 Ga0501038_0000101_59276_60856 460
18 3300049580 Ga0501046_0001709 Ga0501046_0001709_7693_9273 460
19 3300049581 Ga0501047_0001213 Ga0501047_0001213_16296_17876 460
20 3300049582 Ga0501048_0001051 Ga0501048_0001051_11538_13118 460
21 3300049586 Ga0501070_0000346 Ga0501070_0000346_16438_18018 460
22 3300049589 Ga0501073_0002837 Ga0501073_0002837_3634_5214 460
23 3300049590 Ga0501074_0019852 Ga0501074_0019852_3075_4655 460
24 3300049742 Ga0501080_0006622 Ga0501080_0006622_6149_7729 460
25 3300049744 Ga0501083_0003579 Ga0501083_0003579_6690_8270 460
26 3300049822 Ga0501035_0000534 Ga0501035_0000534_20727_22307 460
27 3300049823 Ga0501044_0000820 Ga0501044_0000820_11683_13263 460
28 3300049824 Ga0501045_0028542 Ga0501045_0028542_1884_3464 460
29 3300060353 Ga0501082_0005883 Ga0501082_0005883_7526_9106 460
30 3300009176 Ga0105242_10000085 Ga0105242_1000008516 461
31 3300021384 Ga0213876_10015191 Ga0213876_100151913 461
32 3300039437 Ga0436365_0666274 Ga0436365_0666274_6332_7924 461
33 3300048928 Ga0496125_0087688 Ga0496125_0087688_422_2026 461
34 3300003373 JGI25407J50210_10008812 JGI25407J50210_100088122 462
35 3300005981 Ga0081538_10000235 Ga0081538_1000023557 462
36 3300028379 Ga0268266_10001702 Ga0268266_100017028 462
37 3300047321 Ga0495676_0026507 Ga0495676_0026507_2747_4330 465
38 3300046455 Ga0495603_0070864 Ga0495603_0070864_168_1763 466
39 3300044656 Ga0466969_0008888 Ga0466969_0008888_701_2269 467
40 3300044693 Ga0466961_0034661 Ga0466961_0034661_1387_2955 467
41 3300045836 Ga0466958_0009792 Ga0466958_0009792_2504_4072 467
42 3300044684 Ga0466966_0085084 Ga0466966_0085084_27_1595 468
43 3300044693 Ga0466961_0000571 Ga0466961_0000571_7533_9101 468
44 3300045049 Ga0466959_0010557 Ga0466959_0010557_574_2142 468
45 3300045836 Ga0466958_0012514 Ga0466958_0012514_117_1685 468
46 3300005937 Ga0081455_10007309 Ga0081455_100073098 470
47 3300037418 Ga0395900_0019906 Ga0395900_0019906_4640_6211 471
48 3300044735 Ga0466968_0004001 Ga0466968_0004001_3057_4625 471
49 3300048918 Ga0496115_0000064 Ga0496115_0000064_48102_49730 471
50 3300048918 Ga0496115_0000241 Ga0496115_0000241_33185_34825 471
51 3300050512 nmdc:mga0n895_47706_c1 nmdc:mga0n895_47706_c1_707_2305 471
52 3300050513 nmdc:mga0rr50_75999_c1 nmdc:mga0rr50_75999_c1_338_1936 471
53 3300035398 Ga0316574_0001485 Ga0316574_0001485_8112_9704 472
54 3300009545 Ga0105237_10013027 Ga0105237_100130279 474
55 3300025914 Ga0207671_10028718 Ga0207671_100287183 474
56 3300044694 Ga0466963_0032634 Ga0466963_0032634_796_2361 474
57 3300045836 Ga0466958_0016113 Ga0466958_0016113_2679_4265 474
58 3300045976 Ga0466967_0089643 Ga0466967_0089643_626_2191 474
59 3300048911 Ga0496108_0066517 Ga0496108_0066517_1267_2889 475
60 3300005329 Ga0070683_100085928 Ga0070683_1000859282 478
61 3300005331 Ga0070670_100041099 Ga0070670_1000410994 478
62 3300005343 Ga0070687_100000924 Ga0070687_10000092411 478
63 3300005365 Ga0070688_100039415 Ga0070688_1000394151 478
64 3300005614 Ga0068856_100046055 Ga0068856_1000460554 478
65 3300009093 Ga0105240_10058462 Ga0105240_100584622 478
66 3300013296 Ga0157374_10120059 Ga0157374_101200592 478
67 3300025913 Ga0207695_10044076 Ga0207695_100440765 478
68 3300026075 Ga0207708_10001416 Ga0207708_1000141614 478
69 3300037466 Ga0395898_0022412 Ga0395898_0022412_582_2177 478
70 3300005615 Ga0070702_100058822 Ga0070702_1000588222 479
71 3300046462 Ga0495651_0035244 Ga0495651_0035244_1020_2606 479
72 3300049587 Ga0501071_0006203 Ga0501071_0006203_5840_7444 479
73 3300049823 Ga0501044_0186704 Ga0501044_0186704_358_1962 479
74 3300037853 Ga0436364_0691258 Ga0436364_0691258_6263_7849 481
75 3300039437 Ga0436365_0959238 Ga0436365_0959238_593_2179 481
76 3300014745 Ga0157377_10012907 Ga0157377_100129074 483
77 3300050491 nmdc:mga00v17_65561_c1 nmdc:mga00v17_65561_c1_396_1991 483
78 3300005981 Ga0081538_10021470 Ga0081538_100214704 484
79 3300028558 Ga0265326_10000023 Ga0265326_1000002376 485
80 3300028573 Ga0265334_10000135 Ga0265334_1000013528 485
81 3300028666 Ga0265336_10008684 Ga0265336_100086842 485
82 3300028800 Ga0265338_10000902 Ga0265338_1000090233 485
83 3300029957 Ga0265324_10001427 Ga0265324_100014274 485
84 3300005548 Ga0070665_100000627 Ga0070665_10000062733 486
85 3300025933 Ga0207706_10064665 Ga0207706_100646651 486
86 3300028563 Ga0265319_1003540 Ga0265319_10035402 486
87 3300045976 Ga0466967_0006633 Ga0466967_0006633_1580_3142 486
88 3300050515 nmdc:mga0a205_63684_c1 nmdc:mga0a205_63684_c1_1389_2987 486
89 3300037466 Ga0395898_0008133 Ga0395898_0008133_4646_6241 487
90 3300037471 Ga0395905_0062047 Ga0395905_0062047_499_2094 487
91 3300038443 Ga0395901_0046782 Ga0395901_0046782_2013_3608 487
92 3300038443 Ga0395901_0096098 Ga0395901_0096098_1031_2587 487
93 3300006880 Ga0075429_100140358 Ga0075429_1001403582 488
94 3300049572 Ga0501036_0125107 Ga0501036_0125107_40_1596 488
95 3300049587 Ga0501071_0067382 Ga0501071_0067382_94_1650 488
96 3300049824 Ga0501045_0078718 Ga0501045_0078718_817_2373 488
97 3300060353 Ga0501082_0110587 Ga0501082_0110587_414_1970 488
98 3300005437 Ga0070710_10000015 Ga0070710_1000001515 489
99 3300025898 Ga0207692_10000013 Ga0207692_1000001384 489
100 3300044719 Ga0466971_0042936 Ga0466971_0042936_269_1831 489
101 3300049580 Ga0501046_0100321 Ga0501046_0100321_614_2173 489
102 3300005981 Ga0081538_10010215 Ga0081538_100102156 491
103 3300005983 Ga0081540_1000041 Ga0081540_1000041122 491
104 3300046477 Ga0495664_0000011 Ga0495664_0000011_36190_37782 491
105 3300005406 Ga0070703_10014907 Ga0070703_100149071 492
106 3300025934 Ga0207686_10000199 Ga0207686_1000019916 492
107 3300048929 Ga0496126_0025417 Ga0496126_0025417_2412_4016 492
108 3300049581 Ga0501047_0002265 Ga0501047_0002265_4658_6238 492
109 3300053094 Ga0500566_0002030 Ga0500566_0002030_8112_9698 492
110 3300061719 Ga0466962_0025419 Ga0466962_0025419_548_2137 492
111 3300005327 Ga0070658_10069134 Ga0070658_100691343 493
112 3300005329 Ga0070683_100025146 Ga0070683_1000251463 493
113 3300005340 Ga0070689_100054916 Ga0070689_1000549162 493
114 3300005345 Ga0070692_10000809 Ga0070692_100008092 493
115 3300005347 Ga0070668_100037922 Ga0070668_1000379222 493
116 3300005356 Ga0070674_100000004 Ga0070674_100000004153 493
117 3300005366 Ga0070659_100009454 Ga0070659_1000094547 493
118 3300005455 Ga0070663_100001585 Ga0070663_10000158512 493
119 3300005459 Ga0068867_100004390 Ga0068867_1000043902 493
120 3300005539 Ga0068853_100021127 Ga0068853_1000211274 493
121 3300005543 Ga0070672_100005111 Ga0070672_1000051115 493
122 3300005718 Ga0068866_10000004 Ga0068866_10000004190 493
123 3300006038 Ga0075365_10056722 Ga0075365_100567222 493
124 3300006048 Ga0075363_100009622 Ga0075363_1000096224 493
125 3300006051 Ga0075364_10014024 Ga0075364_100140242 493
126 3300014326 Ga0157380_10008928 Ga0157380_100089285 493
127 3300014745 Ga0157377_10004901 Ga0157377_100049012 493
128 3300025899 Ga0207642_10000005 Ga0207642_1000000517 493
129 3300025901 Ga0207688_10011075 Ga0207688_100110754 493
130 3300025909 Ga0207705_10048310 Ga0207705_100483103 493
131 3300025932 Ga0207690_10045402 Ga0207690_100454022 493
132 3300025937 Ga0207669_10000131 Ga0207669_1000013115 493
133 3300025940 Ga0207691_10012528 Ga0207691_100125285 493
134 3300025944 Ga0207661_10049401 Ga0207661_100494013 493
135 3300025944 Ga0207661_10075464 Ga0207661_100754642 493
136 3300025945 Ga0207679_10137022 Ga0207679_101370221 493
137 3300025960 Ga0207651_10094573 Ga0207651_100945732 493
138 3300025972 Ga0207668_10029480 Ga0207668_100294804 493
139 3300026023 Ga0207677_10037265 Ga0207677_100372652 493
140 3300026041 Ga0207639_10054809 Ga0207639_100548092 493
141 3300026089 Ga0207648_10008149 Ga0207648_1000814912 493
142 3300026095 Ga0207676_10063990 Ga0207676_100639903 493
143 3300026142 Ga0207698_10050057 Ga0207698_100500573 493
144 3300044693 Ga0466961_0036839 Ga0466961_0036839_749_2335 493
145 3300044719 Ga0466971_0004563 Ga0466971_0004563_2361_3947 493
146 3300044842 Ga0466957_0038421 Ga0466957_0038421_619_2205 493
147 3300045049 Ga0466959_0028899 Ga0466959_0028899_2131_3717 493
148 3300046473 Ga0495582_0000001 Ga0495582_0000001_204989_206575 493
149 3300046536 Ga0495587_0069797 Ga0495587_0069797_296_1882 493
150 3300046683 Ga0495658_0000193 Ga0495658_0000193_18045_19631 493
151 3300047317 Ga0495604_0000267 Ga0495604_0000267_15158_16744 493
152 3300048909 Ga0496106_0110337 Ga0496106_0110337_401_2020 493
153 3300048911 Ga0496108_0109616 Ga0496108_0109616_186_1805 493
154 3300048912 Ga0496109_0001543 Ga0496109_0001543_13827_15446 493
155 3300048913 Ga0496110_0110281 Ga0496110_0110281_814_2433 493
156 3300050510 nmdc:mga06r32_21158_c1 nmdc:mga06r32_21158_c1_209_1804 493
157 3300053083 Ga0495655_0000023 Ga0495655_0000023_19599_21185 493
158 3300053129 Ga0500628_000001 Ga0500628_000001_421282_422868 493
159 3300006163 Ga0070715_10000014 Ga0070715_10000014150 494
160 3300006852 Ga0075433_10000244 Ga0075433_1000024417 494
161 3300025905 Ga0207685_10000025 Ga0207685_1000002517 494
162 3300046476 Ga0495662_0002875 Ga0495662_0002875_6207_7805 494
163 3300046642 Ga0495634_0001510 Ga0495634_0001510_15188_16774 494
164 3300050515 nmdc:mga0a205_45_c1 nmdc:mga0a205_45_c1_15730_17316 494
165 3300053085 Ga0495619_0006703 Ga0495619_0006703_3311_4897 494
166 3300048911 Ga0496108_0001109 Ga0496108_0001109_1788_3386 495
167 3300048912 Ga0496109_0001433 Ga0496109_0001433_15368_16966 495
168 3300048915 Ga0496112_0000085 Ga0496112_0000085_16759_18348 495
169 3300049586 Ga0501070_0027403 Ga0501070_0027403_244_1839 495
170 3300013104 Ga0157370_10035413 Ga0157370_100354132 496
171 3300028563 Ga0265319_1000084 Ga0265319_100008414 496
172 3300031240 Ga0265320_10016269 Ga0265320_100162693 496
173 3300047322 Ga0495680_0025245 Ga0495680_0025245_916_2502 496
174 3300048905 Ga0496102_0000081 Ga0496102_0000081_119732_121318 496
175 3300048906 Ga0496103_0000031 Ga0496103_0000031_17026_18612 496
176 3300048917 Ga0496114_0000450 Ga0496114_0000450_11667_13253 496
177 3300048918 Ga0496115_0000533 Ga0496115_0000533_11656_13242 496
178 3300021384 Ga0213876_10019784 Ga0213876_100197843 497
179 3300039437 Ga0436365_0765215 Ga0436365_0765215_100_1689 497
180 3300039453 Ga0436362_0839696 Ga0436362_0839696_272_1861 497
181 3300048919 Ga0496116_0000176 Ga0496116_0000176_114568_116172 497
182 3300048922 Ga0496119_0039326 Ga0496119_0039326_108_1712 497
183 3300046557 Ga0495622_0000021 Ga0495622_0000021_123538_125124 498
184 3300049578 Ga0501042_0015590 Ga0501042_0015590_1299_2894 498
185 3300005347 Ga0070668_100037191 Ga0070668_1000371913 499
186 3300005356 Ga0070674_100008378 Ga0070674_1000083782 499
187 3300005459 Ga0068867_100051179 Ga0068867_1000511793 499
188 3300006038 Ga0075365_10000786 Ga0075365_1000078614 499
189 3300006847 Ga0075431_100003598 Ga0075431_10000359813 499
190 3300009094 Ga0111539_10008658 Ga0111539_1000865811 499
191 3300009147 Ga0114129_10094883 Ga0114129_100948833 499
192 3300025937 Ga0207669_10009836 Ga0207669_100098362 499
193 3300025972 Ga0207668_10017007 Ga0207668_100170072 499
194 3300026118 Ga0207675_100091446 Ga0207675_1000914462 499
195 3300027907 Ga0207428_10084993 Ga0207428_100849932 499
196 3300046543 Ga0495645_0001215 Ga0495645_0001215_2632_4218 499
197 3300046642 Ga0495634_0000028 Ga0495634_0000028_97303_98889 499
198 3300050490 nmdc:mga03n38_21489_c1 nmdc:mga03n38_21489_c1_641_2236 499
199 3300050491 nmdc:mga00v17_50585_c1 nmdc:mga00v17_50585_c1_128_1723 499
200 3300050492 nmdc:mga0yw44_5272_c1 nmdc:mga0yw44_5272_c1_3646_5241 499
201 3300050507 nmdc:mga05p37_99217_c1 nmdc:mga05p37_99217_c1_516_2111 499
202 3300050510 nmdc:mga06r32_5197_c1 nmdc:mga06r32_5197_c1_4304_5899 499
203 3300005338 Ga0068868_100000633 Ga0068868_10000063317 500
204 3300005981 Ga0081538_10000523 Ga0081538_100005232 500
205 3300026023 Ga0207677_10006893 Ga0207677_100068934 500
206 3300046515 Ga0495620_0002158 Ga0495620_0002158_6676_8262 500
207 3300046642 Ga0495634_0024380 Ga0495634_0024380_2377_3963 500
208 3300048906 Ga0496103_0024086 Ga0496103_0024086_1143_2726 500
209 3300048912 Ga0496109_0000276 Ga0496109_0000276_18724_20343 500
210 3300005338 Ga0068868_100022786 Ga0068868_1000227862 501
211 3300005842 Ga0068858_100000075 Ga0068858_10000007582 501
212 3300026035 Ga0207703_10000088 Ga0207703_1000008882 501
213 3300048910 Ga0496107_0140178 Ga0496107_0140178_103_1662 501
214 3300053085 Ga0495619_0000008 Ga0495619_0000008_288929_290527 501
215 3300014969 Ga0157376_10034595 Ga0157376_100345952 502
216 3300026118 Ga0207675_100055152 Ga0207675_1000551523 502
217 3300003373 JGI25407J50210_10000813 JGI25407J50210_100008134 503
218 3300005981 Ga0081538_10000364 Ga0081538_1000036440 503
219 3300044694 Ga0466963_0008369 Ga0466963_0008369_3285_4874 503
220 3300044735 Ga0466968_0019276 Ga0466968_0019276_1146_2735 503
221 3300044842 Ga0466957_0035372 Ga0466957_0035372_873_2462 503
222 3300045049 Ga0466959_0000734 Ga0466959_0000734_705_2294 503
223 3300045836 Ga0466958_0002570 Ga0466958_0002570_4183_5772 503
224 3300048088 Ga0495602_0055519 Ga0495602_0055519_360_1979 503
225 3300048910 Ga0496107_0056224 Ga0496107_0056224_114_1718 503
226 3300048922 Ga0496119_0003810 Ga0496119_0003810_13113_14717 503
227 3300048924 Ga0496121_0009920 Ga0496121_0009920_6233_7837 503
228 iso_pu_bacteria 2524614857 2526060492 503
229 iso_pu_bacteria 2739367875 2740063222 503
230 3300005329 Ga0070683_100043036 Ga0070683_1000430362 504
231 3300005355 Ga0070671_100090007 Ga0070671_1000900072 504
232 3300005366 Ga0070659_100017917 Ga0070659_1000179172 504
233 3300005438 Ga0070701_10024104 Ga0070701_100241041 504
234 3300005617 Ga0068859_100043111 Ga0068859_1000431112 504
235 3300006931 Ga0097620_100043107 Ga0097620_1000431074 504
236 3300011119 Ga0105246_10099108 Ga0105246_100991082 504
237 3300025908 Ga0207643_10012896 Ga0207643_100128962 504
238 3300025918 Ga0207662_10021201 Ga0207662_100212013 504
239 3300025927 Ga0207687_10113251 Ga0207687_101132512 504
240 3300025942 Ga0207689_10049079 Ga0207689_100490792 504
241 3300026041 Ga0207639_10091972 Ga0207639_100919722 504
242 3300026095 Ga0207676_10032030 Ga0207676_100320303 504
243 3300046511 Ga0495608_0000036 Ga0495608_0000036_111235_112830 504
244 3300046675 Ga0495657_0000001 Ga0495657_0000001_111235_112830 504
245 3300047444 Ga0495675_0000515 Ga0495675_0000515_16803_18398 504
246 3300048907 Ga0496104_0032062 Ga0496104_0032062_2137_3708 504
247 3300048908 Ga0496105_0053351 Ga0496105_0053351_194_1765 504
248 3300048910 Ga0496107_0036951 Ga0496107_0036951_406_1977 504
249 3300048912 Ga0496109_0023662 Ga0496109_0023662_15_1586 504
250 3300048918 Ga0496115_0098969 Ga0496115_0098969_22_1593 504
251 3300053084 Ga0495595_0000002 Ga0495595_0000002_332812_334407 504
252 3300053085 Ga0495619_0000776 Ga0495619_0000776_1014_2609 504
253 3300005535 Ga0070684_100072643 Ga0070684_1000726431 505
254 3300021388 Ga0213875_10006103 Ga0213875_100061032 505
255 3300028563 Ga0265319_1000110 Ga0265319_100011046 505
256 3300028800 Ga0265338_10000578 Ga0265338_1000057847 505
257 3300037853 Ga0436364_0710568 Ga0436364_0710568_48211_49809 505
258 3300046463 Ga0495653_0005601 Ga0495653_0005601_55_1599 505
259 3300048903 Ga0496100_0000005 Ga0496100_0000005_16154_17740 505
260 3300048904 Ga0496101_0000493 Ga0496101_0000493_7217_8803 505
261 3300048909 Ga0496106_0000193 Ga0496106_0000193_16104_17690 505
262 3300048910 Ga0496107_0000094 Ga0496107_0000094_15973_17559 505
263 3300048928 Ga0496125_0023597 Ga0496125_0023597_2908_4524 505
264 3300005329 Ga0070683_100057875 Ga0070683_1000578752 506
265 3300005535 Ga0070684_100052176 Ga0070684_1000521761 506
266 3300005564 Ga0070664_100021697 Ga0070664_1000216971 506
267 3300005577 Ga0068857_100014880 Ga0068857_1000148805 506
268 3300005618 Ga0068864_100091284 Ga0068864_1000912842 506
269 3300025909 Ga0207705_10087233 Ga0207705_100872332 506
270 3300025919 Ga0207657_10058960 Ga0207657_100589602 506
271 3300025920 Ga0207649_10054474 Ga0207649_100544742 506
272 3300025945 Ga0207679_10059096 Ga0207679_100590961 506
273 3300026095 Ga0207676_10131540 Ga0207676_101315401 506
274 3300026116 Ga0207674_10004056 Ga0207674_1000405614 506
275 3300031824 Ga0307413_10002409 Ga0307413_100024093 506
276 3300031903 Ga0307407_10003995 Ga0307407_100039956 506
277 3300031995 Ga0307409_100014596 Ga0307409_1000145962 506
278 3300032002 Ga0307416_100007617 Ga0307416_1000076179 506
279 3300032004 Ga0307414_10018430 Ga0307414_100184304 506
280 3300032126 Ga0307415_100001405 Ga0307415_1000014057 506
281 3300046517 Ga0495630_0000570 Ga0495630_0000570_18012_19559 506
282 3300046675 Ga0495657_0000007 Ga0495657_0000007_206139_207686 506
283 3300047444 Ga0495675_0058207 Ga0495675_0058207_44_1696 506
284 3300048915 Ga0496112_0017335 Ga0496112_0017335_3513_5159 506
285 3300048916 Ga0496113_0055479 Ga0496113_0055479_791_2437 506
286 3300003373 JGI25407J50210_10015480 JGI25407J50210_100154802 507
287 3300005617 Ga0068859_100003264 Ga0068859_1000032642 507
288 3300006931 Ga0097620_100003264 Ga0097620_1000032642 507
289 3300013308 Ga0157375_10179550 Ga0157375_101795502 507
290 3300025908 Ga0207643_10013007 Ga0207643_100130072 507
291 3300025918 Ga0207662_10012724 Ga0207662_100127242 507
292 3300025926 Ga0207659_10019571 Ga0207659_100195715 507
293 3300026035 Ga0207703_10068794 Ga0207703_100687943 507
294 3300026116 Ga0207674_10011888 Ga0207674_100118882 507
295 3300049578 Ga0501042_0046632 Ga0501042_0046632_349_1926 507
296 3300049585 Ga0501069_0054170 Ga0501069_0054170_346_1950 507
297 3300049592 Ga0501076_0119895 Ga0501076_0119895_239_1816 507
298 3300005434 Ga0070709_10002238 Ga0070709_100022384 508
299 3300005436 Ga0070713_100053985 Ga0070713_1000539854 508
300 3300025906 Ga0207699_10000030 Ga0207699_10000030140 508
301 3300025929 Ga0207664_10022668 Ga0207664_100226683 508
302 3300031995 Ga0307409_100007309 Ga0307409_1000073092 508
303 3300045976 Ga0466967_0101878 Ga0466967_0101878_903_2558 508
304 3300046543 Ga0495645_0000023 Ga0495645_0000023_105412_107016 508
305 3300050510 nmdc:mga06r32_112699_c1 nmdc:mga06r32_112699_c1_985_2583 508
306 3300048918 Ga0496115_0000087 Ga0496115_0000087_64465_66063 509
307 3300005937 Ga0081455_10011436 Ga0081455_100114362 510
308 3300046663 Ga0495635_0093129 Ga0495635_0093129_170_1756 510
309 3300005937 Ga0081455_10010376 Ga0081455_100103765 511
310 3300005985 Ga0081539_10037509 Ga0081539_100375092 511
311 3300046517 Ga0495630_0001559 Ga0495630_0001559_112_1698 511
312 3300053077 Ga0495601_0015325 Ga0495601_0015325_415_2001 511
313 3300005937 Ga0081455_10108999 Ga0081455_101089992 512
314 3300005981 Ga0081538_10003277 Ga0081538_1000327712 512
315 3300006852 Ga0075433_10015850 Ga0075433_100158504 512
316 3300007076 Ga0075435_100114618 Ga0075435_1001146182 512
317 3300009094 Ga0111539_10106262 Ga0111539_101062623 512
318 3300009098 Ga0105245_10045353 Ga0105245_100453534 512
319 3300009147 Ga0114129_10144968 Ga0114129_101449682 512
320 3300027907 Ga0207428_10056495 Ga0207428_100564952 512
321 3300039437 Ga0436365_0846702 Ga0436365_0846702_275_1867 512
322 3300044901 Ga0466960_0043074 Ga0466960_0043074_501_2072 512
323 3300048912 Ga0496109_0000400 Ga0496109_0000400_21062_22666 512
324 3300050511 nmdc:mga08y16_97609_c1 nmdc:mga08y16_97609_c1_525_2078 512
325 3300050513 nmdc:mga0rr50_42089_c1 nmdc:mga0rr50_42089_c1_1131_2684 512
326 3300053085 Ga0495619_0003076 Ga0495619_0003076_3084_4670 512
327 3300025907 Ga0207645_10085752 Ga0207645_100857522 513
328 3300045976 Ga0466967_0052216 Ga0466967_0052216_288_1865 513
329 3300005981 Ga0081538_10006379 Ga0081538_100063799 514
330 3300005981 Ga0081538_10014226 Ga0081538_100142263 514
331 3300037853 Ga0436364_0540677 Ga0436364_0540677_6390_7982 514
332 3300046536 Ga0495587_0000703 Ga0495587_0000703_6876_8462 514
333 3300005354 Ga0070675_100139275 Ga0070675_1001392752 515
334 3300005981 Ga0081538_10001335 Ga0081538_1000133514 515
335 3300005983 Ga0081540_1041199 Ga0081540_10411992 515
336 3300006038 Ga0075365_10056493 Ga0075365_100564933 515
337 3300006051 Ga0075364_10067472 Ga0075364_100674723 515
338 3300025927 Ga0207687_10000020 Ga0207687_1000002015 515
339 3300025981 Ga0207640_10005255 Ga0207640_100052552 515
340 3300048903 Ga0496100_0001670 Ga0496100_0001670_8760_10379 515
341 3300048904 Ga0496101_0062170 Ga0496101_0062170_30_1649 515
342 3300048909 Ga0496106_0002707 Ga0496106_0002707_9110_10729 515
343 3300048910 Ga0496107_0000834 Ga0496107_0000834_7091_8710 515
344 3300050491 nmdc:mga00v17_25136_c1 nmdc:mga00v17_25136_c1_259_1869 515
345 3300050492 nmdc:mga0yw44_12468_c1 nmdc:mga0yw44_12468_c1_2025_3635 515
346 3300009147 Ga0114129_10224722 Ga0114129_102247222 516
347 3300025972 Ga0207668_10023866 Ga0207668_100238662 516
348 3300032126 Ga0307415_100000715 Ga0307415_1000007152 516
349 3300048907 Ga0496104_0001546 Ga0496104_0001546_14217_15803 516
350 3300048908 Ga0496105_0000098 Ga0496105_0000098_46793_48379 516
351 3300049575 Ga0501039_0032900 Ga0501039_0032900_2242_3810 516
352 3300049592 Ga0501076_0048290 Ga0501076_0048290_1214_2794 516
353 3300005981 Ga0081538_10011526 Ga0081538_100115266 517
354 3300005985 Ga0081539_10002813 Ga0081539_100028134 517
355 3300025929 Ga0207664_10016874 Ga0207664_100168743 517
356 3300046514 Ga0495618_0000512 Ga0495618_0000512_5971_7566 517
357 3300047320 Ga0495672_0016579 Ga0495672_0016579_2821_4413 517
358 3300005937 Ga0081455_10018195 Ga0081455_100181954 518
359 3300027907 Ga0207428_10008618 Ga0207428_100086185 518
360 3300050510 nmdc:mga06r32_77199_c1 nmdc:mga06r32_77199_c1_828_2402 518
361 3300005435 Ga0070714_100000347 Ga0070714_10000034714 519
362 3300009101 Ga0105247_10050502 Ga0105247_100505022 519
363 3300025929 Ga0207664_10000310 Ga0207664_1000031014 519
364 3300006844 Ga0075428_100165002 Ga0075428_1001650022 520
365 3300025913 Ga0207695_10033458 Ga0207695_100334583 520
366 3300001979 JGI24740J21852_10011271 JGI24740J21852_100112712 521
367 3300005341 Ga0070691_10000362 Ga0070691_100003625 521
368 3300005435 Ga0070714_100035558 Ga0070714_1000355584 521
369 3300005435 Ga0070714_100120675 Ga0070714_1001206752 521
370 3300005459 Ga0068867_100009607 Ga0068867_1000096072 521
371 3300005543 Ga0070672_100112583 Ga0070672_1001125832 521
372 3300006028 Ga0070717_10064191 Ga0070717_100641912 521
373 3300006028 Ga0070717_10133380 Ga0070717_101333801 521
374 3300006175 Ga0070712_100042879 Ga0070712_1000428793 521
375 3300006871 Ga0075434_100011809 Ga0075434_1000118095 521
376 3300006914 Ga0075436_100124446 Ga0075436_1001244462 521
377 3300007076 Ga0075435_100083936 Ga0075435_1000839361 521
378 3300009101 Ga0105247_10001338 Ga0105247_1000133814 521
379 3300009147 Ga0114129_10009190 Ga0114129_100091909 521
380 3300013297 Ga0157378_10240575 Ga0157378_102405752 521
381 3300013308 Ga0157375_10157686 Ga0157375_101576861 521
382 3300025900 Ga0207710_10000243 Ga0207710_1000024325 521
383 3300025915 Ga0207693_10000318 Ga0207693_1000031816 521
384 3300025919 Ga0207657_10071980 Ga0207657_100719802 521
385 3300025929 Ga0207664_10022178 Ga0207664_100221784 521
386 3300025929 Ga0207664_10141174 Ga0207664_101411742 521
387 3300025934 Ga0207686_10015589 Ga0207686_100155893 521
388 3300026089 Ga0207648_10010940 Ga0207648_100109404 521
389 3300036401 Ga0373937_0044413 Ga0373937_0044413_2403_3998 521
390 3300036401 Ga0373937_0118004 Ga0373937_0118004_79_1662 521
391 3300045836 Ga0466958_0026512 Ga0466958_0026512_396_1970 521
392 3300046454 Ga0495592_0108363 Ga0495592_0108363_328_1923 521
393 3300046460 Ga0495638_0007166 Ga0495638_0007166_4224_5810 521
394 3300046462 Ga0495651_0075386 Ga0495651_0075386_851_2446 521
395 3300046499 Ga0495594_0000011 Ga0495594_0000011_53122_54708 521
396 3300046809 Ga0495600_0018459 Ga0495600_0018459_286_1881 521
397 3300047317 Ga0495604_0043636 Ga0495604_0043636_1232_2827 521
398 3300047320 Ga0495672_0035031 Ga0495672_0035031_194_1762 521
399 3300047321 Ga0495676_0001626 Ga0495676_0001626_7207_8793 521
400 3300047322 Ga0495680_0015816 Ga0495680_0015816_2931_4526 521
401 3300048088 Ga0495602_0006880 Ga0495602_0006880_2806_4401 521
402 3300048907 Ga0496104_0000036 Ga0496104_0000036_90320_91939 521
403 3300048907 Ga0496104_0000077 Ga0496104_0000077_19602_21188 521
404 3300048908 Ga0496105_0000004 Ga0496105_0000004_79661_81247 521
405 3300048908 Ga0496105_0048437 Ga0496105_0048437_645_2240 521
406 3300048908 Ga0496105_0053384 Ga0496105_0053384_109_1695 521
407 3300048913 Ga0496110_0000496 Ga0496110_0000496_15005_16624 521
408 3300048914 Ga0496111_0000691 Ga0496111_0000691_1946_3565 521
409 3300048916 Ga0496113_0059168 Ga0496113_0059168_357_1952 521
410 3300048918 Ga0496115_0000010 Ga0496115_0000010_209529_211115 521
411 3300048922 Ga0496119_0067877 Ga0496119_0067877_153_1739 521
412 3300048923 Ga0496120_0044280 Ga0496120_0044280_968_2554 521
413 3300049571 Ga0501034_0019495 Ga0501034_0019495_4988_6574 521
414 3300049823 Ga0501044_0015577 Ga0501044_0015577_1387_2973 521
415 3300050507 nmdc:mga05p37_7012_c1 nmdc:mga05p37_7012_c1_9191_10789 521
416 3300050512 nmdc:mga0n895_2082_c1 nmdc:mga0n895_2082_c1_603_2201 521
417 3300053078 Ga0495612_0001134 Ga0495612_0001134_330_1913 521
418 3300053085 Ga0495619_0002992 Ga0495619_0002992_6391_7974 521
419 3300005367 Ga0070667_100001439 Ga0070667_10000143914 522
420 3300005844 Ga0068862_100012267 Ga0068862_1000122673 522
421 3300009553 Ga0105249_10005337 Ga0105249_100053375 522
422 3300021377 Ga0213874_10000219 Ga0213874_100002198 522
423 3300025961 Ga0207712_10007286 Ga0207712_100072862 522
424 3300025972 Ga0207668_10032607 Ga0207668_100326072 522
425 3300025986 Ga0207658_10029223 Ga0207658_100292233 522
426 3300028380 Ga0268265_10002363 Ga0268265_1000236311 522
427 3300037466 Ga0395898_0201342 Ga0395898_0201342_115_1761 522
428 3300039450 Ga0436363_1171799 Ga0436363_1171799_3507_5102 522
429 3300046543 Ga0495645_0001131 Ga0495645_0001131_4172_5761 522
430 3300048911 Ga0496108_0040293 Ga0496108_0040293_2006_3589 522
431 3300005356 Ga0070674_100000012 Ga0070674_100000012113 523
432 3300005439 Ga0070711_100006224 Ga0070711_1000062242 523
433 3300005455 Ga0070663_100003097 Ga0070663_1000030978 523
434 3300005530 Ga0070679_100003483 Ga0070679_1000034838 523
435 3300005547 Ga0070693_100010237 Ga0070693_1000102372 523
436 3300005564 Ga0070664_100071251 Ga0070664_1000712512 523
437 3300005618 Ga0068864_100000015 Ga0068864_100000015285 523
438 3300005718 Ga0068866_10000062 Ga0068866_100000624 523
439 3300005841 Ga0068863_100124192 Ga0068863_1001241922 523
440 3300005843 Ga0068860_100010512 Ga0068860_1000105125 523
441 3300005985 Ga0081539_10005004 Ga0081539_100050042 523
442 3300005985 Ga0081539_10021343 Ga0081539_100213433 523
443 3300013102 Ga0157371_10050984 Ga0157371_100509841 523
444 3300025899 Ga0207642_10000104 Ga0207642_100001044 523
445 3300025916 Ga0207663_10000748 Ga0207663_100007486 523
446 3300025921 Ga0207652_10000720 Ga0207652_100007202 523
447 3300025933 Ga0207706_10000017 Ga0207706_10000017155 523
448 3300025937 Ga0207669_10000017 Ga0207669_1000001798 523
449 3300026067 Ga0207678_10000709 Ga0207678_100007097 523
450 3300026067 Ga0207678_10079112 Ga0207678_100791122 523
451 3300026088 Ga0207641_10017650 Ga0207641_100176503 523
452 3300026095 Ga0207676_10000018 Ga0207676_1000001815 523
453 3300026121 Ga0207683_10017747 Ga0207683_100177474 523
454 3300028381 Ga0268264_10012409 Ga0268264_100124093 523
455 3300028556 Ga0265337_1000805 Ga0265337_10008055 523
456 3300028558 Ga0265326_10000084 Ga0265326_1000008417 523
457 3300028654 Ga0265322_10000198 Ga0265322_1000019817 523
458 3300029957 Ga0265324_10001108 Ga0265324_1000110815 523
459 3300031239 Ga0265328_10002655 Ga0265328_100026552 523
460 3300031240 Ga0265320_10000035 Ga0265320_10000035104 523
461 3300031242 Ga0265329_10006215 Ga0265329_100062151 523
462 3300031250 Ga0265331_10011116 Ga0265331_100111162 523
463 3300031251 Ga0265327_10000015 Ga0265327_10000015394 523
464 3300031711 Ga0265314_10000690 Ga0265314_1000069021 523
465 3300039437 Ga0436365_0146714 Ga0436365_0146714_2410_4002 523
466 3300044694 Ga0466963_0000022 Ga0466963_0000022_18508_20094 523
467 3300044765 Ga0466970_0047840 Ga0466970_0047840_39_1694 523
468 3300046455 Ga0495603_0000471 Ga0495603_0000471_6936_8522 523
469 3300046455 Ga0495603_0000594 Ga0495603_0000594_3317_4903 523
470 3300046516 Ga0495628_0007112 Ga0495628_0007112_7995_9581 523
471 3300046529 Ga0495652_0000023 Ga0495652_0000023_146154_147740 523
472 3300046529 Ga0495652_0031335 Ga0495652_0031335_2685_4271 523
473 3300046559 Ga0495667_0000034 Ga0495667_0000034_119752_121338 523
474 3300046616 Ga0495668_0049644 Ga0495668_0049644_322_1908 523
475 3300046660 Ga0495625_0000506 Ga0495625_0000506_35718_37313 523
476 3300046663 Ga0495635_0037574 Ga0495635_0037574_1638_3224 523
477 3300047317 Ga0495604_0000852 Ga0495604_0000852_14673_16316 523
478 3300047319 Ga0495674_0000059 Ga0495674_0000059_7367_8953 523
479 3300047322 Ga0495680_0001649 Ga0495680_0001649_5588_7174 523
480 3300047444 Ga0495675_0034972 Ga0495675_0034972_973_2559 523
481 3300048904 Ga0496101_0042499 Ga0496101_0042499_385_2019 523
482 3300048912 Ga0496109_0263170 Ga0496109_0263170_16_1605 523
483 3300048913 Ga0496110_0002236 Ga0496110_0002236_11664_13253 523
484 3300048914 Ga0496111_0006612 Ga0496111_0006612_4335_5924 523
485 3300048918 Ga0496115_0001569 Ga0496115_0001569_4662_6248 523
486 3300048923 Ga0496120_0002545 Ga0496120_0002545_4683_6293 523
487 3300048929 Ga0496126_0042089 Ga0496126_0042089_488_2092 523
488 3300050515 nmdc:mga0a205_7640_c1 nmdc:mga0a205_7640_c1_2687_4276 523
489 3300053077 Ga0495601_0010167 Ga0495601_0010167_203_1789 523
490 3300053085 Ga0495619_0000602 Ga0495619_0000602_8097_9683 523
491 3300053085 Ga0495619_0000929 Ga0495619_0000929_13650_15236 523
492 3300005329 Ga0070683_100039766 Ga0070683_1000397663 524
493 3300005329 Ga0070683_100074051 Ga0070683_1000740513 524
494 3300005337 Ga0070682_100000171 Ga0070682_1000001714 524
495 3300005338 Ga0068868_100001000 Ga0068868_1000010002 524
496 3300005354 Ga0070675_100000377 Ga0070675_10000037713 524
497 3300005365 Ga0070688_100000285 Ga0070688_10000028521 524
498 3300005365 Ga0070688_100000428 Ga0070688_10000042816 524
499 3300005436 Ga0070713_100000380 Ga0070713_10000038014 524
500 3300005466 Ga0070685_10000159 Ga0070685_100001594 524
501 3300005466 Ga0070685_10000174 Ga0070685_1000017423 524
502 3300005539 Ga0068853_100134353 Ga0068853_1001343531 524
503 3300005543 Ga0070672_100000006 Ga0070672_100000006107 524
504 3300005548 Ga0070665_100007718 Ga0070665_1000077187 524
505 3300005548 Ga0070665_100202457 Ga0070665_1002024571 524
506 3300005578 Ga0068854_100012127 Ga0068854_1000121273 524
507 3300005616 Ga0068852_100006635 Ga0068852_1000066353 524
508 3300005834 Ga0068851_10000945 Ga0068851_1000094510 524
509 3300005981 Ga0081538_10006612 Ga0081538_100066124 524
510 3300005981 Ga0081538_10022785 Ga0081538_100227854 524
511 3300006038 Ga0075365_10026124 Ga0075365_100261242 524
512 3300006881 Ga0068865_100001059 Ga0068865_10000105913 524
513 3300009098 Ga0105245_10000116 Ga0105245_1000011660 524
514 3300009177 Ga0105248_10001622 Ga0105248_100016228 524
515 3300013102 Ga0157371_10019361 Ga0157371_100193614 524
516 3300013105 Ga0157369_10000078 Ga0157369_10000078123 524
517 3300013297 Ga0157378_10035063 Ga0157378_100350634 524
518 3300013307 Ga0157372_10002749 Ga0157372_1000274917 524
519 3300014326 Ga0157380_10000445 Ga0157380_1000044517 524
520 3300021384 Ga0213876_10005296 Ga0213876_100052966 524
521 3300021384 Ga0213876_10028470 Ga0213876_100284702 524
522 3300025321 Ga0207656_10000514 Ga0207656_100005145 524
523 3300025901 Ga0207688_10032160 Ga0207688_100321602 524
524 3300025903 Ga0207680_10002670 Ga0207680_100026704 524
525 3300025907 Ga0207645_10007972 Ga0207645_100079723 524
526 3300025920 Ga0207649_10000028 Ga0207649_10000028143 524
527 3300025926 Ga0207659_10000246 Ga0207659_1000024617 524
528 3300025927 Ga0207687_10000031 Ga0207687_10000031139 524
529 3300025927 Ga0207687_10002310 Ga0207687_100023102 524
530 3300025928 Ga0207700_10000033 Ga0207700_1000003316 524
531 3300025932 Ga0207690_10005055 Ga0207690_100050556 524
532 3300025936 Ga0207670_10044064 Ga0207670_100440643 524
533 3300025938 Ga0207704_10000103 Ga0207704_1000010315 524
534 3300025940 Ga0207691_10000025 Ga0207691_1000002517 524
535 3300025940 Ga0207691_10012417 Ga0207691_100124172 524
536 3300025941 Ga0207711_10000006 Ga0207711_10000006391 524
537 3300025944 Ga0207661_10000739 Ga0207661_100007394 524
538 3300025944 Ga0207661_10014625 Ga0207661_100146252 524
539 3300025972 Ga0207668_10023775 Ga0207668_100237752 524
540 3300025981 Ga0207640_10000686 Ga0207640_100006863 524
541 3300026023 Ga0207677_10009956 Ga0207677_100099564 524
542 3300026078 Ga0207702_10000242 Ga0207702_1000024243 524
543 3300026142 Ga0207698_10000414 Ga0207698_1000041417 524
544 3300028379 Ga0268266_10001578 Ga0268266_1000157817 524
545 3300028379 Ga0268266_10201604 Ga0268266_102016041 524
546 3300031727 Ga0316576_10110683 Ga0316576_101106831 524
547 3300035398 Ga0316574_0036213 Ga0316574_0036213_391_1983 524
548 3300036712 Ga0316584_0006436 Ga0316584_0006436_4796_6388 524
549 3300037471 Ga0395905_0082991 Ga0395905_0082991_1061_2707 524
550 3300039437 Ga0436365_0470617 Ga0436365_0470617_382_1983 524
551 3300039437 Ga0436365_1135905 Ga0436365_1135905_64_1656 524
552 3300039437 Ga0436365_1292596 Ga0436365_1292596_6873_8465 524
553 3300039453 Ga0436362_0908846 Ga0436362_0908846_449_2050 524
554 3300044842 Ga0466957_0036255 Ga0466957_0036255_661_2256 524
555 3300045976 Ga0466967_0000017 Ga0466967_0000017_779_2374 524
556 3300045976 Ga0466967_0034557 Ga0466967_0034557_2156_3778 524
557 3300046459 Ga0495629_0000999 Ga0495629_0000999_4783_6381 524
558 3300046507 Ga0495606_0000108 Ga0495606_0000108_137655_139253 524
559 3300046517 Ga0495630_0000012 Ga0495630_0000012_221079_222680 524
560 3300046674 Ga0495588_0000393 Ga0495588_0000393_18066_19664 524
561 3300046681 Ga0495647_0014058 Ga0495647_0014058_40_1641 524
562 3300046683 Ga0495658_0054079 Ga0495658_0054079_65_1669 524
563 3300046689 Ga0495613_0000860 Ga0495613_0000860_5550_7145 524
564 3300046690 Ga0495624_0020815 Ga0495624_0020815_1536_3140 524
565 3300046809 Ga0495600_0003292 Ga0495600_0003292_6299_7894 524
566 3300047317 Ga0495604_0000122 Ga0495604_0000122_18880_20475 524
567 3300047317 Ga0495604_0007409 Ga0495604_0007409_3293_4888 524
568 3300047321 Ga0495676_0045174 Ga0495676_0045174_428_2023 524
569 3300047472 Ga0495686_0028251 Ga0495686_0028251_1653_3248 524
570 3300048088 Ga0495602_0000166 Ga0495602_0000166_17267_18862 524
571 3300048905 Ga0496102_0017198 Ga0496102_0017198_2302_3897 524
572 3300048906 Ga0496103_0016357 Ga0496103_0016357_31_1626 524
573 3300048907 Ga0496104_0013755 Ga0496104_0013755_2436_4031 524
574 3300048907 Ga0496104_0039362 Ga0496104_0039362_373_1968 524
575 3300048909 Ga0496106_0001777 Ga0496106_0001777_8688_10283 524
576 3300048910 Ga0496107_0005273 Ga0496107_0005273_4187_5782 524
577 3300048911 Ga0496108_0000355 Ga0496108_0000355_16457_18055 524
578 3300048912 Ga0496109_0000903 Ga0496109_0000903_16337_17935 524
579 3300048912 Ga0496109_0017755 Ga0496109_0017755_2737_4332 524
580 3300048913 Ga0496110_0000011 Ga0496110_0000011_16159_17757 524
581 3300048913 Ga0496110_0032285 Ga0496110_0032285_2208_3806 524
582 3300048914 Ga0496111_0006159 Ga0496111_0006159_6111_7709 524
583 3300048914 Ga0496111_0075898 Ga0496111_0075898_783_2381 524
584 3300048915 Ga0496112_0000980 Ga0496112_0000980_2977_4575 524
585 3300048916 Ga0496113_0000283 Ga0496113_0000283_6145_7743 524
586 3300048917 Ga0496114_0001473 Ga0496114_0001473_6981_8576 524
587 3300053077 Ga0495601_0000034 Ga0495601_0000034_65282_66877 524
588 3300053078 Ga0495612_0005209 Ga0495612_0005209_2627_4231 524
589 3300053084 Ga0495595_0017313 Ga0495595_0017313_337_1932 524
590 3300053085 Ga0495619_0000277 Ga0495619_0000277_18069_19667 524
591 3300005347 Ga0070668_100004996 Ga0070668_1000049967 525
592 3300005366 Ga0070659_100000132 Ga0070659_10000013214 525
593 3300005435 Ga0070714_100005669 Ga0070714_1000056693 525
594 3300005440 Ga0070705_100002087 Ga0070705_1000020874 525
595 3300005441 Ga0070700_100016626 Ga0070700_1000166262 525
596 3300005457 Ga0070662_100002985 Ga0070662_1000029854 525
597 3300005719 Ga0068861_100042924 Ga0068861_1000429242 525
598 3300005981 Ga0081538_10000487 Ga0081538_1000048719 525
599 3300006028 Ga0070717_10000059 Ga0070717_1000005970 525
600 3300006038 Ga0075365_10104365 Ga0075365_101043652 525
601 3300006058 Ga0075432_10025769 Ga0075432_100257692 525
602 3300006175 Ga0070712_100000050 Ga0070712_10000005018 525
603 3300006846 Ga0075430_100076592 Ga0075430_1000765922 525
604 3300006847 Ga0075431_100051053 Ga0075431_1000510533 525
605 3300009094 Ga0111539_10023958 Ga0111539_100239584 525
606 3300009094 Ga0111539_10024383 Ga0111539_100243835 525
607 3300009098 Ga0105245_10005224 Ga0105245_100052243 525
608 3300009147 Ga0114129_10006622 Ga0114129_1000662215 525
609 3300009553 Ga0105249_10008684 Ga0105249_100086843 525
610 3300010375 Ga0105239_10034780 Ga0105239_100347803 525
611 3300011119 Ga0105246_10030530 Ga0105246_100305303 525
612 3300013306 Ga0163162_10047250 Ga0163162_100472503 525
613 3300021388 Ga0213875_10011697 Ga0213875_100116972 525
614 3300025915 Ga0207693_10000151 Ga0207693_1000015117 525
615 3300025932 Ga0207690_10001305 Ga0207690_1000130514 525
616 3300025933 Ga0207706_10003131 Ga0207706_100031319 525
617 3300025961 Ga0207712_10006422 Ga0207712_100064222 525
618 3300026075 Ga0207708_10011794 Ga0207708_100117942 525
619 3300026118 Ga0207675_100014345 Ga0207675_1000143454 525
620 3300027907 Ga0207428_10099818 Ga0207428_100998182 525
621 3300031995 Ga0307409_100071834 Ga0307409_1000718342 525
622 3300032002 Ga0307416_100068284 Ga0307416_1000682841 525
623 3300032005 Ga0307411_10011261 Ga0307411_100112612 525
624 3300032126 Ga0307415_100023571 Ga0307415_1000235712 525
625 3300037853 Ga0436364_0632307 Ga0436364_0632307_2320_3942 525
626 3300049591 Ga0501075_0078870 Ga0501075_0078870_281_1861 525
627 3300050507 nmdc:mga05p37_124721_c1 nmdc:mga05p37_124721_c1_1234_2814 525
628 3300050510 nmdc:mga06r32_92494_c1 nmdc:mga06r32_92494_c1_528_2108 525
629 3300050511 nmdc:mga08y16_119057_c1 nmdc:mga08y16_119057_c1_455_2035 525
630 3300050511 nmdc:mga08y16_38950_c1 nmdc:mga08y16_38950_c1_673_2253 525
631 3300031731 Ga0307405_10009632 Ga0307405_100096325 526
632 3300031824 Ga0307413_10066393 Ga0307413_100663932 526
633 3300031852 Ga0307410_10005592 Ga0307410_100055926 526
634 3300031995 Ga0307409_100000976 Ga0307409_1000009765 526
635 3300032004 Ga0307414_10033503 Ga0307414_100335033 526
636 3300032126 Ga0307415_100002611 Ga0307415_1000026114 526
637 3300000549 LJQas_1001017 LJQas_10010172 529
638 3300005366 Ga0070659_100006257 Ga0070659_1000062576 529
639 3300005458 Ga0070681_10083993 Ga0070681_100839932 529
640 3300005530 Ga0070679_100025361 Ga0070679_1000253615 529
641 3300005535 Ga0070684_100118508 Ga0070684_1001185082 529
642 3300005614 Ga0068856_100161960 Ga0068856_1001619601 529
643 3300005616 Ga0068852_100010424 Ga0068852_1000104245 529
644 3300006844 Ga0075428_100021480 Ga0075428_1000214805 529
645 3300006847 Ga0075431_100018329 Ga0075431_1000183294 529
646 3300009147 Ga0114129_10002371 Ga0114129_100023718 529
647 3300009551 Ga0105238_10004264 Ga0105238_1000426410 529
648 3300013105 Ga0157369_10022884 Ga0157369_100228842 529
649 3300013307 Ga0157372_10015644 Ga0157372_100156445 529
650 3300025912 Ga0207707_10007051 Ga0207707_100070512 529
651 3300025921 Ga0207652_10018072 Ga0207652_100180722 529
652 3300025932 Ga0207690_10007554 Ga0207690_100075542 529
653 3300025944 Ga0207661_10045777 Ga0207661_100457772 529
654 3300026142 Ga0207698_10015354 Ga0207698_100153543 529
655 3300045976 Ga0466967_0072530 Ga0466967_0072530_182_1780 529
656 3300050507 nmdc:mga05p37_19950_c1 nmdc:mga05p37_19950_c1_5699_7348 529
657 3300050509 nmdc:mga0qj67_411_c1 nmdc:mga0qj67_411_c1_822_2465 529
658 3300050510 nmdc:mga06r32_2376_c1 nmdc:mga06r32_2376_c1_6972_8615 529

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

27

299

0.99

PF08502

LeuA_dimer

LeuA allosteric (dimerisation) domain

396

527

0.97

PF22617

HCS_D2

Homocitrate synthase post-HMGL domain-like

313

395

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ewb-assembly1.cif.gz_X-2 crystal structure of n-terminal domain of putative 2-isopropylmalate synthase from listeria monocytogenes 0.9752 11 283
3rmj-assembly1.cif.gz_A crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis 0.9646 11 328
3rmj-assembly1.cif.gz_B crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis 0.9627 11 328
3eeg-assembly1.cif.gz_A crystal structure of a 2-isopropylmalate synthase from cytophaga hutchinsonii 0.9617 11 287
3ewb-assembly1.cif.gz_X-2 crystal structure of n-terminal domain of putative 2-isopropylmalate synthase from listeria monocytogenes 0.9611 11 283
ID Description Score Start End Superfamily
3ewbX00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.975 11 283 3.20.20.70
af_I1NJA3_77_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9731 9 287 3.20.20.70
3rmjB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9627 11 328 3.20.20.70
af_P09151_393_501_3.30.160.270 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain 0.9616 400 506 3.30.160.270
3ewbX00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9607 11 283 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2S8K502-F1-model_v4 deleted 0.988 34 155
AF-T1CKX2-F1-model_v4 Pyruvate carboxyltransferase domain protein (EC 6.4.1.1) 0.9865 53 169 GO:0003852
GO:0004736
GO:0009098
AF-X1I4H9-F1-model_v4 2-isopropylmalate synthase (EC 2.3.3.13) 0.981 67 265 GO:0003852
GO:0009098
AF-A0A357AGP8-F1-model_v4 2-isopropylmalate synthase (EC 2.3.3.13) 0.9793 53 221 GO:0003852
GO:0009098
AF-A0A6P0AYC6-F1-model_v4 deleted 0.9788 79 217

Feature Viewer

pLDDT pTM Quality
83.33 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map