F472989

General Info

Members Datasets Scaffolds Average Seq Length
656 247 649 247

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100000075|Ga0070680_10000007532
Length 282
Sequence MQANMSSATDALSEKPATLAGRDESSGQMTGYTVIPSTGTVLSSLLRADLTTQWRNRKSFMLILIVPVIILISWKGLIDKLGSAFVLGNCITIGLIAIGLMGYSNSVARDRDKGIFQRLRVAPLSAWSIMMSRLAVQLLMIVLMTTAVYIAGFYFDKIALSPGSYVMGYVAALVGGAVYLGLGQMIVGLIKNAETVHSTSRLVYFIFIMVGMFGELGILGQQIGTLVQWSPYGTVKHILASSAHPGTWNISATKALLVTIGYAFVFAVLGIKWFKWSGGEKG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
5 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.15
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.1
Nodule 0
Rhizoplane 1.07
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 5.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2063463 2162886011 Bacteria 1413
2 JGI24740J21852_10002328 3300001979 Bacteria 8646
3 JGI24743J22301_10009620 3300001991 Bacteria 1715
4 JGI24744J21845_10019369 3300002077 Bacteria 1346
5 JGI25162J39368_1000688 3300002737 Bacteria 23552
6 JGI25154J39366_1000044 3300002738 Bacteria 136516
7 JGI25164J39214_1001043 3300002772 Bacteria 8334
8 JGI25165J46597_1003733 3300003214 Bacteria 3608
9 JGI25153J46596_10003613 3300003215 Bacteria 8583
10 rootH1_10104481 3300003316 Unclassified 1193
11 rootH2_10001414 3300003320 Bacteria 59840
12 rootH2_10002197 3300003320 Bacteria 14946
13 rootH2_10013265 3300003320 Bacteria 8575
14 rootH2_10187887 3300003320 Bacteria 1369
15 rootH2_10191691 3300003320 Bacteria 4517
16 rootH2_10230854 3300003320 Bacteria 2299
17 rootL2_10196379 3300003322 Bacteria 1234
18 rootL2_10222192 3300003322 Bacteria 3578
19 rootL2_10300232 3300003322 Unclassified 2875
20 rootH1_10001276 3300003316 Bacteria 3262
21 rootH1_10001276 3300003323 Bacteria 38627
22 rootH1_10018525 3300003323 Bacteria 11066
23 rootH1_10052168 3300003323 Bacteria 4762
24 rootH1_10097619 3300003323 Bacteria 3557
25 rootH1_10112358 3300003323 Bacteria 11821
26 rootH1_10154623 3300003323 Bacteria 1880
27 rootH1_10338497 3300003323 Bacteria 1470
28 rootH1_10365013 3300003323 Bacteria 1092
29 JGI25160J50197_1002488 3300003354 Bacteria 8560
30 JGI25160J50197_1004606 3300003354 Bacteria 5933
31 JGI25160J50197_1005692 3300003354 Bacteria 5149
32 Ga0055526_1010370 3300003771 Bacteria 4346
33 Ga0055526_1032649 3300003771 Bacteria 1464
34 Ga0055528_1000572 3300003790 Bacteria 27859
35 Ga0055530_10000789 3300003791 Bacteria 26378
36 Ga0058863_11690196 3300004799 Bacteria 1184
37 Ga0065165_1000017 3300005262 Bacteria 278286
38 Ga0065165_1019675 3300005262 Bacteria 2400
39 Ga0065712_10323773 3300005290 Unclassified 824
40 Ga0065715_10154051 3300005293 Unclassified 1684
41 Ga0070658_10030999 3300005327 Bacteria 4294
42 Ga0070658_10077787 3300005327 Bacteria 2722
43 Ga0070676_10029614 3300005328 Bacteria 3115
44 Ga0070683_100011222 3300005329 Bacteria 7730
45 Ga0070683_100026642 3300005329 Bacteria 5208
46 Ga0070683_100093238 3300005329 Bacteria 2829
47 Ga0070690_100040887 3300005330 Bacteria 2934
48 Ga0070690_100079612 3300005330 Unclassified 2142
49 Ga0070670_100073904 3300005331 Bacteria 2928
50 Ga0070670_100261710 3300005331 Bacteria 1508
51 Ga0068869_100004728 3300005334 Bacteria 8495
52 Ga0070666_10000101 3300005335 Bacteria 58900
53 Ga0070666_10015846 3300005335 Bacteria 4815
54 Ga0070666_10043983 3300005335 Bacteria 2991
55 Ga0070666_10053096 3300005335 Bacteria 2733
56 Ga0070666_10117578 3300005335 Bacteria 1841
57 Ga0070680_100000075 3300005336 Bacteria 53328
58 Ga0070680_100049001 3300005336 Unclassified 3443
59 Ga0070682_100000008 3300005337 Bacteria 322125
60 Ga0070682_100000628 3300005337 Bacteria 21473
61 Ga0070682_100025853 3300005337 Bacteria 3508
62 Ga0070682_100083516 3300005337 Unclassified 2073
63 Ga0068868_100000543 3300005338 Bacteria 25349
64 Ga0068868_100002455 3300005338 Bacteria 12866
65 Ga0068868_100041244 3300005338 Bacteria 3596
66 Ga0068868_100051895 3300005338 Bacteria 3228
67 Ga0068868_100053733 3300005338 Bacteria 3173
68 Ga0068868_100139933 3300005338 Bacteria 1986
69 Ga0068868_100180587 3300005338 Unclassified 1751
70 Ga0068868_100232424 3300005338 Bacteria 1547
71 Ga0068868_100373728 3300005338 Unclassified 1225
72 Ga0068868_100426069 3300005338 Bacteria 1150
73 Ga0068868_100673307 3300005338 Bacteria 923
74 Ga0070660_100007461 3300005339 Bacteria 7622
75 Ga0070689_100009325 3300005340 Bacteria 6957
76 Ga0070689_100022142 3300005340 Bacteria 4743
77 Ga0070689_100558088 3300005340 Bacteria 987
78 Ga0070691_10000522 3300005341 Bacteria 14488
79 Ga0070691_10002772 3300005341 Bacteria 7816
80 Ga0070661_100011271 3300005344 Bacteria 6228
81 Ga0070661_100019628 3300005344 Bacteria 4816
82 Ga0070661_100334427 3300005344 Bacteria 1185
83 Ga0070668_100139122 3300005347 Bacteria 1955
84 Ga0070668_100179030 3300005347 Bacteria 1731
85 Ga0070669_100027806 3300005353 Unclassified 4071
86 Ga0070675_100047970 3300005354 Bacteria 3501
87 Ga0070675_100077145 3300005354 Bacteria 2773
88 Ga0070671_100005460 3300005355 Bacteria 10149
89 Ga0070671_100030079 3300005355 Bacteria 4481
90 Ga0070671_100049820 3300005355 Bacteria 3485
91 Ga0070671_100090307 3300005355 Bacteria 2564
92 Ga0070671_100144949 3300005355 Unclassified 2004
93 Ga0070671_100190123 3300005355 Unclassified 1740
94 Ga0070671_100601032 3300005355 Bacteria 951
95 Ga0070673_100030800 3300005364 Bacteria 4021
96 Ga0070673_100043944 3300005364 Bacteria 3457
97 Ga0070673_100089533 3300005364 Unclassified 2512
98 Ga0070673_100505524 3300005364 Bacteria 1093
99 Ga0070688_100005011 3300005365 Bacteria 6938
100 Ga0070688_100010942 3300005365 Bacteria 5025
101 Ga0070688_100078898 3300005365 Bacteria 2125
102 Ga0070659_100026039 3300005366 Bacteria 4499
103 Ga0070659_100151898 3300005366 Bacteria 1889
104 Ga0070667_100021007 3300005367 Bacteria 5424
105 Ga0070667_100060561 3300005367 Bacteria 3203
106 Ga0070667_100108083 3300005367 Bacteria 2409
107 Ga0070667_100245685 3300005367 Bacteria 1599
108 Ga0070663_100223193 3300005455 Bacteria 1480
109 Ga0070678_100098259 3300005456 Bacteria 2263
110 Ga0070662_100038027 3300005457 Bacteria 3416
111 Ga0070662_100073798 3300005457 Bacteria 2522
112 Ga0070662_100079156 3300005457 Bacteria 2443
113 Ga0070662_100097015 3300005457 Bacteria 2224
114 Ga0070662_100146349 3300005457 Unclassified 1835
115 Ga0070681_10458403 3300005458 Bacteria 1187
116 Ga0068867_100015760 3300005459 Bacteria 5364
117 Ga0068867_100079740 3300005459 Unclassified 2464
118 Ga0068867_100476132 3300005459 Bacteria 1069
119 Ga0068867_100629143 3300005459 Bacteria 939
120 Ga0070685_10205011 3300005466 Bacteria 1284
121 Ga0070679_100000892 3300005530 Bacteria 25923
122 Ga0070679_100051407 3300005530 Bacteria 4105
123 Ga0070679_100117894 3300005530 Bacteria 2639
124 Ga0070679_100128370 3300005530 Bacteria 2517
125 Ga0070679_100189896 3300005530 Bacteria 2024
126 Ga0070679_100586346 3300005530 Bacteria 1058
127 Ga0070684_100022795 3300005535 Bacteria 5228
128 Ga0070684_100028964 3300005535 Bacteria 4689
129 Ga0070684_100070959 3300005535 Bacteria 3066
130 Ga0070684_100253583 3300005535 Bacteria 1608
131 Ga0070684_100402297 3300005535 Bacteria 1262
132 Ga0068853_100001368 3300005539 Bacteria 17591
133 Ga0068853_100004852 3300005539 Bacteria 10451
134 Ga0068853_100045996 3300005539 Unclassified 3741
135 Ga0068853_100087849 3300005539 Bacteria 2728
136 Ga0068853_100517052 3300005539 Unclassified 1128
137 Ga0068853_100555712 3300005539 Unclassified 1088
138 Ga0070672_100124457 3300005543 Bacteria 2113
139 Ga0070672_100600668 3300005543 Bacteria 958
140 Ga0070686_100290334 3300005544 Bacteria 1209
141 Ga0070693_100047893 3300005547 Bacteria 2433
142 Ga0070665_100000052 3300005548 Bacteria 245694
143 Ga0068855_100000041 3300005563 Bacteria 151653
144 Ga0068855_100077427 3300005563 Bacteria 3859
145 Ga0068855_100111620 3300005563 Bacteria 3138
146 Ga0068855_100140750 3300005563 Unclassified 2751
147 Ga0068855_100244936 3300005563 Bacteria 2001
148 Ga0068855_100306734 3300005563 Unclassified 1757
149 Ga0070664_100010888 3300005564 Bacteria 7376
150 Ga0070664_100011721 3300005564 Bacteria 7116
151 Ga0070664_100047316 3300005564 Bacteria 3633
152 Ga0070664_100100310 3300005564 Unclassified 2517
153 Ga0070664_100380831 3300005564 Bacteria 1288
154 Ga0068857_100429115 3300005577 Bacteria 1233
155 Ga0068857_100505751 3300005577 Bacteria 1134
156 Ga0068854_100019070 3300005578 Bacteria 4616
157 Ga0068854_100077604 3300005578 Unclassified 2445
158 Ga0068854_100077861 3300005578 Bacteria 2441
159 Ga0068856_100000204 3300005614 Bacteria 63335
160 Ga0068856_100014177 3300005614 Bacteria 7705
161 Ga0068856_100021104 3300005614 Bacteria 6330
162 Ga0068856_100044321 3300005614 Bacteria 4377
163 Ga0068856_100055918 3300005614 Bacteria 3894
164 Ga0070702_100081623 3300005615 Unclassified 1938
165 Ga0068852_100005196 3300005616 Bacteria 9282
166 Ga0068852_100048454 3300005616 Bacteria 3630
167 Ga0068852_100071912 3300005616 Bacteria 3038
168 Ga0068852_100149714 3300005616 Bacteria 2169
169 Ga0068852_100250059 3300005616 Unclassified 1698
170 Ga0068852_100251949 3300005616 Unclassified 1692
171 Ga0068859_100000007 3300005617 Bacteria 390070
172 Ga0068859_100007965 3300005617 Bacteria 10750
173 Ga0068859_100010183 3300005617 Bacteria 9465
174 Ga0068864_100006739 3300005618 Bacteria 9407
175 Ga0068864_100019953 3300005618 Bacteria 5604
176 Ga0068864_100051718 3300005618 Bacteria 3539
177 Ga0068864_100501788 3300005618 Unclassified 1167
178 Ga0068866_10499861 3300005718 Bacteria 804
179 Ga0068861_100046054 3300005719 Bacteria 3287
180 Ga0068861_100276430 3300005719 Unclassified 1444
181 Ga0068861_100276520 3300005719 Bacteria 1444
182 Ga0068851_10059600 3300005834 Unclassified 1953
183 Ga0068863_100013437 3300005841 Bacteria 7895
184 Ga0068863_100065602 3300005841 Bacteria 3435
185 Ga0068863_100091159 3300005841 Bacteria 2890
186 Ga0068863_100243676 3300005841 Bacteria 1735
187 Ga0068863_100281736 3300005841 Bacteria 1610
188 Ga0068863_101086932 3300005841 Bacteria 804
189 Ga0068858_100004375 3300005842 Bacteria 13862
190 Ga0068858_100028234 3300005842 Bacteria 5213
191 Ga0068858_100321674 3300005842 Unclassified 1478
192 Ga0068858_100567197 3300005842 Bacteria 1099
193 Ga0068860_100000004 3300005843 Bacteria 506126
194 Ga0068860_100001504 3300005843 Bacteria 25146
195 Ga0068860_100006976 3300005843 Bacteria 11319
196 Ga0068860_100009791 3300005843 Bacteria 9513
197 Ga0068860_100021982 3300005843 Bacteria 6174
198 Ga0068860_100053680 3300005843 Bacteria 3831
199 Ga0068860_100072581 3300005843 Bacteria 3271
200 Ga0068860_100125138 3300005843 Bacteria 2464
201 Ga0068862_100165726 3300005844 Bacteria 1975
202 Ga0068862_100179448 3300005844 Unclassified 1899
203 Ga0081540_1008682 3300005983 Bacteria 7076
204 Ga0070715_10326361 3300006163 Unclassified 830
205 Ga0097621_100000606 3300006237 Bacteria 25267
206 Ga0097621_100006155 3300006237 Bacteria 8501
207 Ga0097621_100061528 3300006237 Bacteria 3079
208 Ga0097621_100143073 3300006237 Bacteria 2045
209 Ga0097621_100284257 3300006237 Bacteria 1457
210 Ga0068871_100000334 3300006358 Bacteria 32598
211 Ga0068871_100013793 3300006358 Bacteria 6007
212 Ga0068871_100032752 3300006358 Unclassified 4109
213 Ga0068871_100037552 3300006358 Bacteria 3864
214 Ga0068871_100042670 3300006358 Bacteria 3643
215 Ga0068871_100075370 3300006358 Unclassified 2785
216 Ga0068871_100109512 3300006358 Bacteria 2322
217 Ga0068871_100179060 3300006358 Bacteria 1821
218 Ga0068871_100201182 3300006358 Bacteria 1720
219 Ga0068871_100330850 3300006358 Unclassified 1343
220 Ga0075434_100715952 3300006871 Bacteria 1018
221 Ga0068865_100045392 3300006881 Bacteria 3012
222 Ga0068865_100363701 3300006881 Unclassified 1176
223 Ga0097620_100000007 3300006931 Bacteria 390070
224 Ga0097620_100007965 3300006931 Bacteria 10750
225 Ga0097620_100010184 3300006931 Bacteria 9465
226 Ga0105240_10000010 3300009093 Bacteria 537830
227 Ga0105240_10000061 3300009093 Bacteria 218897
228 Ga0105240_10001967 3300009093 Bacteria 33956
229 Ga0105240_10002002 3300009093 Bacteria 33613
230 Ga0105240_10012550 3300009093 Bacteria 11689
231 Ga0105240_10051059 3300009093 Bacteria 5207
232 Ga0105240_10064030 3300009093 Bacteria 4570
233 Ga0105240_10167551 3300009093 Bacteria 2604
234 Ga0105240_10384828 3300009093 Bacteria 1583
235 Ga0105240_10411375 3300009093 Bacteria 1521
236 Ga0105240_10441528 3300009093 Bacteria 1458
237 Ga0105240_10452127 3300009093 Bacteria 1437
238 Ga0105247_10033116 3300009101 Bacteria 3142
239 Ga0105247_10213782 3300009101 Unclassified 1302
240 Ga0105241_10000206 3300009174 Bacteria 44346
241 Ga0105241_10000622 3300009174 Bacteria 26623
242 Ga0105241_10003350 3300009174 Bacteria 11931
243 Ga0105241_10012190 3300009174 Bacteria 6309
244 Ga0105241_10023243 3300009174 Bacteria 4596
245 Ga0105241_10033338 3300009174 Bacteria 3866
246 Ga0105241_10275042 3300009174 Bacteria 1436
247 Ga0105241_10825965 3300009174 Bacteria 855
248 Ga0105242_10007074 3300009176 Bacteria 8667
249 Ga0105242_10014851 3300009176 Bacteria 6033
250 Ga0105242_10046006 3300009176 Unclassified 3539
251 Ga0105242_10520817 3300009176 Bacteria 1134
252 Ga0105242_10866673 3300009176 Bacteria 900
253 Ga0105242_10881055 3300009176 Bacteria 893
254 Ga0105248_10064000 3300009177 Bacteria 4129
255 Ga0105248_10860398 3300009177 Bacteria 1023
256 Ga0105248_11167562 3300009177 Bacteria 870
257 Ga0105237_10000227 3300009545 Bacteria 79785
258 Ga0105237_10001595 3300009545 Bacteria 29470
259 Ga0105237_10002803 3300009545 Bacteria 21168
260 Ga0105237_10006073 3300009545 Bacteria 13509
261 Ga0105237_10007233 3300009545 Bacteria 12177
262 Ga0105237_10017867 3300009545 Bacteria 7351
263 Ga0105237_10022543 3300009545 Bacteria 6460
264 Ga0105237_10084161 3300009545 Bacteria 3171
265 Ga0105237_10200402 3300009545 Bacteria 1996
266 Ga0105237_10318064 3300009545 Bacteria 1560
267 Ga0105237_10680015 3300009545 Bacteria 1036
268 Ga0105238_10000422 3300009551 Bacteria 44567
269 Ga0105238_10018910 3300009551 Bacteria 7016
270 Ga0105238_10081376 3300009551 Bacteria 3228
271 Ga0105238_10174489 3300009551 Unclassified 2126
272 Ga0105238_10728824 3300009551 Bacteria 1004
273 Ga0105249_10009474 3300009553 Bacteria 8527
274 Ga0105249_10067153 3300009553 Bacteria 3303
275 Ga0105249_10172233 3300009553 Unclassified 2100
276 Ga0105249_10601587 3300009553 Bacteria 1154
277 Ga0105249_10765594 3300009553 Bacteria 1028
278 Ga0105249_11007363 3300009553 Unclassified 902
279 Ga0105249_11031706 3300009553 Bacteria 892
280 Ga0105239_10000017 3300010375 Bacteria 290760
281 Ga0105239_10000126 3300010375 Bacteria 107921
282 Ga0105239_10000566 3300010375 Bacteria 53074
283 Ga0105239_10000958 3300010375 Bacteria 40571
284 Ga0105239_10002026 3300010375 Bacteria 26303
285 Ga0105239_10002474 3300010375 Bacteria 23547
286 Ga0105239_10003229 3300010375 Bacteria 20165
287 Ga0105239_10008727 3300010375 Bacteria 11476
288 Ga0105239_10075665 3300010375 Bacteria 3702
289 Ga0105239_10200529 3300010375 Bacteria 2235
290 Ga0105239_10273728 3300010375 Bacteria 1899
291 Ga0105246_10188980 3300011119 Bacteria 1593
292 Ga0157373_10046724 3300013100 Unclassified 3089
293 Ga0157371_10000548 3300013102 Bacteria 44733
294 Ga0157371_10064165 3300013102 Bacteria 2603
295 Ga0157371_10131699 3300013102 Bacteria 1779
296 Ga0157371_10162604 3300013102 Bacteria 1594
297 Ga0157371_10286653 3300013102 Bacteria 1190
298 Ga0157370_10000426 3300013104 Bacteria 52773
299 Ga0157370_10050996 3300013104 Bacteria 3953
300 Ga0157370_10196276 3300013104 Unclassified 1873
301 Ga0157370_10290268 3300013104 Bacteria 1511
302 Ga0157370_10761226 3300013104 Bacteria 882
303 Ga0157369_10013765 3300013105 Bacteria 9144
304 Ga0157369_10101052 3300013105 Unclassified 3074
305 Ga0157369_10192759 3300013105 Bacteria 2141
306 Ga0157369_10703170 3300013105 Bacteria 1041
307 Ga0157374_10000001 3300013296 Bacteria 1077351
308 Ga0157374_10013422 3300013296 Bacteria 7150
309 Ga0157374_10031377 3300013296 Bacteria 4829
310 Ga0157374_10081757 3300013296 Bacteria 3066
311 Ga0157374_10134490 3300013296 Bacteria 2396
312 Ga0157374_10157323 3300013296 Bacteria 2212
313 Ga0157374_10446791 3300013296 Unclassified 1294
314 Ga0157374_10481645 3300013296 Unclassified 1244
315 Ga0157374_10633810 3300013296 Bacteria 1080
316 Ga0157378_10001036 3300013297 Bacteria 25378
317 Ga0157378_10003261 3300013297 Bacteria 14423
318 Ga0157378_10003577 3300013297 Bacteria 13761
319 Ga0157378_10009825 3300013297 Bacteria 8342
320 Ga0157378_10058008 3300013297 Bacteria 3452
321 Ga0157378_10059847 3300013297 Bacteria 3399
322 Ga0157378_10118781 3300013297 Bacteria 2434
323 Ga0157378_10247866 3300013297 Bacteria 1704
324 Ga0157378_10254136 3300013297 Bacteria 1684
325 Ga0157378_10600165 3300013297 Bacteria 1112
326 Ga0157378_10934909 3300013297 Unclassified 899
327 Ga0163162_10000214 3300013306 Bacteria 53543
328 Ga0163162_10000746 3300013306 Bacteria 30256
329 Ga0163162_10003837 3300013306 Bacteria 14412
330 Ga0163162_10004601 3300013306 Bacteria 13293
331 Ga0163162_10008000 3300013306 Bacteria 10311
332 Ga0163162_10028558 3300013306 Bacteria 5520
333 Ga0163162_10033319 3300013306 Bacteria 5118
334 Ga0163162_10041455 3300013306 Bacteria 4606
335 Ga0163162_10061096 3300013306 Bacteria 3806
336 Ga0163162_10065099 3300013306 Bacteria 3691
337 Ga0163162_10070938 3300013306 Bacteria 3536
338 Ga0163162_10164531 3300013306 Bacteria 2342
339 Ga0163162_10526533 3300013306 Bacteria 1311
340 Ga0163162_10555151 3300013306 Bacteria 1276
341 Ga0163162_10559152 3300013306 Bacteria 1272
342 Ga0163162_10591449 3300013306 Bacteria 1236
343 Ga0157372_10001870 3300013307 Bacteria 22853
344 Ga0157372_10030550 3300013307 Bacteria 5894
345 Ga0157372_10102911 3300013307 Bacteria 3262
346 Ga0157372_10127330 3300013307 Bacteria 2928
347 Ga0157372_10137662 3300013307 Unclassified 2812
348 Ga0157372_10182637 3300013307 Bacteria 2429
349 Ga0157372_10352840 3300013307 Bacteria 1714
350 Ga0157375_10000125 3300013308 Bacteria 75607
351 Ga0157375_10015416 3300013308 Bacteria 6841
352 Ga0157375_10017332 3300013308 Bacteria 6498
353 Ga0157375_10075094 3300013308 Bacteria 3404
354 Ga0157375_10159592 3300013308 Bacteria 2396
355 Ga0157375_10531535 3300013308 Bacteria 1339
356 Ga0157375_10679369 3300013308 Unclassified 1184
357 Ga0163163_10022878 3300014325 Bacteria 5924
358 Ga0163163_10028496 3300014325 Bacteria 5364
359 Ga0163163_10038726 3300014325 Unclassified 4647
360 Ga0163163_10039355 3300014325 Bacteria 4614
361 Ga0163163_10053081 3300014325 Bacteria 4000
362 Ga0163163_10079543 3300014325 Unclassified 3276
363 Ga0163163_10416238 3300014325 Bacteria 1403
364 Ga0163163_10631200 3300014325 Bacteria 1135
365 Ga0163163_10808033 3300014325 Bacteria 1001
366 Ga0157380_10508528 3300014326 Bacteria 1172
367 Ga0157377_10043178 3300014745 Unclassified 2508
368 Ga0157377_10062341 3300014745 Bacteria 2133
369 Ga0157379_10006414 3300014968 Bacteria 10131
370 Ga0157379_10016848 3300014968 Bacteria 6432
371 Ga0157379_10098454 3300014968 Bacteria 2625
372 Ga0157379_10176329 3300014968 Bacteria 1930
373 Ga0157376_10001900 3300014969 Bacteria 13949
374 Ga0157376_10002389 3300014969 Bacteria 12680
375 Ga0157376_10048874 3300014969 Bacteria 3501
376 Ga0157376_10145558 3300014969 Bacteria 2131
377 Ga0157376_10158383 3300014969 Bacteria 2050
378 Ga0157376_10168006 3300014969 Bacteria 1995
379 Ga0157376_10243315 3300014969 Bacteria 1677
380 Ga0163161_10007441 3300017792 Bacteria 7566
381 Ga0163161_10012849 3300017792 Bacteria 5817
382 Ga0163161_10017410 3300017792 Bacteria 5028
383 Ga0163161_10139421 3300017792 Unclassified 1835
384 Ga0163161_10472952 3300017792 Bacteria 1016
385 Ga0209436_103440 3300025208 Bacteria 4214
386 Ga0209563_106089 3300025230 Bacteria 2108
387 Ga0207427_100138 3300025231 Bacteria 86499
388 Ga0209437_100010 3300025233 Bacteria 838447
389 Ga0209646_1000006 3300025246 Bacteria 694084
390 Ga0209026_1000262 3300025250 Bacteria 64597
391 Ga0209233_1000017 3300025261 Bacteria 898076
392 Ga0209455_1004518 3300025272 Unclassified 4526
393 Ga0209673_1000354 3300025273 Bacteria 83443
394 Ga0209673_1054118 3300025273 Unclassified 1042
395 Ga0209130_1001301 3300025284 Bacteria 17090
396 Ga0209564_1004026 3300025295 Bacteria 9293
397 Ga0209564_1006922 3300025295 Bacteria 5966
398 Ga0209564_1010412 3300025295 Bacteria 4288
399 Ga0209758_1003300 3300025297 Bacteria 14935
400 Ga0209758_1006769 3300025297 Bacteria 8055
401 Ga0209758_1009028 3300025297 Bacteria 6301
402 Ga0209050_1000163 3300025298 Bacteria 154895
403 Ga0207426_1000060 3300025302 Bacteria 363139
404 Ga0207426_1000096 3300025302 Bacteria 271627
405 Ga0207426_1000157 3300025302 Bacteria 178442
406 Ga0207426_1002866 3300025302 Bacteria 10231
407 Ga0207426_1038024 3300025302 Bacteria 1518
408 Ga0209257_1011230 3300025304 Bacteria 4347
409 Ga0207642_10040479 3300025899 Bacteria 2034
410 Ga0207710_10090245 3300025900 Bacteria 1433
411 Ga0207680_10001183 3300025903 Bacteria 12328
412 Ga0207680_10015875 3300025903 Bacteria 3941
413 Ga0207680_10016256 3300025903 Bacteria 3902
414 Ga0207680_10188301 3300025903 Bacteria 1399
415 Ga0207647_10052617 3300025904 Unclassified 2513
416 Ga0207647_10168329 3300025904 Bacteria 1276
417 Ga0207647_10172270 3300025904 Unclassified 1260
418 Ga0207685_10181858 3300025905 Unclassified 975
419 Ga0207645_10021368 3300025907 Unclassified 4221
420 Ga0207645_10031006 3300025907 Bacteria 3443
421 Ga0207705_10027566 3300025909 Bacteria 4052
422 Ga0207654_10002076 3300025911 Bacteria 10270
423 Ga0207654_10002638 3300025911 Bacteria 9098
424 Ga0207654_10004110 3300025911 Bacteria 7336
425 Ga0207654_10010271 3300025911 Bacteria 4768
426 Ga0207707_10000111 3300025912 Bacteria 82165
427 Ga0207707_10092681 3300025912 Bacteria 2640
428 Ga0207707_10108977 3300025912 Bacteria 2421
429 Ga0207695_10000019 3300025913 Bacteria 732137
430 Ga0207695_10000057 3300025913 Bacteria 376090
431 Ga0207695_10000068 3300025913 Bacteria 324859
432 Ga0207695_10002809 3300025913 Bacteria 25312
433 Ga0207695_10022478 3300025913 Bacteria 7156
434 Ga0207695_10038940 3300025913 Bacteria 5113
435 Ga0207695_10049375 3300025913 Bacteria 4436
436 Ga0207695_10050172 3300025913 Bacteria 4392
437 Ga0207695_10154492 3300025913 Bacteria 2230
438 Ga0207695_10564871 3300025913 Bacteria 1019
439 Ga0207671_10000515 3300025914 Bacteria 52421
440 Ga0207671_10001507 3300025914 Bacteria 26846
441 Ga0207671_10001648 3300025914 Bacteria 25416
442 Ga0207671_10004263 3300025914 Bacteria 13763
443 Ga0207671_10007231 3300025914 Bacteria 9667
444 Ga0207671_10020022 3300025914 Bacteria 5103
445 Ga0207671_10032780 3300025914 Bacteria 3865
446 Ga0207660_10021100 3300025917 Bacteria 4377
447 Ga0207660_10054559 3300025917 Bacteria 2853
448 Ga0207657_10014655 3300025919 Bacteria 7639
449 Ga0207649_10047637 3300025920 Bacteria 2639
450 Ga0207649_10052351 3300025920 Bacteria 2532
451 Ga0207652_10000538 3300025921 Bacteria 38475
452 Ga0207652_10038532 3300025921 Bacteria 4053
453 Ga0207652_10053384 3300025921 Bacteria 3472
454 Ga0207652_10101134 3300025921 Bacteria 2546
455 Ga0207681_10079696 3300025923 Unclassified 2308
456 Ga0207694_10142483 3300025924 Unclassified 1928
457 Ga0207694_10461784 3300025924 Unclassified 1061
458 Ga0207650_10101974 3300025925 Bacteria 2210
459 Ga0207650_10112539 3300025925 Bacteria 2109
460 Ga0207650_10269473 3300025925 Bacteria 1383
461 Ga0207650_10450412 3300025925 Bacteria 1071
462 Ga0207650_10650417 3300025925 Unclassified 889
463 Ga0207659_10116136 3300025926 Bacteria 2043
464 Ga0207659_10461968 3300025926 Bacteria 1070
465 Ga0207644_10007168 3300025931 Bacteria 7263
466 Ga0207644_10079906 3300025931 Bacteria 2414
467 Ga0207644_10215029 3300025931 Bacteria 1521
468 Ga0207644_10628299 3300025931 Unclassified 893
469 Ga0207690_10019756 3300025932 Bacteria 4153
470 Ga0207706_10008179 3300025933 Bacteria 9648
471 Ga0207706_10020230 3300025933 Bacteria 5982
472 Ga0207706_10035883 3300025933 Bacteria 4406
473 Ga0207706_10075732 3300025933 Bacteria 2960
474 Ga0207706_10084043 3300025933 Bacteria 2798
475 Ga0207686_10000375 3300025934 Bacteria 31141
476 Ga0207670_10056219 3300025936 Bacteria 2663
477 Ga0207670_10181717 3300025936 Bacteria 1585
478 Ga0207691_10005439 3300025940 Bacteria 12299
479 Ga0207691_10114579 3300025940 Bacteria 2395
480 Ga0207691_10153153 3300025940 Unclassified 2026
481 Ga0207711_10437746 3300025941 Unclassified 1217
482 Ga0207689_10003450 3300025942 Bacteria 14436
483 Ga0207689_10039074 3300025942 Bacteria 3930
484 Ga0207689_10435380 3300025942 Bacteria 1095
485 Ga0207661_10031975 3300025944 Bacteria 4072
486 Ga0207661_10042051 3300025944 Bacteria 3601
487 Ga0207661_10115041 3300025944 Bacteria 2281
488 Ga0207661_10390105 3300025944 Bacteria 1261
489 Ga0207679_10043751 3300025945 Bacteria 3226
490 Ga0207679_10052795 3300025945 Bacteria 2983
491 Ga0207679_10075204 3300025945 Unclassified 2562
492 Ga0207679_10106918 3300025945 Bacteria 2200
493 Ga0207667_10000621 3300025949 Bacteria 45894
494 Ga0207667_10116475 3300025949 Bacteria 2753
495 Ga0207667_10132744 3300025949 Bacteria 2565
496 Ga0207667_10176490 3300025949 Unclassified 2195
497 Ga0207651_10205130 3300025960 Unclassified 1583
498 Ga0207651_10231544 3300025960 Bacteria 1500
499 Ga0207651_10267760 3300025960 Unclassified 1406
500 Ga0207651_10269722 3300025960 Bacteria 1401
501 Ga0207651_10297305 3300025960 Bacteria 1341
502 Ga0207651_10401578 3300025960 Unclassified 1166
503 Ga0207712_10025016 3300025961 Bacteria 3962
504 Ga0207712_10067880 3300025961 Unclassified 2553
505 Ga0207712_10161561 3300025961 Bacteria 1742
506 Ga0207712_10793936 3300025961 Unclassified 832
507 Ga0207668_10858205 3300025972 Bacteria 806
508 Ga0207640_10062216 3300025981 Bacteria 2475
509 Ga0207640_10075009 3300025981 Unclassified 2291
510 Ga0207640_10192486 3300025981 Bacteria 1538
511 Ga0207658_10012271 3300025986 Bacteria 5849
512 Ga0207658_10019797 3300025986 Bacteria 4657
513 Ga0207658_10043198 3300025986 Bacteria 3275
514 Ga0207658_10448883 3300025986 Unclassified 1141
515 Ga0207677_10016626 3300026023 Bacteria 4363
516 Ga0207677_10298680 3300026023 Unclassified 1329
517 Ga0207703_10000798 3300026035 Bacteria 31051
518 Ga0207703_10049018 3300026035 Bacteria 3412
519 Ga0207703_10126439 3300026035 Unclassified 2202
520 Ga0207703_10354522 3300026035 Bacteria 1351
521 Ga0207639_10039989 3300026041 Bacteria 3498
522 Ga0207639_10427714 3300026041 Bacteria 1198
523 Ga0207639_10502938 3300026041 Bacteria 1107
524 Ga0207678_10137935 3300026067 Bacteria 2081
525 Ga0207708_10127057 3300026075 Unclassified 1991
526 Ga0207702_10002255 3300026078 Bacteria 18481
527 Ga0207702_10009624 3300026078 Bacteria 8111
528 Ga0207702_10041386 3300026078 Bacteria 3864
529 Ga0207702_10042062 3300026078 Bacteria 3832
530 Ga0207702_10620940 3300026078 Bacteria 1061
531 Ga0207641_10000056 3300026088 Bacteria 170719
532 Ga0207641_10000690 3300026088 Bacteria 36445
533 Ga0207641_10080123 3300026088 Bacteria 2832
534 Ga0207641_10269272 3300026088 Unclassified 1598
535 Ga0207641_10351457 3300026088 Bacteria 1405
536 Ga0207641_10717655 3300026088 Bacteria 985
537 Ga0207648_10053122 3300026089 Bacteria 3542
538 Ga0207648_10171436 3300026089 Bacteria 1918
539 Ga0207648_10222522 3300026089 Unclassified 1678
540 Ga0207648_10275919 3300026089 Bacteria 1503
541 Ga0207648_10432231 3300026089 Bacteria 1197
542 Ga0207676_10005956 3300026095 Bacteria 8600
543 Ga0207676_10055592 3300026095 Bacteria 3108
544 Ga0207676_10077417 3300026095 Bacteria 2690
545 Ga0207676_10229463 3300026095 Bacteria 1659
546 Ga0207676_10264741 3300026095 Bacteria 1554
547 Ga0207676_10635879 3300026095 Unclassified 1028
548 Ga0207674_10017345 3300026116 Bacteria 7855
549 Ga0207674_10914515 3300026116 Unclassified 846
550 Ga0207675_100025171 3300026118 Bacteria 5538
551 Ga0207675_100146973 3300026118 Unclassified 2242
552 Ga0207675_100474663 3300026118 Bacteria 1242
553 Ga0207683_10127576 3300026121 Bacteria 2287
554 Ga0207683_10339664 3300026121 Bacteria 1377
555 Ga0207698_10034662 3300026142 Bacteria 3682
556 Ga0207698_10064122 3300026142 Unclassified 2878
557 Ga0207698_10076314 3300026142 Bacteria 2682
558 Ga0207698_10201475 3300026142 Bacteria 1782
559 Ga0207698_10972432 3300026142 Bacteria 859
560 Ga0268266_10000070 3300028379 Bacteria 235423
561 Ga0268265_10299066 3300028380 Bacteria 1448
562 Ga0268264_10000011 3300028381 Bacteria 580884
563 Ga0268264_10002267 3300028381 Bacteria 17033
564 Ga0268264_10002439 3300028381 Bacteria 16350
565 Ga0268264_10002602 3300028381 Bacteria 15783
566 Ga0268264_10018085 3300028381 Bacteria 5765
567 Ga0268264_10032902 3300028381 Bacteria 4255
568 Ga0268264_10127345 3300028381 Bacteria 2253
569 Ga0268264_10130451 3300028381 Bacteria 2227
570 Ga0265322_10034698 3300028654 Bacteria 1437
571 Ga0307517_10002276 3300028786 Bacteria 30977
572 Ga0307515_10000078 3300028794 Bacteria 227988
573 Ga0265338_10188139 3300028800 Bacteria 1567
574 Ga0307511_10000304 3300030521 Bacteria 52160
575 Ga0265327_10000048 3300031251 Bacteria 269173
576 Ga0265327_10102895 3300031251 Bacteria 1375
577 Ga0307509_10061686 3300031507 Unclassified 3957
578 Ga0307509_10090538 3300031507 Bacteria 3135
579 Ga0307509_10141944 3300031507 Bacteria 2335
580 Ga0307516_10001487 3300031730 Bacteria 32321
581 Ga0307516_10087877 3300031730 Bacteria 2942
582 Ga0307510_10000062 3300033180 Bacteria 81920
583 Ga0373943_0147067 3300035170 Bacteria 1274
584 Ga0373943_0167537 3300035170 Bacteria 1200
585 Ga0373955_0011356 3300035172 Bacteria 4241
586 Ga0373947_0119761 3300035725 Bacteria 1671
587 Ga0395899_0000002 3300037312 Bacteria 1324310
588 Ga0395899_0013384 3300037312 Bacteria 6277
589 Ga0395900_0036349 3300037418 Bacteria 5077
590 Ga0395900_0169747 3300037418 Bacteria 2221
591 Ga0395898_0045550 3300037466 Bacteria 4311
592 Ga0395905_0324575 3300037471 Unclassified 1429
593 Ga0395901_0361168 3300038443 Bacteria 1497
594 Ga0451793_1724395 3300041452 Unclassified 1248
595 Ga0451839_1285172 3300041496 Unclassified 1445
596 Ga0466972_0000014 3300044658 Bacteria 216776
597 Ga0466972_0028584 3300044658 Bacteria 2749
598 Ga0466972_0105570 3300044658 Bacteria 1332
599 Ga0466965_0044649 3300044683 Bacteria 2191
600 Ga0466966_0132644 3300044684 Bacteria 1525
601 Ga0466961_0045509 3300044693 Bacteria 2808
602 Ga0466970_0002409 3300044765 Bacteria 9036
603 Ga0466959_0026914 3300045049 Bacteria 4265
604 Ga0495629_0172216 3300046459 Unclassified 1502
605 Ga0495638_0024301 3300046460 Bacteria 3953
606 Ga0495580_0089987 3300046472 Bacteria 2137
607 Ga0495582_0077330 3300046473 Unclassified 1846
608 Ga0495648_0023003 3300046524 Bacteria 4276
609 Ga0495640_0064438 3300046533 Bacteria 2478
610 Ga0495586_0258167 3300046535 Bacteria 995
611 Ga0495611_0000150 3300046648 Bacteria 49672
612 Ga0495611_0048018 3300046648 Bacteria 1917
613 Ga0495625_0096223 3300046660 Bacteria 2040
614 Ga0495635_0143276 3300046663 Unclassified 1627
615 Ga0495658_0025365 3300046683 Unclassified 3168
616 Ga0495658_0182725 3300046683 Bacteria 1302
617 Ga0495674_0081733 3300047319 Unclassified 2771
618 Ga0495672_0046727 3300047320 Bacteria 2580
619 Ga0495676_0197922 3300047321 Bacteria 1398
620 Ga0495687_000006 3300047443 Bacteria 571936
621 Ga0495684_0155414 3300047471 Bacteria 1709
622 Ga0495686_0000078 3300047472 Bacteria 203927
623 Ga0496101_0019332 3300048904 Bacteria 4650
624 Ga0496104_0315165 3300048907 Bacteria 1477
625 Ga0496110_0118808 3300048913 Bacteria 2381
626 Ga0496111_0118855 3300048914 Bacteria 1951
627 Ga0496112_0213058 3300048915 Bacteria 1889
628 Ga0496115_0121040 3300048918 Bacteria 2154
629 Ga0501034_0165896 3300049571 Bacteria 2177
630 Ga0501037_0459996 3300049573 Unclassified 867
631 Ga0501046_0292587 3300049580 Unclassified 1191
632 Ga0501047_0350061 3300049581 Unclassified 1314
633 Ga0501048_0215029 3300049582 Unclassified 1363
634 Ga0501067_0102960 3300049583 Unclassified 1586
635 Ga0501068_0282913 3300049584 Unclassified 1060
636 Ga0501069_0018441 3300049585 Bacteria 3765
637 Ga0501073_0014748 3300049589 Bacteria 5676
638 Ga0501079_0727771 3300049741 Unclassified 781
639 Ga0501083_0012904 3300049744 Bacteria 5839
640 Ga0501044_0240296 3300049823 Archaea 1755
641 nmdc:mga0k408_162134_c1 3300050493 Unclassified 1332
642 nmdc:mga0n895_663492_c1 3300050512 Bacteria 1041
643 Ga0500652_016281 3300053131 Unclassified 2702
644 Ga0500568_0032490 3300053139 Bacteria 2146
645 Ga0500622_0010155 3300053156 Bacteria 5178
646 Ga0500637_0046561 3300053178 Bacteria 2462
647 Ga0501084_0004894 3300054114 Bacteria 10945
648 Ga0501082_0373692 3300060353 Unclassified 1243
649 Ga0466962_0033092 3300061719 Bacteria 2473

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100558088 Ga0070689_1005580881 204
2 3300005618 Ga0068864_100501788 Ga0068864_1005017881 204
3 3300005842 Ga0068858_100321674 Ga0068858_1003216742 204
4 3300006163 Ga0070715_10326361 Ga0070715_103263611 204
5 3300006358 Ga0068871_100330850 Ga0068871_1003308502 204
6 3300013306 Ga0163162_10041455 Ga0163162_100414553 204
7 3300025905 Ga0207685_10181858 Ga0207685_101818582 204
8 3300025931 Ga0207644_10628299 Ga0207644_106282992 204
9 3300025941 Ga0207711_10437746 Ga0207711_104377462 204
10 3300025961 Ga0207712_10067880 Ga0207712_100678801 204
11 3300026035 Ga0207703_10126439 Ga0207703_101264393 204
12 3300026095 Ga0207676_10635879 Ga0207676_106358792 204
13 3300009093 Ga0105240_10384828 Ga0105240_103848281 214
14 3300005290 Ga0065712_10323773 Ga0065712_103237731 216
15 3300005367 Ga0070667_100245685 Ga0070667_1002456852 218
16 3300005456 Ga0070678_100098259 Ga0070678_1000982593 218
17 3300005543 Ga0070672_100600668 Ga0070672_1006006683 218
18 3300009176 Ga0105242_10881055 Ga0105242_108810551 218
19 3300009177 Ga0105248_10064000 Ga0105248_100640005 218
20 3300009553 Ga0105249_11031706 Ga0105249_110317061 218
21 3300013308 Ga0157375_10000125 Ga0157375_1000012536 218
22 3300031730 Ga0307516_10001487 Ga0307516_100014876 218
23 3300013102 Ga0157371_10131699 Ga0157371_101316992 223
24 3300025297 Ga0209758_1006769 Ga0209758_10067694 223
25 3300003354 JGI25160J50197_1002488 JGI25160J50197_10024886 225
26 3300003771 Ga0055526_1010370 Ga0055526_10103704 225
27 3300003771 Ga0055526_1032649 Ga0055526_10326492 225
28 3300003790 Ga0055528_1000572 Ga0055528_10005723 225
29 3300003791 Ga0055530_10000789 Ga0055530_1000078916 225
30 3300005262 Ga0065165_1000017 Ga0065165_100001726 225
31 3300025273 Ga0209673_1000354 Ga0209673_100035437 225
32 3300025273 Ga0209673_1054118 Ga0209673_10541181 225
33 3300025295 Ga0209564_1004026 Ga0209564_10040264 225
34 3300025295 Ga0209564_1006922 Ga0209564_10069225 225
35 3300025295 Ga0209564_1010412 Ga0209564_10104125 225
36 3300025297 Ga0209758_1003300 Ga0209758_10033008 225
37 3300025298 Ga0209050_1000163 Ga0209050_100016329 225
38 3300025302 Ga0207426_1002866 Ga0207426_10028665 225
39 3300025304 Ga0209257_1011230 Ga0209257_10112302 225
40 3300050493 nmdc:mga0k408_162134_c1 nmdc:mga0k408_162134_c1_31_780 225
41 3300003320 rootH2_10001414 rootH2_100014145 226
42 3300003320 rootH2_10187887 rootH2_101878872 227
43 3300014325 Ga0163163_10038726 Ga0163163_100387261 227
44 3300005577 Ga0068857_100429115 Ga0068857_1004291152 228
45 3300014325 Ga0163163_10053081 Ga0163163_100530813 228
46 3300009093 Ga0105240_10411375 Ga0105240_104113753 229
47 3300005329 Ga0070683_100093238 Ga0070683_1000932382 230
48 3300005335 Ga0070666_10043983 Ga0070666_100439832 230
49 3300005616 Ga0068852_100250059 Ga0068852_1002500592 230
50 3300009093 Ga0105240_10002002 Ga0105240_1000200220 230
51 3300009174 Ga0105241_10023243 Ga0105241_100232434 230
52 3300009545 Ga0105237_10022543 Ga0105237_100225432 230
53 3300009551 Ga0105238_10000422 Ga0105238_1000042229 230
54 3300010375 Ga0105239_10075665 Ga0105239_100756652 230
55 3300013306 Ga0163162_10526533 Ga0163162_105265332 230
56 3300013307 Ga0157372_10030550 Ga0157372_100305505 230
57 3300025208 Ga0209436_103440 Ga0209436_1034402 230
58 3300025284 Ga0209130_1001301 Ga0209130_100130113 230
59 3300025302 Ga0207426_1000096 Ga0207426_100009682 230
60 3300025944 Ga0207661_10390105 Ga0207661_103901052 230
61 3300026088 Ga0207641_10000690 Ga0207641_1000069028 230
62 3300028381 Ga0268264_10127345 Ga0268264_101273455 230
63 3300044658 Ga0466972_0028584 Ga0466972_0028584_1636_2328 230
64 3300046460 Ga0495638_0024301 Ga0495638_0024301_1219_1911 230
65 3300046524 Ga0495648_0023003 Ga0495648_0023003_208_900 230
66 3300047443 Ga0495687_000006 Ga0495687_000006_197996_198688 230
67 3300053156 Ga0500622_0010155 Ga0500622_0010155_1009_1701 230
68 3300009174 Ga0105241_10275042 Ga0105241_102750422 231
69 3300009553 Ga0105249_10172233 Ga0105249_101722333 231
70 3300013306 Ga0163162_10003837 Ga0163162_100038371 231
71 3300014325 Ga0163163_10631200 Ga0163163_106312002 231
72 3300014968 Ga0157379_10016848 Ga0157379_100168486 231
73 3300017792 Ga0163161_10012849 Ga0163161_100128496 231
74 3300046472 Ga0495580_0089987 Ga0495580_0089987_24_773 231
75 3300003322 rootL2_10300232 rootL2_103002323 232
76 3300005328 Ga0070676_10029614 Ga0070676_100296143 232
77 3300005338 Ga0068868_100002455 Ga0068868_1000024552 232
78 3300005355 Ga0070671_100030079 Ga0070671_1000300792 232
79 3300005364 Ga0070673_100089533 Ga0070673_1000895332 232
80 3300005365 Ga0070688_100078898 Ga0070688_1000788982 232
81 3300005614 Ga0068856_100014177 Ga0068856_1000141773 232
82 3300005834 Ga0068851_10059600 Ga0068851_100596001 232
83 3300005841 Ga0068863_100065602 Ga0068863_1000656022 232
84 3300006358 Ga0068871_100075370 Ga0068871_1000753703 232
85 3300013296 Ga0157374_10481645 Ga0157374_104816452 232
86 3300013308 Ga0157375_10679369 Ga0157375_106793692 232
87 3300014325 Ga0163163_10079543 Ga0163163_100795432 232
88 3300025907 Ga0207645_10031006 Ga0207645_100310063 232
89 3300025925 Ga0207650_10112539 Ga0207650_101125392 232
90 3300026023 Ga0207677_10016626 Ga0207677_100166262 232
91 3300026088 Ga0207641_10080123 Ga0207641_100801233 232
92 3300003323 rootH1_10018525 rootH1_100185254 233
93 3300005293 Ga0065715_10154051 Ga0065715_101540511 233
94 3300005337 Ga0070682_100083516 Ga0070682_1000835161 233
95 3300005338 Ga0068868_100180587 Ga0068868_1001805871 233
96 3300005355 Ga0070671_100190123 Ga0070671_1001901232 233
97 3300005364 Ga0070673_100505524 Ga0070673_1005055241 233
98 3300005563 Ga0068855_100077427 Ga0068855_1000774275 233
99 3300005616 Ga0068852_100251949 Ga0068852_1002519492 233
100 3300005719 Ga0068861_100046054 Ga0068861_1000460542 233
101 3300005841 Ga0068863_100091159 Ga0068863_1000911593 233
102 3300005843 Ga0068860_100125138 Ga0068860_1001251383 233
103 3300005844 Ga0068862_100179448 Ga0068862_1001794482 233
104 3300006237 Ga0097621_100006155 Ga0097621_10000615512 233
105 3300009176 Ga0105242_10007074 Ga0105242_100070745 233
106 3300009176 Ga0105242_10520817 Ga0105242_105208172 233
107 3300009553 Ga0105249_10765594 Ga0105249_107655942 233
108 3300013296 Ga0157374_10446791 Ga0157374_104467911 233
109 3300013297 Ga0157378_10600165 Ga0157378_106001651 233
110 3300013297 Ga0157378_10934909 Ga0157378_109349091 233
111 3300014745 Ga0157377_10043178 Ga0157377_100431784 233
112 3300017792 Ga0163161_10017410 Ga0163161_100174102 233
113 3300025899 Ga0207642_10040479 Ga0207642_100404792 233
114 3300025913 Ga0207695_10038940 Ga0207695_100389404 233
115 3300025925 Ga0207650_10450412 Ga0207650_104504122 233
116 3300025934 Ga0207686_10000375 Ga0207686_100003757 233
117 3300025940 Ga0207691_10005439 Ga0207691_1000543916 233
118 3300025949 Ga0207667_10132744 Ga0207667_101327442 233
119 3300026075 Ga0207708_10127057 Ga0207708_101270573 233
120 3300026118 Ga0207675_100025171 Ga0207675_1000251714 233
121 3300028381 Ga0268264_10130451 Ga0268264_101304513 233
122 3300031507 Ga0307509_10061686 Ga0307509_100616864 233
123 3300041452 Ga0451793_1724395 Ga0451793_1724395_98_847 233
124 3300001979 JGI24740J21852_10002328 JGI24740J21852_100023285 234
125 3300005341 Ga0070691_10002772 Ga0070691_100027724 234
126 3300010375 Ga0105239_10200529 Ga0105239_102005292 234
127 3300013104 Ga0157370_10761226 Ga0157370_107612261 234
128 3300013105 Ga0157369_10703170 Ga0157369_107031702 234
129 3300013297 Ga0157378_10003261 Ga0157378_1000326111 234
130 3300031730 Ga0307516_10087877 Ga0307516_100878772 234
131 3300035170 Ga0373943_0167537 Ga0373943_0167537_78_824 234
132 3300035172 Ga0373955_0011356 Ga0373955_0011356_3449_4195 234
133 3300041496 Ga0451839_1285172 Ga0451839_1285172_72_818 234
134 3300046533 Ga0495640_0064438 Ga0495640_0064438_1091_1837 234
135 3300046535 Ga0495586_0258167 Ga0495586_0258167_27_773 234
136 3300046683 Ga0495658_0182725 Ga0495658_0182725_139_885 234
137 iso_pu_bacteria 2929177148 2929181259 234
138 iso_pu_bacteria 2945977869 2945983663 234
139 iso_pu_bacteria 2946013367 2946016927 234
140 3300009545 Ga0105237_10007233 Ga0105237_100072339 235
141 3300025272 Ga0209455_1004518 Ga0209455_10045184 235
142 3300025914 Ga0207671_10004263 Ga0207671_1000426312 235
143 3300048918 Ga0496115_0121040 Ga0496115_0121040_539_1294 235
144 3300014969 Ga0157376_10158383 Ga0157376_101583832 236
145 3300044658 Ga0466972_0105570 Ga0466972_0105570_122_871 236
146 3300013306 Ga0163162_10591449 Ga0163162_105914492 237
147 3300005530 Ga0070679_100128370 Ga0070679_1001283702 238
148 3300013296 Ga0157374_10633810 Ga0157374_106338101 238
149 3300013306 Ga0163162_10559152 Ga0163162_105591521 238
150 3300025921 Ga0207652_10101134 Ga0207652_101011341 238
151 3300003316 rootH1_10104481 rootH1_101044812 239
152 3300003320 rootH2_10191691 rootH2_101916914 239
153 3300003323 rootH1_10112358 rootH1_101123587 239
154 3300049741 Ga0501079_0727771 Ga0501079_0727771_44_769 239
155 3300005843 Ga0068860_100072581 Ga0068860_1000725813 240
156 3300009093 Ga0105240_10452127 Ga0105240_104521271 240
157 3300025925 Ga0207650_10650417 Ga0207650_106504172 240
158 3300026041 Ga0207639_10502938 Ga0207639_105029382 240
159 3300026089 Ga0207648_10053122 Ga0207648_100531224 240
160 3300026095 Ga0207676_10229463 Ga0207676_102294632 240
161 3300026116 Ga0207674_10914515 Ga0207674_109145151 240
162 3300028381 Ga0268264_10002439 Ga0268264_100024393 240
163 3300053131 Ga0500652_016281 Ga0500652_016281_826_1575 240
164 3300053139 Ga0500568_0032490 Ga0500568_0032490_160_909 240
165 3300005329 Ga0070683_100011222 Ga0070683_1000112223 241
166 3300005535 Ga0070684_100028964 Ga0070684_1000289643 241
167 3300013306 Ga0163162_10164531 Ga0163162_101645314 241
168 3300025302 Ga0207426_1038024 Ga0207426_10380241 241
169 3300013296 Ga0157374_10000001 Ga0157374_10000001783 242
170 3300002738 JGI25154J39366_1000044 JGI25154J39366_100004488 243
171 3300005563 Ga0068855_100244936 Ga0068855_1002449363 243
172 3300014325 Ga0163163_10416238 Ga0163163_104162382 243
173 3300025246 Ga0209646_1000006 Ga0209646_1000006320 243
174 3300025250 Ga0209026_1000262 Ga0209026_100026239 243
175 iso_pu_bacteria 2884791551 2884792791 243
176 iso_pu_bacteria 2886627955 2886628836 244
177 3300003323 rootH1_10154623 rootH1_101546233 245
178 3300005539 Ga0068853_100001368 Ga0068853_1000013684 245
179 3300005577 Ga0068857_100505751 Ga0068857_1005057511 245
180 3300009093 Ga0105240_10167551 Ga0105240_101675512 245
181 3300009174 Ga0105241_10825965 Ga0105241_108259651 245
182 3300009545 Ga0105237_10680015 Ga0105237_106800151 245
183 3300009551 Ga0105238_10018910 Ga0105238_100189102 245
184 3300010375 Ga0105239_10008727 Ga0105239_100087275 245
185 3300025913 Ga0207695_10049375 Ga0207695_100493754 245
186 3300046660 Ga0495625_0096223 Ga0495625_0096223_922_1668 245
187 3300049583 Ga0501067_0102960 Ga0501067_0102960_366_1181 245
188 3300054114 Ga0501084_0004894 Ga0501084_0004894_10104_10919 245
189 iso_pu_bacteria 2818991460 2819681539 245
190 iso_pu_bacteria 2929921140 2929925027 245
191 iso_pu_bacteria 8003151029 8003157397 245
192 3300005578 Ga0068854_100019070 Ga0068854_1000190705 246
193 3300009093 Ga0105240_10012550 Ga0105240_100125504 246
194 3300009174 Ga0105241_10012190 Ga0105241_100121902 246
195 3300010375 Ga0105239_10003229 Ga0105239_1000322924 246
196 3300025913 Ga0207695_10154492 Ga0207695_101544921 246
197 3300026078 Ga0207702_10620940 Ga0207702_106209401 246
198 3300031251 Ga0265327_10000048 Ga0265327_1000004893 246
199 3300031251 Ga0265327_10102895 Ga0265327_101028952 246
200 3300003322 rootL2_10196379 rootL2_101963792 247
201 3300004799 Ga0058863_11690196 Ga0058863_116901962 247
202 3300005327 Ga0070658_10030999 Ga0070658_100309992 247
203 3300005335 Ga0070666_10117578 Ga0070666_101175781 247
204 3300005355 Ga0070671_100005460 Ga0070671_1000054605 247
205 3300005530 Ga0070679_100051407 Ga0070679_1000514074 247
206 3300005530 Ga0070679_100586346 Ga0070679_1005863461 247
207 3300005563 Ga0068855_100306734 Ga0068855_1003067342 247
208 3300005614 Ga0068856_100021104 Ga0068856_1000211044 247
209 3300005614 Ga0068856_100055918 Ga0068856_1000559186 247
210 3300005718 Ga0068866_10499861 Ga0068866_104998611 247
211 3300006237 Ga0097621_100000606 Ga0097621_10000060624 247
212 3300006358 Ga0068871_100000334 Ga0068871_1000003349 247
213 3300009093 Ga0105240_10000010 Ga0105240_10000010365 247
214 3300009174 Ga0105241_10033338 Ga0105241_100333383 247
215 3300009545 Ga0105237_10000227 Ga0105237_1000022724 247
216 3300009545 Ga0105237_10318064 Ga0105237_103180642 247
217 3300010375 Ga0105239_10002474 Ga0105239_1000247414 247
218 3300013104 Ga0157370_10290268 Ga0157370_102902682 247
219 3300013297 Ga0157378_10003577 Ga0157378_100035774 247
220 3300013306 Ga0163162_10000214 Ga0163162_1000021413 247
221 3300013306 Ga0163162_10004601 Ga0163162_100046015 247
222 3300014968 Ga0157379_10006414 Ga0157379_100064149 247
223 3300014969 Ga0157376_10001900 Ga0157376_1000190011 247
224 3300017792 Ga0163161_10007441 Ga0163161_100074412 247
225 3300025903 Ga0207680_10188301 Ga0207680_101883012 247
226 3300025909 Ga0207705_10027566 Ga0207705_100275662 247
227 3300025911 Ga0207654_10002076 Ga0207654_100020762 247
228 3300025911 Ga0207654_10002638 Ga0207654_100026385 247
229 3300025913 Ga0207695_10000019 Ga0207695_1000001991 247
230 3300025913 Ga0207695_10002809 Ga0207695_1000280917 247
231 3300025913 Ga0207695_10564871 Ga0207695_105648712 247
232 3300025914 Ga0207671_10000515 Ga0207671_1000051538 247
233 3300025914 Ga0207671_10001507 Ga0207671_1000150718 247
234 3300025921 Ga0207652_10038532 Ga0207652_100385322 247
235 3300025931 Ga0207644_10007168 Ga0207644_100071682 247
236 3300025986 Ga0207658_10012271 Ga0207658_100122713 247
237 3300026078 Ga0207702_10009624 Ga0207702_100096245 247
238 3300026078 Ga0207702_10041386 Ga0207702_100413863 247
239 3300026121 Ga0207683_10127576 Ga0207683_101275762 247
240 3300026142 Ga0207698_10064122 Ga0207698_100641223 247
241 3300028800 Ga0265338_10188139 Ga0265338_101881392 247
242 3300048904 Ga0496101_0019332 Ga0496101_0019332_3147_3911 247
243 3300048907 Ga0496104_0315165 Ga0496104_0315165_250_1014 247
244 2162886011 MRS1b_contig_2063463 MRS1b_0353.00003400 248
245 3300001991 JGI24743J22301_10009620 JGI24743J22301_100096202 248
246 3300002077 JGI24744J21845_10019369 JGI24744J21845_100193692 248
247 3300002737 JGI25162J39368_1000688 JGI25162J39368_100068825 248
248 3300002772 JGI25164J39214_1001043 JGI25164J39214_10010439 248
249 3300003214 JGI25165J46597_1003733 JGI25165J46597_10037334 248
250 3300003215 JGI25153J46596_10003613 JGI25153J46596_100036135 248
251 3300003320 rootH2_10002197 rootH2_100021972 248
252 3300003320 rootH2_10013265 rootH2_100132655 248
253 3300003320 rootH2_10230854 rootH2_102308542 248
254 3300003322 rootL2_10222192 rootL2_102221923 248
255 3300003323 rootH1_10001276 rootH1_1000127636 248
256 3300003323 rootH1_10052168 rootH1_100521683 248
257 3300003323 rootH1_10097619 rootH1_100976192 248
258 3300003323 rootH1_10338497 rootH1_103384972 248
259 3300003323 rootH1_10365013 rootH1_103650132 248
260 3300003354 JGI25160J50197_1004606 JGI25160J50197_10046065 248
261 3300003354 JGI25160J50197_1005692 JGI25160J50197_10056924 248
262 3300005262 Ga0065165_1019675 Ga0065165_10196752 248
263 3300005327 Ga0070658_10077787 Ga0070658_100777874 248
264 3300005329 Ga0070683_100026642 Ga0070683_1000266424 248
265 3300005330 Ga0070690_100040887 Ga0070690_1000408872 248
266 3300005330 Ga0070690_100079612 Ga0070690_1000796122 248
267 3300005331 Ga0070670_100073904 Ga0070670_1000739042 248
268 3300005331 Ga0070670_100261710 Ga0070670_1002617102 248
269 3300005334 Ga0068869_100004728 Ga0068869_1000047289 248
270 3300005335 Ga0070666_10000101 Ga0070666_1000010123 248
271 3300005335 Ga0070666_10015846 Ga0070666_100158463 248
272 3300005335 Ga0070666_10053096 Ga0070666_100530963 248
273 3300005336 Ga0070680_100000075 Ga0070680_10000007532 248
274 3300005336 Ga0070680_100049001 Ga0070680_1000490013 248
275 3300005337 Ga0070682_100000008 Ga0070682_10000000896 248
276 3300005337 Ga0070682_100000628 Ga0070682_10000062818 248
277 3300005337 Ga0070682_100025853 Ga0070682_1000258533 248
278 3300005338 Ga0068868_100000543 Ga0068868_1000005434 248
279 3300005338 Ga0068868_100041244 Ga0068868_1000412443 248
280 3300005338 Ga0068868_100051895 Ga0068868_1000518953 248
281 3300005338 Ga0068868_100053733 Ga0068868_1000537334 248
282 3300005338 Ga0068868_100139933 Ga0068868_1001399331 248
283 3300005338 Ga0068868_100232424 Ga0068868_1002324241 248
284 3300005338 Ga0068868_100373728 Ga0068868_1003737282 248
285 3300005338 Ga0068868_100426069 Ga0068868_1004260692 248
286 3300005338 Ga0068868_100673307 Ga0068868_1006733071 248
287 3300005339 Ga0070660_100007461 Ga0070660_1000074616 248
288 3300005340 Ga0070689_100009325 Ga0070689_1000093251 248
289 3300005340 Ga0070689_100022142 Ga0070689_1000221425 248
290 3300005341 Ga0070691_10000522 Ga0070691_100005226 248
291 3300005344 Ga0070661_100011271 Ga0070661_1000112713 248
292 3300005344 Ga0070661_100019628 Ga0070661_1000196283 248
293 3300005344 Ga0070661_100334427 Ga0070661_1003344272 248
294 3300005347 Ga0070668_100139122 Ga0070668_1001391222 248
295 3300005347 Ga0070668_100179030 Ga0070668_1001790302 248
296 3300005353 Ga0070669_100027806 Ga0070669_1000278063 248
297 3300005354 Ga0070675_100047970 Ga0070675_1000479702 248
298 3300005354 Ga0070675_100077145 Ga0070675_1000771452 248
299 3300005355 Ga0070671_100049820 Ga0070671_1000498202 248
300 3300005355 Ga0070671_100090307 Ga0070671_1000903072 248
301 3300005355 Ga0070671_100144949 Ga0070671_1001449492 248
302 3300005355 Ga0070671_100601032 Ga0070671_1006010321 248
303 3300005364 Ga0070673_100030800 Ga0070673_1000308002 248
304 3300005364 Ga0070673_100043944 Ga0070673_1000439442 248
305 3300005365 Ga0070688_100005011 Ga0070688_1000050117 248
306 3300005365 Ga0070688_100010942 Ga0070688_1000109427 248
307 3300005366 Ga0070659_100026039 Ga0070659_1000260393 248
308 3300005366 Ga0070659_100151898 Ga0070659_1001518981 248
309 3300005367 Ga0070667_100021007 Ga0070667_1000210074 248
310 3300005367 Ga0070667_100060561 Ga0070667_1000605612 248
311 3300005367 Ga0070667_100108083 Ga0070667_1001080834 248
312 3300005455 Ga0070663_100223193 Ga0070663_1002231931 248
313 3300005457 Ga0070662_100038027 Ga0070662_1000380275 248
314 3300005457 Ga0070662_100073798 Ga0070662_1000737982 248
315 3300005457 Ga0070662_100079156 Ga0070662_1000791562 248
316 3300005457 Ga0070662_100097015 Ga0070662_1000970153 248
317 3300005457 Ga0070662_100146349 Ga0070662_1001463492 248
318 3300005458 Ga0070681_10458403 Ga0070681_104584032 248
319 3300005459 Ga0068867_100015760 Ga0068867_1000157602 248
320 3300005459 Ga0068867_100079740 Ga0068867_1000797403 248
321 3300005459 Ga0068867_100476132 Ga0068867_1004761322 248
322 3300005459 Ga0068867_100629143 Ga0068867_1006291431 248
323 3300005466 Ga0070685_10205011 Ga0070685_102050111 248
324 3300005530 Ga0070679_100000892 Ga0070679_10000089213 248
325 3300005530 Ga0070679_100117894 Ga0070679_1001178942 248
326 3300005530 Ga0070679_100189896 Ga0070679_1001898962 248
327 3300005535 Ga0070684_100022795 Ga0070684_1000227952 248
328 3300005535 Ga0070684_100070959 Ga0070684_1000709592 248
329 3300005535 Ga0070684_100253583 Ga0070684_1002535832 248
330 3300005535 Ga0070684_100402297 Ga0070684_1004022971 248
331 3300005539 Ga0068853_100004852 Ga0068853_1000048525 248
332 3300005539 Ga0068853_100045996 Ga0068853_1000459963 248
333 3300005539 Ga0068853_100087849 Ga0068853_1000878493 248
334 3300005539 Ga0068853_100517052 Ga0068853_1005170522 248
335 3300005539 Ga0068853_100555712 Ga0068853_1005557121 248
336 3300005543 Ga0070672_100124457 Ga0070672_1001244572 248
337 3300005544 Ga0070686_100290334 Ga0070686_1002903341 248
338 3300005547 Ga0070693_100047893 Ga0070693_1000478932 248
339 3300005548 Ga0070665_100000052 Ga0070665_10000005264 248
340 3300005563 Ga0068855_100000041 Ga0068855_100000041100 248
341 3300005563 Ga0068855_100111620 Ga0068855_1001116203 248
342 3300005563 Ga0068855_100140750 Ga0068855_1001407502 248
343 3300005564 Ga0070664_100010888 Ga0070664_1000108884 248
344 3300005564 Ga0070664_100011721 Ga0070664_1000117219 248
345 3300005564 Ga0070664_100047316 Ga0070664_1000473163 248
346 3300005564 Ga0070664_100100310 Ga0070664_1001003102 248
347 3300005564 Ga0070664_100380831 Ga0070664_1003808312 248
348 3300005578 Ga0068854_100077604 Ga0068854_1000776043 248
349 3300005578 Ga0068854_100077861 Ga0068854_1000778612 248
350 3300005614 Ga0068856_100000204 Ga0068856_10000020444 248
351 3300005614 Ga0068856_100044321 Ga0068856_1000443213 248
352 3300005615 Ga0070702_100081623 Ga0070702_1000816232 248
353 3300005616 Ga0068852_100005196 Ga0068852_1000051964 248
354 3300005616 Ga0068852_100048454 Ga0068852_1000484545 248
355 3300005616 Ga0068852_100071912 Ga0068852_1000719123 248
356 3300005616 Ga0068852_100149714 Ga0068852_1001497142 248
357 3300005617 Ga0068859_100000007 Ga0068859_100000007140 248
358 3300005617 Ga0068859_100007965 Ga0068859_1000079659 248
359 3300005617 Ga0068859_100010183 Ga0068859_1000101834 248
360 3300005618 Ga0068864_100006739 Ga0068864_1000067393 248
361 3300005618 Ga0068864_100019953 Ga0068864_1000199533 248
362 3300005618 Ga0068864_100051718 Ga0068864_1000517185 248
363 3300005719 Ga0068861_100276430 Ga0068861_1002764302 248
364 3300005719 Ga0068861_100276520 Ga0068861_1002765202 248
365 3300005841 Ga0068863_100013437 Ga0068863_1000134372 248
366 3300005841 Ga0068863_100243676 Ga0068863_1002436762 248
367 3300005841 Ga0068863_100281736 Ga0068863_1002817362 248
368 3300005841 Ga0068863_101086932 Ga0068863_1010869321 248
369 3300005842 Ga0068858_100004375 Ga0068858_1000043759 248
370 3300005842 Ga0068858_100028234 Ga0068858_1000282342 248
371 3300005842 Ga0068858_100567197 Ga0068858_1005671972 248
372 3300005843 Ga0068860_100000004 Ga0068860_100000004319 248
373 3300005843 Ga0068860_100001504 Ga0068860_10000150417 248
374 3300005843 Ga0068860_100006976 Ga0068860_1000069766 248
375 3300005843 Ga0068860_100009791 Ga0068860_1000097916 248
376 3300005843 Ga0068860_100021982 Ga0068860_1000219824 248
377 3300005843 Ga0068860_100053680 Ga0068860_1000536802 248
378 3300005844 Ga0068862_100165726 Ga0068862_1001657262 248
379 3300005983 Ga0081540_1008682 Ga0081540_10086822 248
380 3300006237 Ga0097621_100061528 Ga0097621_1000615281 248
381 3300006237 Ga0097621_100143073 Ga0097621_1001430732 248
382 3300006237 Ga0097621_100284257 Ga0097621_1002842571 248
383 3300006358 Ga0068871_100013793 Ga0068871_1000137935 248
384 3300006358 Ga0068871_100032752 Ga0068871_1000327522 248
385 3300006358 Ga0068871_100037552 Ga0068871_1000375522 248
386 3300006358 Ga0068871_100042670 Ga0068871_1000426705 248
387 3300006358 Ga0068871_100109512 Ga0068871_1001095122 248
388 3300006358 Ga0068871_100179060 Ga0068871_1001790603 248
389 3300006358 Ga0068871_100201182 Ga0068871_1002011822 248
390 3300006871 Ga0075434_100715952 Ga0075434_1007159521 248
391 3300006881 Ga0068865_100045392 Ga0068865_1000453922 248
392 3300006881 Ga0068865_100363701 Ga0068865_1003637012 248
393 3300006931 Ga0097620_100000007 Ga0097620_100000007141 248
394 3300006931 Ga0097620_100007965 Ga0097620_1000079659 248
395 3300006931 Ga0097620_100010184 Ga0097620_1000101847 248
396 3300009093 Ga0105240_10000061 Ga0105240_10000061150 248
397 3300009093 Ga0105240_10001967 Ga0105240_1000196719 248
398 3300009093 Ga0105240_10051059 Ga0105240_100510592 248
399 3300009093 Ga0105240_10064030 Ga0105240_100640302 248
400 3300009093 Ga0105240_10441528 Ga0105240_104415282 248
401 3300009101 Ga0105247_10033116 Ga0105247_100331162 248
402 3300009101 Ga0105247_10213782 Ga0105247_102137822 248
403 3300009174 Ga0105241_10000206 Ga0105241_1000020643 248
404 3300009174 Ga0105241_10000622 Ga0105241_1000062218 248
405 3300009174 Ga0105241_10003350 Ga0105241_100033508 248
406 3300009176 Ga0105242_10014851 Ga0105242_100148514 248
407 3300009176 Ga0105242_10046006 Ga0105242_100460063 248
408 3300009176 Ga0105242_10866673 Ga0105242_108666731 248
409 3300009177 Ga0105248_10860398 Ga0105248_108603982 248
410 3300009177 Ga0105248_11167562 Ga0105248_111675621 248
411 3300009545 Ga0105237_10001595 Ga0105237_1000159514 248
412 3300009545 Ga0105237_10002803 Ga0105237_100028034 248
413 3300009545 Ga0105237_10006073 Ga0105237_100060738 248
414 3300009545 Ga0105237_10017867 Ga0105237_100178673 248
415 3300009545 Ga0105237_10084161 Ga0105237_100841613 248
416 3300009545 Ga0105237_10200402 Ga0105237_102004022 248
417 3300009551 Ga0105238_10081376 Ga0105238_100813763 248
418 3300009551 Ga0105238_10174489 Ga0105238_101744892 248
419 3300009551 Ga0105238_10728824 Ga0105238_107288241 248
420 3300009553 Ga0105249_10009474 Ga0105249_100094743 248
421 3300009553 Ga0105249_10067153 Ga0105249_100671531 248
422 3300009553 Ga0105249_10601587 Ga0105249_106015872 248
423 3300009553 Ga0105249_11007363 Ga0105249_110073631 248
424 3300010375 Ga0105239_10000017 Ga0105239_10000017105 248
425 3300010375 Ga0105239_10000126 Ga0105239_1000012615 248
426 3300010375 Ga0105239_10000566 Ga0105239_1000056627 248
427 3300010375 Ga0105239_10000958 Ga0105239_1000095832 248
428 3300010375 Ga0105239_10002026 Ga0105239_1000202626 248
429 3300010375 Ga0105239_10273728 Ga0105239_102737283 248
430 3300011119 Ga0105246_10188980 Ga0105246_101889802 248
431 3300013100 Ga0157373_10046724 Ga0157373_100467243 248
432 3300013102 Ga0157371_10000548 Ga0157371_1000054840 248
433 3300013102 Ga0157371_10064165 Ga0157371_100641651 248
434 3300013102 Ga0157371_10162604 Ga0157371_101626041 248
435 3300013102 Ga0157371_10286653 Ga0157371_102866532 248
436 3300013104 Ga0157370_10000426 Ga0157370_1000042632 248
437 3300013104 Ga0157370_10050996 Ga0157370_100509963 248
438 3300013104 Ga0157370_10196276 Ga0157370_101962761 248
439 3300013105 Ga0157369_10013765 Ga0157369_100137653 248
440 3300013105 Ga0157369_10101052 Ga0157369_101010522 248
441 3300013105 Ga0157369_10192759 Ga0157369_101927591 248
442 3300013296 Ga0157374_10013422 Ga0157374_100134227 248
443 3300013296 Ga0157374_10031377 Ga0157374_100313772 248
444 3300013296 Ga0157374_10081757 Ga0157374_100817572 248
445 3300013296 Ga0157374_10134490 Ga0157374_101344904 248
446 3300013296 Ga0157374_10157323 Ga0157374_101573232 248
447 3300013297 Ga0157378_10001036 Ga0157378_1000103617 248
448 3300013297 Ga0157378_10009825 Ga0157378_100098254 248
449 3300013297 Ga0157378_10058008 Ga0157378_100580082 248
450 3300013297 Ga0157378_10059847 Ga0157378_100598472 248
451 3300013297 Ga0157378_10118781 Ga0157378_101187813 248
452 3300013297 Ga0157378_10247866 Ga0157378_102478662 248
453 3300013297 Ga0157378_10254136 Ga0157378_102541362 248
454 3300013306 Ga0163162_10000746 Ga0163162_100007464 248
455 3300013306 Ga0163162_10008000 Ga0163162_100080003 248
456 3300013306 Ga0163162_10028558 Ga0163162_100285584 248
457 3300013306 Ga0163162_10033319 Ga0163162_100333192 248
458 3300013306 Ga0163162_10061096 Ga0163162_100610962 248
459 3300013306 Ga0163162_10065099 Ga0163162_100650994 248
460 3300013306 Ga0163162_10070938 Ga0163162_100709382 248
461 3300013306 Ga0163162_10555151 Ga0163162_105551512 248
462 3300013307 Ga0157372_10001870 Ga0157372_1000187015 248
463 3300013307 Ga0157372_10102911 Ga0157372_101029112 248
464 3300013307 Ga0157372_10127330 Ga0157372_101273302 248
465 3300013307 Ga0157372_10137662 Ga0157372_101376622 248
466 3300013307 Ga0157372_10182637 Ga0157372_101826373 248
467 3300013307 Ga0157372_10352840 Ga0157372_103528402 248
468 3300013308 Ga0157375_10015416 Ga0157375_100154163 248
469 3300013308 Ga0157375_10017332 Ga0157375_100173327 248
470 3300013308 Ga0157375_10075094 Ga0157375_100750942 248
471 3300013308 Ga0157375_10159592 Ga0157375_101595922 248
472 3300013308 Ga0157375_10531535 Ga0157375_105315351 248
473 3300014325 Ga0163163_10022878 Ga0163163_100228782 248
474 3300014325 Ga0163163_10028496 Ga0163163_100284967 248
475 3300014325 Ga0163163_10039355 Ga0163163_100393552 248
476 3300014325 Ga0163163_10808033 Ga0163163_108080331 248
477 3300014326 Ga0157380_10508528 Ga0157380_105085282 248
478 3300014745 Ga0157377_10062341 Ga0157377_100623413 248
479 3300014968 Ga0157379_10098454 Ga0157379_100984542 248
480 3300014968 Ga0157379_10176329 Ga0157379_101763292 248
481 3300014969 Ga0157376_10002389 Ga0157376_100023894 248
482 3300014969 Ga0157376_10048874 Ga0157376_100488743 248
483 3300014969 Ga0157376_10145558 Ga0157376_101455582 248
484 3300014969 Ga0157376_10168006 Ga0157376_101680062 248
485 3300014969 Ga0157376_10243315 Ga0157376_102433152 248
486 3300017792 Ga0163161_10139421 Ga0163161_101394212 248
487 3300017792 Ga0163161_10472952 Ga0163161_104729522 248
488 3300025230 Ga0209563_106089 Ga0209563_1060893 248
489 3300025231 Ga0207427_100138 Ga0207427_10013818 248
490 3300025233 Ga0209437_100010 Ga0209437_10001083 248
491 3300025261 Ga0209233_1000017 Ga0209233_100001796 248
492 3300025297 Ga0209758_1009028 Ga0209758_10090283 248
493 3300025302 Ga0207426_1000060 Ga0207426_1000060175 248
494 3300025302 Ga0207426_1000157 Ga0207426_1000157125 248
495 3300025900 Ga0207710_10090245 Ga0207710_100902452 248
496 3300025903 Ga0207680_10001183 Ga0207680_100011834 248
497 3300025903 Ga0207680_10015875 Ga0207680_100158752 248
498 3300025903 Ga0207680_10016256 Ga0207680_100162562 248
499 3300025904 Ga0207647_10052617 Ga0207647_100526172 248
500 3300025904 Ga0207647_10168329 Ga0207647_101683292 248
501 3300025904 Ga0207647_10172270 Ga0207647_101722702 248
502 3300025907 Ga0207645_10021368 Ga0207645_100213683 248
503 3300025911 Ga0207654_10004110 Ga0207654_100041106 248
504 3300025911 Ga0207654_10010271 Ga0207654_100102715 248
505 3300025912 Ga0207707_10000111 Ga0207707_1000011132 248
506 3300025912 Ga0207707_10092681 Ga0207707_100926812 248
507 3300025912 Ga0207707_10108977 Ga0207707_101089772 248
508 3300025913 Ga0207695_10000057 Ga0207695_10000057252 248
509 3300025913 Ga0207695_10000068 Ga0207695_10000068153 248
510 3300025913 Ga0207695_10022478 Ga0207695_100224784 248
511 3300025913 Ga0207695_10050172 Ga0207695_100501722 248
512 3300025914 Ga0207671_10001648 Ga0207671_1000164817 248
513 3300025914 Ga0207671_10007231 Ga0207671_100072317 248
514 3300025914 Ga0207671_10020022 Ga0207671_100200226 248
515 3300025914 Ga0207671_10032780 Ga0207671_100327802 248
516 3300025917 Ga0207660_10021100 Ga0207660_100211002 248
517 3300025917 Ga0207660_10054559 Ga0207660_100545592 248
518 3300025919 Ga0207657_10014655 Ga0207657_100146553 248
519 3300025920 Ga0207649_10047637 Ga0207649_100476372 248
520 3300025920 Ga0207649_10052351 Ga0207649_100523512 248
521 3300025921 Ga0207652_10000538 Ga0207652_1000053839 248
522 3300025921 Ga0207652_10053384 Ga0207652_100533842 248
523 3300025923 Ga0207681_10079696 Ga0207681_100796963 248
524 3300025924 Ga0207694_10142483 Ga0207694_101424832 248
525 3300025924 Ga0207694_10461784 Ga0207694_104617842 248
526 3300025925 Ga0207650_10101974 Ga0207650_101019743 248
527 3300025925 Ga0207650_10269473 Ga0207650_102694732 248
528 3300025926 Ga0207659_10116136 Ga0207659_101161362 248
529 3300025926 Ga0207659_10461968 Ga0207659_104619682 248
530 3300025931 Ga0207644_10079906 Ga0207644_100799062 248
531 3300025931 Ga0207644_10215029 Ga0207644_102150292 248
532 3300025932 Ga0207690_10019756 Ga0207690_100197562 248
533 3300025933 Ga0207706_10008179 Ga0207706_100081794 248
534 3300025933 Ga0207706_10020230 Ga0207706_100202303 248
535 3300025933 Ga0207706_10035883 Ga0207706_100358835 248
536 3300025933 Ga0207706_10075732 Ga0207706_100757323 248
537 3300025933 Ga0207706_10084043 Ga0207706_100840432 248
538 3300025936 Ga0207670_10056219 Ga0207670_100562191 248
539 3300025936 Ga0207670_10181717 Ga0207670_101817172 248
540 3300025940 Ga0207691_10114579 Ga0207691_101145792 248
541 3300025940 Ga0207691_10153153 Ga0207691_101531532 248
542 3300025942 Ga0207689_10003450 Ga0207689_100034505 248
543 3300025942 Ga0207689_10039074 Ga0207689_100390745 248
544 3300025942 Ga0207689_10435380 Ga0207689_104353802 248
545 3300025944 Ga0207661_10031975 Ga0207661_100319753 248
546 3300025944 Ga0207661_10042051 Ga0207661_100420513 248
547 3300025944 Ga0207661_10115041 Ga0207661_101150412 248
548 3300025945 Ga0207679_10043751 Ga0207679_100437513 248
549 3300025945 Ga0207679_10052795 Ga0207679_100527952 248
550 3300025945 Ga0207679_10075204 Ga0207679_100752043 248
551 3300025945 Ga0207679_10106918 Ga0207679_101069182 248
552 3300025949 Ga0207667_10000621 Ga0207667_1000062147 248
553 3300025949 Ga0207667_10116475 Ga0207667_101164752 248
554 3300025949 Ga0207667_10176490 Ga0207667_101764902 248
555 3300025960 Ga0207651_10205130 Ga0207651_102051302 248
556 3300025960 Ga0207651_10231544 Ga0207651_102315441 248
557 3300025960 Ga0207651_10267760 Ga0207651_102677602 248
558 3300025960 Ga0207651_10269722 Ga0207651_102697222 248
559 3300025960 Ga0207651_10297305 Ga0207651_102973052 248
560 3300025960 Ga0207651_10401578 Ga0207651_104015782 248
561 3300025961 Ga0207712_10025016 Ga0207712_100250165 248
562 3300025961 Ga0207712_10161561 Ga0207712_101615612 248
563 3300025961 Ga0207712_10793936 Ga0207712_107939361 248
564 3300025972 Ga0207668_10858205 Ga0207668_108582051 248
565 3300025981 Ga0207640_10062216 Ga0207640_100622162 248
566 3300025981 Ga0207640_10075009 Ga0207640_100750092 248
567 3300025981 Ga0207640_10192486 Ga0207640_101924862 248
568 3300025986 Ga0207658_10019797 Ga0207658_100197975 248
569 3300025986 Ga0207658_10043198 Ga0207658_100431984 248
570 3300025986 Ga0207658_10448883 Ga0207658_104488832 248
571 3300026023 Ga0207677_10298680 Ga0207677_102986802 248
572 3300026035 Ga0207703_10000798 Ga0207703_1000079817 248
573 3300026035 Ga0207703_10049018 Ga0207703_100490182 248
574 3300026035 Ga0207703_10354522 Ga0207703_103545222 248
575 3300026041 Ga0207639_10039989 Ga0207639_100399892 248
576 3300026041 Ga0207639_10427714 Ga0207639_104277142 248
577 3300026067 Ga0207678_10137935 Ga0207678_101379353 248
578 3300026078 Ga0207702_10002255 Ga0207702_100022557 248
579 3300026078 Ga0207702_10042062 Ga0207702_100420622 248
580 3300026088 Ga0207641_10000056 Ga0207641_10000056131 248
581 3300026088 Ga0207641_10269272 Ga0207641_102692722 248
582 3300026088 Ga0207641_10351457 Ga0207641_103514571 248
583 3300026088 Ga0207641_10717655 Ga0207641_107176551 248
584 3300026089 Ga0207648_10171436 Ga0207648_101714362 248
585 3300026089 Ga0207648_10222522 Ga0207648_102225221 248
586 3300026089 Ga0207648_10275919 Ga0207648_102759191 248
587 3300026089 Ga0207648_10432231 Ga0207648_104322312 248
588 3300026095 Ga0207676_10005956 Ga0207676_100059567 248
589 3300026095 Ga0207676_10055592 Ga0207676_100555922 248
590 3300026095 Ga0207676_10077417 Ga0207676_100774173 248
591 3300026095 Ga0207676_10264741 Ga0207676_102647412 248
592 3300026116 Ga0207674_10017345 Ga0207674_100173458 248
593 3300026118 Ga0207675_100146973 Ga0207675_1001469732 248
594 3300026118 Ga0207675_100474663 Ga0207675_1004746632 248
595 3300026121 Ga0207683_10339664 Ga0207683_103396642 248
596 3300026142 Ga0207698_10034662 Ga0207698_100346623 248
597 3300026142 Ga0207698_10076314 Ga0207698_100763142 248
598 3300026142 Ga0207698_10201475 Ga0207698_102014752 248
599 3300026142 Ga0207698_10972432 Ga0207698_109724321 248
600 3300028379 Ga0268266_10000070 Ga0268266_10000070117 248
601 3300028380 Ga0268265_10299066 Ga0268265_102990662 248
602 3300028381 Ga0268264_10000011 Ga0268264_1000001147 248
603 3300028381 Ga0268264_10002267 Ga0268264_100022676 248
604 3300028381 Ga0268264_10002602 Ga0268264_100026025 248
605 3300028381 Ga0268264_10018085 Ga0268264_100180856 248
606 3300028381 Ga0268264_10032902 Ga0268264_100329022 248
607 3300028654 Ga0265322_10034698 Ga0265322_100346981 248
608 3300028786 Ga0307517_10002276 Ga0307517_100022766 248
609 3300028794 Ga0307515_10000078 Ga0307515_10000078111 248
610 3300030521 Ga0307511_10000304 Ga0307511_1000030414 248
611 3300031507 Ga0307509_10090538 Ga0307509_100905384 248
612 3300031507 Ga0307509_10141944 Ga0307509_101419441 248
613 3300033180 Ga0307510_10000062 Ga0307510_1000006244 248
614 3300035170 Ga0373943_0147067 Ga0373943_0147067_234_989 248
615 3300035725 Ga0373947_0119761 Ga0373947_0119761_669_1415 248
616 3300037312 Ga0395899_0000002 Ga0395899_0000002_776340_777101 248
617 3300037312 Ga0395899_0013384 Ga0395899_0013384_4849_5601 248
618 3300037418 Ga0395900_0036349 Ga0395900_0036349_786_1538 248
619 3300037418 Ga0395900_0169747 Ga0395900_0169747_634_1386 248
620 3300037466 Ga0395898_0045550 Ga0395898_0045550_1537_2289 248
621 3300037471 Ga0395905_0324575 Ga0395905_0324575_292_1044 248
622 3300038443 Ga0395901_0361168 Ga0395901_0361168_454_1206 248
623 3300044658 Ga0466972_0000014 Ga0466972_0000014_201836_202585 248
624 3300044683 Ga0466965_0044649 Ga0466965_0044649_710_1459 248
625 3300044684 Ga0466966_0132644 Ga0466966_0132644_403_1164 248
626 3300044693 Ga0466961_0045509 Ga0466961_0045509_466_1269 248
627 3300044765 Ga0466970_0002409 Ga0466970_0002409_4403_5152 248
628 3300045049 Ga0466959_0026914 Ga0466959_0026914_474_1277 248
629 3300046459 Ga0495629_0172216 Ga0495629_0172216_523_1278 248
630 3300046473 Ga0495582_0077330 Ga0495582_0077330_79_834 248
631 3300046648 Ga0495611_0000150 Ga0495611_0000150_12708_13508 248
632 3300046648 Ga0495611_0048018 Ga0495611_0048018_423_1172 248
633 3300046663 Ga0495635_0143276 Ga0495635_0143276_780_1535 248
634 3300046683 Ga0495658_0025365 Ga0495658_0025365_141_896 248
635 3300047319 Ga0495674_0081733 Ga0495674_0081733_1561_2316 248
636 3300047320 Ga0495672_0046727 Ga0495672_0046727_1091_1840 248
637 3300047321 Ga0495676_0197922 Ga0495676_0197922_256_1011 248
638 3300047471 Ga0495684_0155414 Ga0495684_0155414_339_1094 248
639 3300047472 Ga0495686_0000078 Ga0495686_0000078_73232_74023 248
640 3300048913 Ga0496110_0118808 Ga0496110_0118808_1296_2042 248
641 3300048914 Ga0496111_0118855 Ga0496111_0118855_1009_1755 248
642 3300048915 Ga0496112_0213058 Ga0496112_0213058_763_1509 248
643 3300049571 Ga0501034_0165896 Ga0501034_0165896_1243_2088 248
644 3300049573 Ga0501037_0459996 Ga0501037_0459996_57_809 248
645 3300049580 Ga0501046_0292587 Ga0501046_0292587_23_868 248
646 3300049581 Ga0501047_0350061 Ga0501047_0350061_169_1014 248
647 3300049582 Ga0501048_0215029 Ga0501048_0215029_206_1051 248
648 3300049584 Ga0501068_0282913 Ga0501068_0282913_70_915 248
649 3300049585 Ga0501069_0018441 Ga0501069_0018441_318_1163 248
650 3300049589 Ga0501073_0014748 Ga0501073_0014748_1082_1927 248
651 3300049744 Ga0501083_0012904 Ga0501083_0012904_3419_4264 248
652 3300049823 Ga0501044_0240296 Ga0501044_0240296_853_1698 248
653 3300050512 nmdc:mga0n895_663492_c1 nmdc:mga0n895_663492_c1_230_979 248
654 3300053178 Ga0500637_0046561 Ga0500637_0046561_309_1058 248
655 3300060353 Ga0501082_0373692 Ga0501082_0373692_59_904 248
656 3300061719 Ga0466962_0033092 Ga0466962_0033092_584_1387 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

40

233

0.89

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

78

272

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.7665 11 243
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.7591 11 243
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.7493 11 243
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.7367 56 242
7znq-assembly1.cif.gz_y abc transporter complex nosdfyl in gdn 0.728 11 244
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7961 53 244 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7887 52 243 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.736 53 241 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6245 53 244 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6189 52 243 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A839MFU6-F1-model_v4 deleted 0.994 4 248
AF-A0A839MFU6-F1-model_v4 deleted 0.9859 4 248
AF-A0A317IFH4-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9801 1 151 GO:0016020
GO:0140359
AF-A0A7W1NNY1-F1-model_v4 ABC transporter permease 0.9722 1 248 GO:0016020
GO:0140359
AF-A0A7W1NNY1-F1-model_v4 ABC transporter permease 0.9684 1 248 GO:0016020
GO:0140359

Feature Viewer

pLDDT pTM Quality
86.28 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map