F472989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 247 | 649 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100000075|Ga0070680_10000007532 |
| Length | 282 |
| Sequence | MQANMSSATDALSEKPATLAGRDESSGQMTGYTVIPSTGTVLSSLLRADLTTQWRNRKSFMLILIVPVIILISWKGLIDKLGSAFVLGNCITIGLIAIGLMGYSNSVARDRDKGIFQRLRVAPLSAWSIMMSRLAVQLLMIVLMTTAVYIAGFYFDKIALSPGSYVMGYVAALVGGAVYLGLGQMIVGLIKNAETVHSTSRLVYFIFIMVGMFGELGILGQQIGTLVQWSPYGTVKHILASSAHPGTWNISATKALLVTIGYAFVFAVLGIKWFKWSGGEKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 4 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 5 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 6 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 7 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 8 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 241 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 243 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 247 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.63 |
| Metatranscriptomes | 0.15 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.1 |
| Nodule | 0 |
| Rhizoplane | 1.07 |
| Rhizosphere | 87.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2063463 | 2162886011 | Bacteria | 1413 |
| 2 | JGI24740J21852_10002328 | 3300001979 | Bacteria | 8646 |
| 3 | JGI24743J22301_10009620 | 3300001991 | Bacteria | 1715 |
| 4 | JGI24744J21845_10019369 | 3300002077 | Bacteria | 1346 |
| 5 | JGI25162J39368_1000688 | 3300002737 | Bacteria | 23552 |
| 6 | JGI25154J39366_1000044 | 3300002738 | Bacteria | 136516 |
| 7 | JGI25164J39214_1001043 | 3300002772 | Bacteria | 8334 |
| 8 | JGI25165J46597_1003733 | 3300003214 | Bacteria | 3608 |
| 9 | JGI25153J46596_10003613 | 3300003215 | Bacteria | 8583 |
| 10 | rootH1_10104481 | 3300003316 | Unclassified | 1193 |
| 11 | rootH2_10001414 | 3300003320 | Bacteria | 59840 |
| 12 | rootH2_10002197 | 3300003320 | Bacteria | 14946 |
| 13 | rootH2_10013265 | 3300003320 | Bacteria | 8575 |
| 14 | rootH2_10187887 | 3300003320 | Bacteria | 1369 |
| 15 | rootH2_10191691 | 3300003320 | Bacteria | 4517 |
| 16 | rootH2_10230854 | 3300003320 | Bacteria | 2299 |
| 17 | rootL2_10196379 | 3300003322 | Bacteria | 1234 |
| 18 | rootL2_10222192 | 3300003322 | Bacteria | 3578 |
| 19 | rootL2_10300232 | 3300003322 | Unclassified | 2875 |
| 20 | rootH1_10001276 | 3300003316 | Bacteria | 3262 |
| 21 | rootH1_10001276 | 3300003323 | Bacteria | 38627 |
| 22 | rootH1_10018525 | 3300003323 | Bacteria | 11066 |
| 23 | rootH1_10052168 | 3300003323 | Bacteria | 4762 |
| 24 | rootH1_10097619 | 3300003323 | Bacteria | 3557 |
| 25 | rootH1_10112358 | 3300003323 | Bacteria | 11821 |
| 26 | rootH1_10154623 | 3300003323 | Bacteria | 1880 |
| 27 | rootH1_10338497 | 3300003323 | Bacteria | 1470 |
| 28 | rootH1_10365013 | 3300003323 | Bacteria | 1092 |
| 29 | JGI25160J50197_1002488 | 3300003354 | Bacteria | 8560 |
| 30 | JGI25160J50197_1004606 | 3300003354 | Bacteria | 5933 |
| 31 | JGI25160J50197_1005692 | 3300003354 | Bacteria | 5149 |
| 32 | Ga0055526_1010370 | 3300003771 | Bacteria | 4346 |
| 33 | Ga0055526_1032649 | 3300003771 | Bacteria | 1464 |
| 34 | Ga0055528_1000572 | 3300003790 | Bacteria | 27859 |
| 35 | Ga0055530_10000789 | 3300003791 | Bacteria | 26378 |
| 36 | Ga0058863_11690196 | 3300004799 | Bacteria | 1184 |
| 37 | Ga0065165_1000017 | 3300005262 | Bacteria | 278286 |
| 38 | Ga0065165_1019675 | 3300005262 | Bacteria | 2400 |
| 39 | Ga0065712_10323773 | 3300005290 | Unclassified | 824 |
| 40 | Ga0065715_10154051 | 3300005293 | Unclassified | 1684 |
| 41 | Ga0070658_10030999 | 3300005327 | Bacteria | 4294 |
| 42 | Ga0070658_10077787 | 3300005327 | Bacteria | 2722 |
| 43 | Ga0070676_10029614 | 3300005328 | Bacteria | 3115 |
| 44 | Ga0070683_100011222 | 3300005329 | Bacteria | 7730 |
| 45 | Ga0070683_100026642 | 3300005329 | Bacteria | 5208 |
| 46 | Ga0070683_100093238 | 3300005329 | Bacteria | 2829 |
| 47 | Ga0070690_100040887 | 3300005330 | Bacteria | 2934 |
| 48 | Ga0070690_100079612 | 3300005330 | Unclassified | 2142 |
| 49 | Ga0070670_100073904 | 3300005331 | Bacteria | 2928 |
| 50 | Ga0070670_100261710 | 3300005331 | Bacteria | 1508 |
| 51 | Ga0068869_100004728 | 3300005334 | Bacteria | 8495 |
| 52 | Ga0070666_10000101 | 3300005335 | Bacteria | 58900 |
| 53 | Ga0070666_10015846 | 3300005335 | Bacteria | 4815 |
| 54 | Ga0070666_10043983 | 3300005335 | Bacteria | 2991 |
| 55 | Ga0070666_10053096 | 3300005335 | Bacteria | 2733 |
| 56 | Ga0070666_10117578 | 3300005335 | Bacteria | 1841 |
| 57 | Ga0070680_100000075 | 3300005336 | Bacteria | 53328 |
| 58 | Ga0070680_100049001 | 3300005336 | Unclassified | 3443 |
| 59 | Ga0070682_100000008 | 3300005337 | Bacteria | 322125 |
| 60 | Ga0070682_100000628 | 3300005337 | Bacteria | 21473 |
| 61 | Ga0070682_100025853 | 3300005337 | Bacteria | 3508 |
| 62 | Ga0070682_100083516 | 3300005337 | Unclassified | 2073 |
| 63 | Ga0068868_100000543 | 3300005338 | Bacteria | 25349 |
| 64 | Ga0068868_100002455 | 3300005338 | Bacteria | 12866 |
| 65 | Ga0068868_100041244 | 3300005338 | Bacteria | 3596 |
| 66 | Ga0068868_100051895 | 3300005338 | Bacteria | 3228 |
| 67 | Ga0068868_100053733 | 3300005338 | Bacteria | 3173 |
| 68 | Ga0068868_100139933 | 3300005338 | Bacteria | 1986 |
| 69 | Ga0068868_100180587 | 3300005338 | Unclassified | 1751 |
| 70 | Ga0068868_100232424 | 3300005338 | Bacteria | 1547 |
| 71 | Ga0068868_100373728 | 3300005338 | Unclassified | 1225 |
| 72 | Ga0068868_100426069 | 3300005338 | Bacteria | 1150 |
| 73 | Ga0068868_100673307 | 3300005338 | Bacteria | 923 |
| 74 | Ga0070660_100007461 | 3300005339 | Bacteria | 7622 |
| 75 | Ga0070689_100009325 | 3300005340 | Bacteria | 6957 |
| 76 | Ga0070689_100022142 | 3300005340 | Bacteria | 4743 |
| 77 | Ga0070689_100558088 | 3300005340 | Bacteria | 987 |
| 78 | Ga0070691_10000522 | 3300005341 | Bacteria | 14488 |
| 79 | Ga0070691_10002772 | 3300005341 | Bacteria | 7816 |
| 80 | Ga0070661_100011271 | 3300005344 | Bacteria | 6228 |
| 81 | Ga0070661_100019628 | 3300005344 | Bacteria | 4816 |
| 82 | Ga0070661_100334427 | 3300005344 | Bacteria | 1185 |
| 83 | Ga0070668_100139122 | 3300005347 | Bacteria | 1955 |
| 84 | Ga0070668_100179030 | 3300005347 | Bacteria | 1731 |
| 85 | Ga0070669_100027806 | 3300005353 | Unclassified | 4071 |
| 86 | Ga0070675_100047970 | 3300005354 | Bacteria | 3501 |
| 87 | Ga0070675_100077145 | 3300005354 | Bacteria | 2773 |
| 88 | Ga0070671_100005460 | 3300005355 | Bacteria | 10149 |
| 89 | Ga0070671_100030079 | 3300005355 | Bacteria | 4481 |
| 90 | Ga0070671_100049820 | 3300005355 | Bacteria | 3485 |
| 91 | Ga0070671_100090307 | 3300005355 | Bacteria | 2564 |
| 92 | Ga0070671_100144949 | 3300005355 | Unclassified | 2004 |
| 93 | Ga0070671_100190123 | 3300005355 | Unclassified | 1740 |
| 94 | Ga0070671_100601032 | 3300005355 | Bacteria | 951 |
| 95 | Ga0070673_100030800 | 3300005364 | Bacteria | 4021 |
| 96 | Ga0070673_100043944 | 3300005364 | Bacteria | 3457 |
| 97 | Ga0070673_100089533 | 3300005364 | Unclassified | 2512 |
| 98 | Ga0070673_100505524 | 3300005364 | Bacteria | 1093 |
| 99 | Ga0070688_100005011 | 3300005365 | Bacteria | 6938 |
| 100 | Ga0070688_100010942 | 3300005365 | Bacteria | 5025 |
| 101 | Ga0070688_100078898 | 3300005365 | Bacteria | 2125 |
| 102 | Ga0070659_100026039 | 3300005366 | Bacteria | 4499 |
| 103 | Ga0070659_100151898 | 3300005366 | Bacteria | 1889 |
| 104 | Ga0070667_100021007 | 3300005367 | Bacteria | 5424 |
| 105 | Ga0070667_100060561 | 3300005367 | Bacteria | 3203 |
| 106 | Ga0070667_100108083 | 3300005367 | Bacteria | 2409 |
| 107 | Ga0070667_100245685 | 3300005367 | Bacteria | 1599 |
| 108 | Ga0070663_100223193 | 3300005455 | Bacteria | 1480 |
| 109 | Ga0070678_100098259 | 3300005456 | Bacteria | 2263 |
| 110 | Ga0070662_100038027 | 3300005457 | Bacteria | 3416 |
| 111 | Ga0070662_100073798 | 3300005457 | Bacteria | 2522 |
| 112 | Ga0070662_100079156 | 3300005457 | Bacteria | 2443 |
| 113 | Ga0070662_100097015 | 3300005457 | Bacteria | 2224 |
| 114 | Ga0070662_100146349 | 3300005457 | Unclassified | 1835 |
| 115 | Ga0070681_10458403 | 3300005458 | Bacteria | 1187 |
| 116 | Ga0068867_100015760 | 3300005459 | Bacteria | 5364 |
| 117 | Ga0068867_100079740 | 3300005459 | Unclassified | 2464 |
| 118 | Ga0068867_100476132 | 3300005459 | Bacteria | 1069 |
| 119 | Ga0068867_100629143 | 3300005459 | Bacteria | 939 |
| 120 | Ga0070685_10205011 | 3300005466 | Bacteria | 1284 |
| 121 | Ga0070679_100000892 | 3300005530 | Bacteria | 25923 |
| 122 | Ga0070679_100051407 | 3300005530 | Bacteria | 4105 |
| 123 | Ga0070679_100117894 | 3300005530 | Bacteria | 2639 |
| 124 | Ga0070679_100128370 | 3300005530 | Bacteria | 2517 |
| 125 | Ga0070679_100189896 | 3300005530 | Bacteria | 2024 |
| 126 | Ga0070679_100586346 | 3300005530 | Bacteria | 1058 |
| 127 | Ga0070684_100022795 | 3300005535 | Bacteria | 5228 |
| 128 | Ga0070684_100028964 | 3300005535 | Bacteria | 4689 |
| 129 | Ga0070684_100070959 | 3300005535 | Bacteria | 3066 |
| 130 | Ga0070684_100253583 | 3300005535 | Bacteria | 1608 |
| 131 | Ga0070684_100402297 | 3300005535 | Bacteria | 1262 |
| 132 | Ga0068853_100001368 | 3300005539 | Bacteria | 17591 |
| 133 | Ga0068853_100004852 | 3300005539 | Bacteria | 10451 |
| 134 | Ga0068853_100045996 | 3300005539 | Unclassified | 3741 |
| 135 | Ga0068853_100087849 | 3300005539 | Bacteria | 2728 |
| 136 | Ga0068853_100517052 | 3300005539 | Unclassified | 1128 |
| 137 | Ga0068853_100555712 | 3300005539 | Unclassified | 1088 |
| 138 | Ga0070672_100124457 | 3300005543 | Bacteria | 2113 |
| 139 | Ga0070672_100600668 | 3300005543 | Bacteria | 958 |
| 140 | Ga0070686_100290334 | 3300005544 | Bacteria | 1209 |
| 141 | Ga0070693_100047893 | 3300005547 | Bacteria | 2433 |
| 142 | Ga0070665_100000052 | 3300005548 | Bacteria | 245694 |
| 143 | Ga0068855_100000041 | 3300005563 | Bacteria | 151653 |
| 144 | Ga0068855_100077427 | 3300005563 | Bacteria | 3859 |
| 145 | Ga0068855_100111620 | 3300005563 | Bacteria | 3138 |
| 146 | Ga0068855_100140750 | 3300005563 | Unclassified | 2751 |
| 147 | Ga0068855_100244936 | 3300005563 | Bacteria | 2001 |
| 148 | Ga0068855_100306734 | 3300005563 | Unclassified | 1757 |
| 149 | Ga0070664_100010888 | 3300005564 | Bacteria | 7376 |
| 150 | Ga0070664_100011721 | 3300005564 | Bacteria | 7116 |
| 151 | Ga0070664_100047316 | 3300005564 | Bacteria | 3633 |
| 152 | Ga0070664_100100310 | 3300005564 | Unclassified | 2517 |
| 153 | Ga0070664_100380831 | 3300005564 | Bacteria | 1288 |
| 154 | Ga0068857_100429115 | 3300005577 | Bacteria | 1233 |
| 155 | Ga0068857_100505751 | 3300005577 | Bacteria | 1134 |
| 156 | Ga0068854_100019070 | 3300005578 | Bacteria | 4616 |
| 157 | Ga0068854_100077604 | 3300005578 | Unclassified | 2445 |
| 158 | Ga0068854_100077861 | 3300005578 | Bacteria | 2441 |
| 159 | Ga0068856_100000204 | 3300005614 | Bacteria | 63335 |
| 160 | Ga0068856_100014177 | 3300005614 | Bacteria | 7705 |
| 161 | Ga0068856_100021104 | 3300005614 | Bacteria | 6330 |
| 162 | Ga0068856_100044321 | 3300005614 | Bacteria | 4377 |
| 163 | Ga0068856_100055918 | 3300005614 | Bacteria | 3894 |
| 164 | Ga0070702_100081623 | 3300005615 | Unclassified | 1938 |
| 165 | Ga0068852_100005196 | 3300005616 | Bacteria | 9282 |
| 166 | Ga0068852_100048454 | 3300005616 | Bacteria | 3630 |
| 167 | Ga0068852_100071912 | 3300005616 | Bacteria | 3038 |
| 168 | Ga0068852_100149714 | 3300005616 | Bacteria | 2169 |
| 169 | Ga0068852_100250059 | 3300005616 | Unclassified | 1698 |
| 170 | Ga0068852_100251949 | 3300005616 | Unclassified | 1692 |
| 171 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 172 | Ga0068859_100007965 | 3300005617 | Bacteria | 10750 |
| 173 | Ga0068859_100010183 | 3300005617 | Bacteria | 9465 |
| 174 | Ga0068864_100006739 | 3300005618 | Bacteria | 9407 |
| 175 | Ga0068864_100019953 | 3300005618 | Bacteria | 5604 |
| 176 | Ga0068864_100051718 | 3300005618 | Bacteria | 3539 |
| 177 | Ga0068864_100501788 | 3300005618 | Unclassified | 1167 |
| 178 | Ga0068866_10499861 | 3300005718 | Bacteria | 804 |
| 179 | Ga0068861_100046054 | 3300005719 | Bacteria | 3287 |
| 180 | Ga0068861_100276430 | 3300005719 | Unclassified | 1444 |
| 181 | Ga0068861_100276520 | 3300005719 | Bacteria | 1444 |
| 182 | Ga0068851_10059600 | 3300005834 | Unclassified | 1953 |
| 183 | Ga0068863_100013437 | 3300005841 | Bacteria | 7895 |
| 184 | Ga0068863_100065602 | 3300005841 | Bacteria | 3435 |
| 185 | Ga0068863_100091159 | 3300005841 | Bacteria | 2890 |
| 186 | Ga0068863_100243676 | 3300005841 | Bacteria | 1735 |
| 187 | Ga0068863_100281736 | 3300005841 | Bacteria | 1610 |
| 188 | Ga0068863_101086932 | 3300005841 | Bacteria | 804 |
| 189 | Ga0068858_100004375 | 3300005842 | Bacteria | 13862 |
| 190 | Ga0068858_100028234 | 3300005842 | Bacteria | 5213 |
| 191 | Ga0068858_100321674 | 3300005842 | Unclassified | 1478 |
| 192 | Ga0068858_100567197 | 3300005842 | Bacteria | 1099 |
| 193 | Ga0068860_100000004 | 3300005843 | Bacteria | 506126 |
| 194 | Ga0068860_100001504 | 3300005843 | Bacteria | 25146 |
| 195 | Ga0068860_100006976 | 3300005843 | Bacteria | 11319 |
| 196 | Ga0068860_100009791 | 3300005843 | Bacteria | 9513 |
| 197 | Ga0068860_100021982 | 3300005843 | Bacteria | 6174 |
| 198 | Ga0068860_100053680 | 3300005843 | Bacteria | 3831 |
| 199 | Ga0068860_100072581 | 3300005843 | Bacteria | 3271 |
| 200 | Ga0068860_100125138 | 3300005843 | Bacteria | 2464 |
| 201 | Ga0068862_100165726 | 3300005844 | Bacteria | 1975 |
| 202 | Ga0068862_100179448 | 3300005844 | Unclassified | 1899 |
| 203 | Ga0081540_1008682 | 3300005983 | Bacteria | 7076 |
| 204 | Ga0070715_10326361 | 3300006163 | Unclassified | 830 |
| 205 | Ga0097621_100000606 | 3300006237 | Bacteria | 25267 |
| 206 | Ga0097621_100006155 | 3300006237 | Bacteria | 8501 |
| 207 | Ga0097621_100061528 | 3300006237 | Bacteria | 3079 |
| 208 | Ga0097621_100143073 | 3300006237 | Bacteria | 2045 |
| 209 | Ga0097621_100284257 | 3300006237 | Bacteria | 1457 |
| 210 | Ga0068871_100000334 | 3300006358 | Bacteria | 32598 |
| 211 | Ga0068871_100013793 | 3300006358 | Bacteria | 6007 |
| 212 | Ga0068871_100032752 | 3300006358 | Unclassified | 4109 |
| 213 | Ga0068871_100037552 | 3300006358 | Bacteria | 3864 |
| 214 | Ga0068871_100042670 | 3300006358 | Bacteria | 3643 |
| 215 | Ga0068871_100075370 | 3300006358 | Unclassified | 2785 |
| 216 | Ga0068871_100109512 | 3300006358 | Bacteria | 2322 |
| 217 | Ga0068871_100179060 | 3300006358 | Bacteria | 1821 |
| 218 | Ga0068871_100201182 | 3300006358 | Bacteria | 1720 |
| 219 | Ga0068871_100330850 | 3300006358 | Unclassified | 1343 |
| 220 | Ga0075434_100715952 | 3300006871 | Bacteria | 1018 |
| 221 | Ga0068865_100045392 | 3300006881 | Bacteria | 3012 |
| 222 | Ga0068865_100363701 | 3300006881 | Unclassified | 1176 |
| 223 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 224 | Ga0097620_100007965 | 3300006931 | Bacteria | 10750 |
| 225 | Ga0097620_100010184 | 3300006931 | Bacteria | 9465 |
| 226 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 227 | Ga0105240_10000061 | 3300009093 | Bacteria | 218897 |
| 228 | Ga0105240_10001967 | 3300009093 | Bacteria | 33956 |
| 229 | Ga0105240_10002002 | 3300009093 | Bacteria | 33613 |
| 230 | Ga0105240_10012550 | 3300009093 | Bacteria | 11689 |
| 231 | Ga0105240_10051059 | 3300009093 | Bacteria | 5207 |
| 232 | Ga0105240_10064030 | 3300009093 | Bacteria | 4570 |
| 233 | Ga0105240_10167551 | 3300009093 | Bacteria | 2604 |
| 234 | Ga0105240_10384828 | 3300009093 | Bacteria | 1583 |
| 235 | Ga0105240_10411375 | 3300009093 | Bacteria | 1521 |
| 236 | Ga0105240_10441528 | 3300009093 | Bacteria | 1458 |
| 237 | Ga0105240_10452127 | 3300009093 | Bacteria | 1437 |
| 238 | Ga0105247_10033116 | 3300009101 | Bacteria | 3142 |
| 239 | Ga0105247_10213782 | 3300009101 | Unclassified | 1302 |
| 240 | Ga0105241_10000206 | 3300009174 | Bacteria | 44346 |
| 241 | Ga0105241_10000622 | 3300009174 | Bacteria | 26623 |
| 242 | Ga0105241_10003350 | 3300009174 | Bacteria | 11931 |
| 243 | Ga0105241_10012190 | 3300009174 | Bacteria | 6309 |
| 244 | Ga0105241_10023243 | 3300009174 | Bacteria | 4596 |
| 245 | Ga0105241_10033338 | 3300009174 | Bacteria | 3866 |
| 246 | Ga0105241_10275042 | 3300009174 | Bacteria | 1436 |
| 247 | Ga0105241_10825965 | 3300009174 | Bacteria | 855 |
| 248 | Ga0105242_10007074 | 3300009176 | Bacteria | 8667 |
| 249 | Ga0105242_10014851 | 3300009176 | Bacteria | 6033 |
| 250 | Ga0105242_10046006 | 3300009176 | Unclassified | 3539 |
| 251 | Ga0105242_10520817 | 3300009176 | Bacteria | 1134 |
| 252 | Ga0105242_10866673 | 3300009176 | Bacteria | 900 |
| 253 | Ga0105242_10881055 | 3300009176 | Bacteria | 893 |
| 254 | Ga0105248_10064000 | 3300009177 | Bacteria | 4129 |
| 255 | Ga0105248_10860398 | 3300009177 | Bacteria | 1023 |
| 256 | Ga0105248_11167562 | 3300009177 | Bacteria | 870 |
| 257 | Ga0105237_10000227 | 3300009545 | Bacteria | 79785 |
| 258 | Ga0105237_10001595 | 3300009545 | Bacteria | 29470 |
| 259 | Ga0105237_10002803 | 3300009545 | Bacteria | 21168 |
| 260 | Ga0105237_10006073 | 3300009545 | Bacteria | 13509 |
| 261 | Ga0105237_10007233 | 3300009545 | Bacteria | 12177 |
| 262 | Ga0105237_10017867 | 3300009545 | Bacteria | 7351 |
| 263 | Ga0105237_10022543 | 3300009545 | Bacteria | 6460 |
| 264 | Ga0105237_10084161 | 3300009545 | Bacteria | 3171 |
| 265 | Ga0105237_10200402 | 3300009545 | Bacteria | 1996 |
| 266 | Ga0105237_10318064 | 3300009545 | Bacteria | 1560 |
| 267 | Ga0105237_10680015 | 3300009545 | Bacteria | 1036 |
| 268 | Ga0105238_10000422 | 3300009551 | Bacteria | 44567 |
| 269 | Ga0105238_10018910 | 3300009551 | Bacteria | 7016 |
| 270 | Ga0105238_10081376 | 3300009551 | Bacteria | 3228 |
| 271 | Ga0105238_10174489 | 3300009551 | Unclassified | 2126 |
| 272 | Ga0105238_10728824 | 3300009551 | Bacteria | 1004 |
| 273 | Ga0105249_10009474 | 3300009553 | Bacteria | 8527 |
| 274 | Ga0105249_10067153 | 3300009553 | Bacteria | 3303 |
| 275 | Ga0105249_10172233 | 3300009553 | Unclassified | 2100 |
| 276 | Ga0105249_10601587 | 3300009553 | Bacteria | 1154 |
| 277 | Ga0105249_10765594 | 3300009553 | Bacteria | 1028 |
| 278 | Ga0105249_11007363 | 3300009553 | Unclassified | 902 |
| 279 | Ga0105249_11031706 | 3300009553 | Bacteria | 892 |
| 280 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 281 | Ga0105239_10000126 | 3300010375 | Bacteria | 107921 |
| 282 | Ga0105239_10000566 | 3300010375 | Bacteria | 53074 |
| 283 | Ga0105239_10000958 | 3300010375 | Bacteria | 40571 |
| 284 | Ga0105239_10002026 | 3300010375 | Bacteria | 26303 |
| 285 | Ga0105239_10002474 | 3300010375 | Bacteria | 23547 |
| 286 | Ga0105239_10003229 | 3300010375 | Bacteria | 20165 |
| 287 | Ga0105239_10008727 | 3300010375 | Bacteria | 11476 |
| 288 | Ga0105239_10075665 | 3300010375 | Bacteria | 3702 |
| 289 | Ga0105239_10200529 | 3300010375 | Bacteria | 2235 |
| 290 | Ga0105239_10273728 | 3300010375 | Bacteria | 1899 |
| 291 | Ga0105246_10188980 | 3300011119 | Bacteria | 1593 |
| 292 | Ga0157373_10046724 | 3300013100 | Unclassified | 3089 |
| 293 | Ga0157371_10000548 | 3300013102 | Bacteria | 44733 |
| 294 | Ga0157371_10064165 | 3300013102 | Bacteria | 2603 |
| 295 | Ga0157371_10131699 | 3300013102 | Bacteria | 1779 |
| 296 | Ga0157371_10162604 | 3300013102 | Bacteria | 1594 |
| 297 | Ga0157371_10286653 | 3300013102 | Bacteria | 1190 |
| 298 | Ga0157370_10000426 | 3300013104 | Bacteria | 52773 |
| 299 | Ga0157370_10050996 | 3300013104 | Bacteria | 3953 |
| 300 | Ga0157370_10196276 | 3300013104 | Unclassified | 1873 |
| 301 | Ga0157370_10290268 | 3300013104 | Bacteria | 1511 |
| 302 | Ga0157370_10761226 | 3300013104 | Bacteria | 882 |
| 303 | Ga0157369_10013765 | 3300013105 | Bacteria | 9144 |
| 304 | Ga0157369_10101052 | 3300013105 | Unclassified | 3074 |
| 305 | Ga0157369_10192759 | 3300013105 | Bacteria | 2141 |
| 306 | Ga0157369_10703170 | 3300013105 | Bacteria | 1041 |
| 307 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 308 | Ga0157374_10013422 | 3300013296 | Bacteria | 7150 |
| 309 | Ga0157374_10031377 | 3300013296 | Bacteria | 4829 |
| 310 | Ga0157374_10081757 | 3300013296 | Bacteria | 3066 |
| 311 | Ga0157374_10134490 | 3300013296 | Bacteria | 2396 |
| 312 | Ga0157374_10157323 | 3300013296 | Bacteria | 2212 |
| 313 | Ga0157374_10446791 | 3300013296 | Unclassified | 1294 |
| 314 | Ga0157374_10481645 | 3300013296 | Unclassified | 1244 |
| 315 | Ga0157374_10633810 | 3300013296 | Bacteria | 1080 |
| 316 | Ga0157378_10001036 | 3300013297 | Bacteria | 25378 |
| 317 | Ga0157378_10003261 | 3300013297 | Bacteria | 14423 |
| 318 | Ga0157378_10003577 | 3300013297 | Bacteria | 13761 |
| 319 | Ga0157378_10009825 | 3300013297 | Bacteria | 8342 |
| 320 | Ga0157378_10058008 | 3300013297 | Bacteria | 3452 |
| 321 | Ga0157378_10059847 | 3300013297 | Bacteria | 3399 |
| 322 | Ga0157378_10118781 | 3300013297 | Bacteria | 2434 |
| 323 | Ga0157378_10247866 | 3300013297 | Bacteria | 1704 |
| 324 | Ga0157378_10254136 | 3300013297 | Bacteria | 1684 |
| 325 | Ga0157378_10600165 | 3300013297 | Bacteria | 1112 |
| 326 | Ga0157378_10934909 | 3300013297 | Unclassified | 899 |
| 327 | Ga0163162_10000214 | 3300013306 | Bacteria | 53543 |
| 328 | Ga0163162_10000746 | 3300013306 | Bacteria | 30256 |
| 329 | Ga0163162_10003837 | 3300013306 | Bacteria | 14412 |
| 330 | Ga0163162_10004601 | 3300013306 | Bacteria | 13293 |
| 331 | Ga0163162_10008000 | 3300013306 | Bacteria | 10311 |
| 332 | Ga0163162_10028558 | 3300013306 | Bacteria | 5520 |
| 333 | Ga0163162_10033319 | 3300013306 | Bacteria | 5118 |
| 334 | Ga0163162_10041455 | 3300013306 | Bacteria | 4606 |
| 335 | Ga0163162_10061096 | 3300013306 | Bacteria | 3806 |
| 336 | Ga0163162_10065099 | 3300013306 | Bacteria | 3691 |
| 337 | Ga0163162_10070938 | 3300013306 | Bacteria | 3536 |
| 338 | Ga0163162_10164531 | 3300013306 | Bacteria | 2342 |
| 339 | Ga0163162_10526533 | 3300013306 | Bacteria | 1311 |
| 340 | Ga0163162_10555151 | 3300013306 | Bacteria | 1276 |
| 341 | Ga0163162_10559152 | 3300013306 | Bacteria | 1272 |
| 342 | Ga0163162_10591449 | 3300013306 | Bacteria | 1236 |
| 343 | Ga0157372_10001870 | 3300013307 | Bacteria | 22853 |
| 344 | Ga0157372_10030550 | 3300013307 | Bacteria | 5894 |
| 345 | Ga0157372_10102911 | 3300013307 | Bacteria | 3262 |
| 346 | Ga0157372_10127330 | 3300013307 | Bacteria | 2928 |
| 347 | Ga0157372_10137662 | 3300013307 | Unclassified | 2812 |
| 348 | Ga0157372_10182637 | 3300013307 | Bacteria | 2429 |
| 349 | Ga0157372_10352840 | 3300013307 | Bacteria | 1714 |
| 350 | Ga0157375_10000125 | 3300013308 | Bacteria | 75607 |
| 351 | Ga0157375_10015416 | 3300013308 | Bacteria | 6841 |
| 352 | Ga0157375_10017332 | 3300013308 | Bacteria | 6498 |
| 353 | Ga0157375_10075094 | 3300013308 | Bacteria | 3404 |
| 354 | Ga0157375_10159592 | 3300013308 | Bacteria | 2396 |
| 355 | Ga0157375_10531535 | 3300013308 | Bacteria | 1339 |
| 356 | Ga0157375_10679369 | 3300013308 | Unclassified | 1184 |
| 357 | Ga0163163_10022878 | 3300014325 | Bacteria | 5924 |
| 358 | Ga0163163_10028496 | 3300014325 | Bacteria | 5364 |
| 359 | Ga0163163_10038726 | 3300014325 | Unclassified | 4647 |
| 360 | Ga0163163_10039355 | 3300014325 | Bacteria | 4614 |
| 361 | Ga0163163_10053081 | 3300014325 | Bacteria | 4000 |
| 362 | Ga0163163_10079543 | 3300014325 | Unclassified | 3276 |
| 363 | Ga0163163_10416238 | 3300014325 | Bacteria | 1403 |
| 364 | Ga0163163_10631200 | 3300014325 | Bacteria | 1135 |
| 365 | Ga0163163_10808033 | 3300014325 | Bacteria | 1001 |
| 366 | Ga0157380_10508528 | 3300014326 | Bacteria | 1172 |
| 367 | Ga0157377_10043178 | 3300014745 | Unclassified | 2508 |
| 368 | Ga0157377_10062341 | 3300014745 | Bacteria | 2133 |
| 369 | Ga0157379_10006414 | 3300014968 | Bacteria | 10131 |
| 370 | Ga0157379_10016848 | 3300014968 | Bacteria | 6432 |
| 371 | Ga0157379_10098454 | 3300014968 | Bacteria | 2625 |
| 372 | Ga0157379_10176329 | 3300014968 | Bacteria | 1930 |
| 373 | Ga0157376_10001900 | 3300014969 | Bacteria | 13949 |
| 374 | Ga0157376_10002389 | 3300014969 | Bacteria | 12680 |
| 375 | Ga0157376_10048874 | 3300014969 | Bacteria | 3501 |
| 376 | Ga0157376_10145558 | 3300014969 | Bacteria | 2131 |
| 377 | Ga0157376_10158383 | 3300014969 | Bacteria | 2050 |
| 378 | Ga0157376_10168006 | 3300014969 | Bacteria | 1995 |
| 379 | Ga0157376_10243315 | 3300014969 | Bacteria | 1677 |
| 380 | Ga0163161_10007441 | 3300017792 | Bacteria | 7566 |
| 381 | Ga0163161_10012849 | 3300017792 | Bacteria | 5817 |
| 382 | Ga0163161_10017410 | 3300017792 | Bacteria | 5028 |
| 383 | Ga0163161_10139421 | 3300017792 | Unclassified | 1835 |
| 384 | Ga0163161_10472952 | 3300017792 | Bacteria | 1016 |
| 385 | Ga0209436_103440 | 3300025208 | Bacteria | 4214 |
| 386 | Ga0209563_106089 | 3300025230 | Bacteria | 2108 |
| 387 | Ga0207427_100138 | 3300025231 | Bacteria | 86499 |
| 388 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 389 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 390 | Ga0209026_1000262 | 3300025250 | Bacteria | 64597 |
| 391 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 392 | Ga0209455_1004518 | 3300025272 | Unclassified | 4526 |
| 393 | Ga0209673_1000354 | 3300025273 | Bacteria | 83443 |
| 394 | Ga0209673_1054118 | 3300025273 | Unclassified | 1042 |
| 395 | Ga0209130_1001301 | 3300025284 | Bacteria | 17090 |
| 396 | Ga0209564_1004026 | 3300025295 | Bacteria | 9293 |
| 397 | Ga0209564_1006922 | 3300025295 | Bacteria | 5966 |
| 398 | Ga0209564_1010412 | 3300025295 | Bacteria | 4288 |
| 399 | Ga0209758_1003300 | 3300025297 | Bacteria | 14935 |
| 400 | Ga0209758_1006769 | 3300025297 | Bacteria | 8055 |
| 401 | Ga0209758_1009028 | 3300025297 | Bacteria | 6301 |
| 402 | Ga0209050_1000163 | 3300025298 | Bacteria | 154895 |
| 403 | Ga0207426_1000060 | 3300025302 | Bacteria | 363139 |
| 404 | Ga0207426_1000096 | 3300025302 | Bacteria | 271627 |
| 405 | Ga0207426_1000157 | 3300025302 | Bacteria | 178442 |
| 406 | Ga0207426_1002866 | 3300025302 | Bacteria | 10231 |
| 407 | Ga0207426_1038024 | 3300025302 | Bacteria | 1518 |
| 408 | Ga0209257_1011230 | 3300025304 | Bacteria | 4347 |
| 409 | Ga0207642_10040479 | 3300025899 | Bacteria | 2034 |
| 410 | Ga0207710_10090245 | 3300025900 | Bacteria | 1433 |
| 411 | Ga0207680_10001183 | 3300025903 | Bacteria | 12328 |
| 412 | Ga0207680_10015875 | 3300025903 | Bacteria | 3941 |
| 413 | Ga0207680_10016256 | 3300025903 | Bacteria | 3902 |
| 414 | Ga0207680_10188301 | 3300025903 | Bacteria | 1399 |
| 415 | Ga0207647_10052617 | 3300025904 | Unclassified | 2513 |
| 416 | Ga0207647_10168329 | 3300025904 | Bacteria | 1276 |
| 417 | Ga0207647_10172270 | 3300025904 | Unclassified | 1260 |
| 418 | Ga0207685_10181858 | 3300025905 | Unclassified | 975 |
| 419 | Ga0207645_10021368 | 3300025907 | Unclassified | 4221 |
| 420 | Ga0207645_10031006 | 3300025907 | Bacteria | 3443 |
| 421 | Ga0207705_10027566 | 3300025909 | Bacteria | 4052 |
| 422 | Ga0207654_10002076 | 3300025911 | Bacteria | 10270 |
| 423 | Ga0207654_10002638 | 3300025911 | Bacteria | 9098 |
| 424 | Ga0207654_10004110 | 3300025911 | Bacteria | 7336 |
| 425 | Ga0207654_10010271 | 3300025911 | Bacteria | 4768 |
| 426 | Ga0207707_10000111 | 3300025912 | Bacteria | 82165 |
| 427 | Ga0207707_10092681 | 3300025912 | Bacteria | 2640 |
| 428 | Ga0207707_10108977 | 3300025912 | Bacteria | 2421 |
| 429 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 430 | Ga0207695_10000057 | 3300025913 | Bacteria | 376090 |
| 431 | Ga0207695_10000068 | 3300025913 | Bacteria | 324859 |
| 432 | Ga0207695_10002809 | 3300025913 | Bacteria | 25312 |
| 433 | Ga0207695_10022478 | 3300025913 | Bacteria | 7156 |
| 434 | Ga0207695_10038940 | 3300025913 | Bacteria | 5113 |
| 435 | Ga0207695_10049375 | 3300025913 | Bacteria | 4436 |
| 436 | Ga0207695_10050172 | 3300025913 | Bacteria | 4392 |
| 437 | Ga0207695_10154492 | 3300025913 | Bacteria | 2230 |
| 438 | Ga0207695_10564871 | 3300025913 | Bacteria | 1019 |
| 439 | Ga0207671_10000515 | 3300025914 | Bacteria | 52421 |
| 440 | Ga0207671_10001507 | 3300025914 | Bacteria | 26846 |
| 441 | Ga0207671_10001648 | 3300025914 | Bacteria | 25416 |
| 442 | Ga0207671_10004263 | 3300025914 | Bacteria | 13763 |
| 443 | Ga0207671_10007231 | 3300025914 | Bacteria | 9667 |
| 444 | Ga0207671_10020022 | 3300025914 | Bacteria | 5103 |
| 445 | Ga0207671_10032780 | 3300025914 | Bacteria | 3865 |
| 446 | Ga0207660_10021100 | 3300025917 | Bacteria | 4377 |
| 447 | Ga0207660_10054559 | 3300025917 | Bacteria | 2853 |
| 448 | Ga0207657_10014655 | 3300025919 | Bacteria | 7639 |
| 449 | Ga0207649_10047637 | 3300025920 | Bacteria | 2639 |
| 450 | Ga0207649_10052351 | 3300025920 | Bacteria | 2532 |
| 451 | Ga0207652_10000538 | 3300025921 | Bacteria | 38475 |
| 452 | Ga0207652_10038532 | 3300025921 | Bacteria | 4053 |
| 453 | Ga0207652_10053384 | 3300025921 | Bacteria | 3472 |
| 454 | Ga0207652_10101134 | 3300025921 | Bacteria | 2546 |
| 455 | Ga0207681_10079696 | 3300025923 | Unclassified | 2308 |
| 456 | Ga0207694_10142483 | 3300025924 | Unclassified | 1928 |
| 457 | Ga0207694_10461784 | 3300025924 | Unclassified | 1061 |
| 458 | Ga0207650_10101974 | 3300025925 | Bacteria | 2210 |
| 459 | Ga0207650_10112539 | 3300025925 | Bacteria | 2109 |
| 460 | Ga0207650_10269473 | 3300025925 | Bacteria | 1383 |
| 461 | Ga0207650_10450412 | 3300025925 | Bacteria | 1071 |
| 462 | Ga0207650_10650417 | 3300025925 | Unclassified | 889 |
| 463 | Ga0207659_10116136 | 3300025926 | Bacteria | 2043 |
| 464 | Ga0207659_10461968 | 3300025926 | Bacteria | 1070 |
| 465 | Ga0207644_10007168 | 3300025931 | Bacteria | 7263 |
| 466 | Ga0207644_10079906 | 3300025931 | Bacteria | 2414 |
| 467 | Ga0207644_10215029 | 3300025931 | Bacteria | 1521 |
| 468 | Ga0207644_10628299 | 3300025931 | Unclassified | 893 |
| 469 | Ga0207690_10019756 | 3300025932 | Bacteria | 4153 |
| 470 | Ga0207706_10008179 | 3300025933 | Bacteria | 9648 |
| 471 | Ga0207706_10020230 | 3300025933 | Bacteria | 5982 |
| 472 | Ga0207706_10035883 | 3300025933 | Bacteria | 4406 |
| 473 | Ga0207706_10075732 | 3300025933 | Bacteria | 2960 |
| 474 | Ga0207706_10084043 | 3300025933 | Bacteria | 2798 |
| 475 | Ga0207686_10000375 | 3300025934 | Bacteria | 31141 |
| 476 | Ga0207670_10056219 | 3300025936 | Bacteria | 2663 |
| 477 | Ga0207670_10181717 | 3300025936 | Bacteria | 1585 |
| 478 | Ga0207691_10005439 | 3300025940 | Bacteria | 12299 |
| 479 | Ga0207691_10114579 | 3300025940 | Bacteria | 2395 |
| 480 | Ga0207691_10153153 | 3300025940 | Unclassified | 2026 |
| 481 | Ga0207711_10437746 | 3300025941 | Unclassified | 1217 |
| 482 | Ga0207689_10003450 | 3300025942 | Bacteria | 14436 |
| 483 | Ga0207689_10039074 | 3300025942 | Bacteria | 3930 |
| 484 | Ga0207689_10435380 | 3300025942 | Bacteria | 1095 |
| 485 | Ga0207661_10031975 | 3300025944 | Bacteria | 4072 |
| 486 | Ga0207661_10042051 | 3300025944 | Bacteria | 3601 |
| 487 | Ga0207661_10115041 | 3300025944 | Bacteria | 2281 |
| 488 | Ga0207661_10390105 | 3300025944 | Bacteria | 1261 |
| 489 | Ga0207679_10043751 | 3300025945 | Bacteria | 3226 |
| 490 | Ga0207679_10052795 | 3300025945 | Bacteria | 2983 |
| 491 | Ga0207679_10075204 | 3300025945 | Unclassified | 2562 |
| 492 | Ga0207679_10106918 | 3300025945 | Bacteria | 2200 |
| 493 | Ga0207667_10000621 | 3300025949 | Bacteria | 45894 |
| 494 | Ga0207667_10116475 | 3300025949 | Bacteria | 2753 |
| 495 | Ga0207667_10132744 | 3300025949 | Bacteria | 2565 |
| 496 | Ga0207667_10176490 | 3300025949 | Unclassified | 2195 |
| 497 | Ga0207651_10205130 | 3300025960 | Unclassified | 1583 |
| 498 | Ga0207651_10231544 | 3300025960 | Bacteria | 1500 |
| 499 | Ga0207651_10267760 | 3300025960 | Unclassified | 1406 |
| 500 | Ga0207651_10269722 | 3300025960 | Bacteria | 1401 |
| 501 | Ga0207651_10297305 | 3300025960 | Bacteria | 1341 |
| 502 | Ga0207651_10401578 | 3300025960 | Unclassified | 1166 |
| 503 | Ga0207712_10025016 | 3300025961 | Bacteria | 3962 |
| 504 | Ga0207712_10067880 | 3300025961 | Unclassified | 2553 |
| 505 | Ga0207712_10161561 | 3300025961 | Bacteria | 1742 |
| 506 | Ga0207712_10793936 | 3300025961 | Unclassified | 832 |
| 507 | Ga0207668_10858205 | 3300025972 | Bacteria | 806 |
| 508 | Ga0207640_10062216 | 3300025981 | Bacteria | 2475 |
| 509 | Ga0207640_10075009 | 3300025981 | Unclassified | 2291 |
| 510 | Ga0207640_10192486 | 3300025981 | Bacteria | 1538 |
| 511 | Ga0207658_10012271 | 3300025986 | Bacteria | 5849 |
| 512 | Ga0207658_10019797 | 3300025986 | Bacteria | 4657 |
| 513 | Ga0207658_10043198 | 3300025986 | Bacteria | 3275 |
| 514 | Ga0207658_10448883 | 3300025986 | Unclassified | 1141 |
| 515 | Ga0207677_10016626 | 3300026023 | Bacteria | 4363 |
| 516 | Ga0207677_10298680 | 3300026023 | Unclassified | 1329 |
| 517 | Ga0207703_10000798 | 3300026035 | Bacteria | 31051 |
| 518 | Ga0207703_10049018 | 3300026035 | Bacteria | 3412 |
| 519 | Ga0207703_10126439 | 3300026035 | Unclassified | 2202 |
| 520 | Ga0207703_10354522 | 3300026035 | Bacteria | 1351 |
| 521 | Ga0207639_10039989 | 3300026041 | Bacteria | 3498 |
| 522 | Ga0207639_10427714 | 3300026041 | Bacteria | 1198 |
| 523 | Ga0207639_10502938 | 3300026041 | Bacteria | 1107 |
| 524 | Ga0207678_10137935 | 3300026067 | Bacteria | 2081 |
| 525 | Ga0207708_10127057 | 3300026075 | Unclassified | 1991 |
| 526 | Ga0207702_10002255 | 3300026078 | Bacteria | 18481 |
| 527 | Ga0207702_10009624 | 3300026078 | Bacteria | 8111 |
| 528 | Ga0207702_10041386 | 3300026078 | Bacteria | 3864 |
| 529 | Ga0207702_10042062 | 3300026078 | Bacteria | 3832 |
| 530 | Ga0207702_10620940 | 3300026078 | Bacteria | 1061 |
| 531 | Ga0207641_10000056 | 3300026088 | Bacteria | 170719 |
| 532 | Ga0207641_10000690 | 3300026088 | Bacteria | 36445 |
| 533 | Ga0207641_10080123 | 3300026088 | Bacteria | 2832 |
| 534 | Ga0207641_10269272 | 3300026088 | Unclassified | 1598 |
| 535 | Ga0207641_10351457 | 3300026088 | Bacteria | 1405 |
| 536 | Ga0207641_10717655 | 3300026088 | Bacteria | 985 |
| 537 | Ga0207648_10053122 | 3300026089 | Bacteria | 3542 |
| 538 | Ga0207648_10171436 | 3300026089 | Bacteria | 1918 |
| 539 | Ga0207648_10222522 | 3300026089 | Unclassified | 1678 |
| 540 | Ga0207648_10275919 | 3300026089 | Bacteria | 1503 |
| 541 | Ga0207648_10432231 | 3300026089 | Bacteria | 1197 |
| 542 | Ga0207676_10005956 | 3300026095 | Bacteria | 8600 |
| 543 | Ga0207676_10055592 | 3300026095 | Bacteria | 3108 |
| 544 | Ga0207676_10077417 | 3300026095 | Bacteria | 2690 |
| 545 | Ga0207676_10229463 | 3300026095 | Bacteria | 1659 |
| 546 | Ga0207676_10264741 | 3300026095 | Bacteria | 1554 |
| 547 | Ga0207676_10635879 | 3300026095 | Unclassified | 1028 |
| 548 | Ga0207674_10017345 | 3300026116 | Bacteria | 7855 |
| 549 | Ga0207674_10914515 | 3300026116 | Unclassified | 846 |
| 550 | Ga0207675_100025171 | 3300026118 | Bacteria | 5538 |
| 551 | Ga0207675_100146973 | 3300026118 | Unclassified | 2242 |
| 552 | Ga0207675_100474663 | 3300026118 | Bacteria | 1242 |
| 553 | Ga0207683_10127576 | 3300026121 | Bacteria | 2287 |
| 554 | Ga0207683_10339664 | 3300026121 | Bacteria | 1377 |
| 555 | Ga0207698_10034662 | 3300026142 | Bacteria | 3682 |
| 556 | Ga0207698_10064122 | 3300026142 | Unclassified | 2878 |
| 557 | Ga0207698_10076314 | 3300026142 | Bacteria | 2682 |
| 558 | Ga0207698_10201475 | 3300026142 | Bacteria | 1782 |
| 559 | Ga0207698_10972432 | 3300026142 | Bacteria | 859 |
| 560 | Ga0268266_10000070 | 3300028379 | Bacteria | 235423 |
| 561 | Ga0268265_10299066 | 3300028380 | Bacteria | 1448 |
| 562 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 563 | Ga0268264_10002267 | 3300028381 | Bacteria | 17033 |
| 564 | Ga0268264_10002439 | 3300028381 | Bacteria | 16350 |
| 565 | Ga0268264_10002602 | 3300028381 | Bacteria | 15783 |
| 566 | Ga0268264_10018085 | 3300028381 | Bacteria | 5765 |
| 567 | Ga0268264_10032902 | 3300028381 | Bacteria | 4255 |
| 568 | Ga0268264_10127345 | 3300028381 | Bacteria | 2253 |
| 569 | Ga0268264_10130451 | 3300028381 | Bacteria | 2227 |
| 570 | Ga0265322_10034698 | 3300028654 | Bacteria | 1437 |
| 571 | Ga0307517_10002276 | 3300028786 | Bacteria | 30977 |
| 572 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 573 | Ga0265338_10188139 | 3300028800 | Bacteria | 1567 |
| 574 | Ga0307511_10000304 | 3300030521 | Bacteria | 52160 |
| 575 | Ga0265327_10000048 | 3300031251 | Bacteria | 269173 |
| 576 | Ga0265327_10102895 | 3300031251 | Bacteria | 1375 |
| 577 | Ga0307509_10061686 | 3300031507 | Unclassified | 3957 |
| 578 | Ga0307509_10090538 | 3300031507 | Bacteria | 3135 |
| 579 | Ga0307509_10141944 | 3300031507 | Bacteria | 2335 |
| 580 | Ga0307516_10001487 | 3300031730 | Bacteria | 32321 |
| 581 | Ga0307516_10087877 | 3300031730 | Bacteria | 2942 |
| 582 | Ga0307510_10000062 | 3300033180 | Bacteria | 81920 |
| 583 | Ga0373943_0147067 | 3300035170 | Bacteria | 1274 |
| 584 | Ga0373943_0167537 | 3300035170 | Bacteria | 1200 |
| 585 | Ga0373955_0011356 | 3300035172 | Bacteria | 4241 |
| 586 | Ga0373947_0119761 | 3300035725 | Bacteria | 1671 |
| 587 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 588 | Ga0395899_0013384 | 3300037312 | Bacteria | 6277 |
| 589 | Ga0395900_0036349 | 3300037418 | Bacteria | 5077 |
| 590 | Ga0395900_0169747 | 3300037418 | Bacteria | 2221 |
| 591 | Ga0395898_0045550 | 3300037466 | Bacteria | 4311 |
| 592 | Ga0395905_0324575 | 3300037471 | Unclassified | 1429 |
| 593 | Ga0395901_0361168 | 3300038443 | Bacteria | 1497 |
| 594 | Ga0451793_1724395 | 3300041452 | Unclassified | 1248 |
| 595 | Ga0451839_1285172 | 3300041496 | Unclassified | 1445 |
| 596 | Ga0466972_0000014 | 3300044658 | Bacteria | 216776 |
| 597 | Ga0466972_0028584 | 3300044658 | Bacteria | 2749 |
| 598 | Ga0466972_0105570 | 3300044658 | Bacteria | 1332 |
| 599 | Ga0466965_0044649 | 3300044683 | Bacteria | 2191 |
| 600 | Ga0466966_0132644 | 3300044684 | Bacteria | 1525 |
| 601 | Ga0466961_0045509 | 3300044693 | Bacteria | 2808 |
| 602 | Ga0466970_0002409 | 3300044765 | Bacteria | 9036 |
| 603 | Ga0466959_0026914 | 3300045049 | Bacteria | 4265 |
| 604 | Ga0495629_0172216 | 3300046459 | Unclassified | 1502 |
| 605 | Ga0495638_0024301 | 3300046460 | Bacteria | 3953 |
| 606 | Ga0495580_0089987 | 3300046472 | Bacteria | 2137 |
| 607 | Ga0495582_0077330 | 3300046473 | Unclassified | 1846 |
| 608 | Ga0495648_0023003 | 3300046524 | Bacteria | 4276 |
| 609 | Ga0495640_0064438 | 3300046533 | Bacteria | 2478 |
| 610 | Ga0495586_0258167 | 3300046535 | Bacteria | 995 |
| 611 | Ga0495611_0000150 | 3300046648 | Bacteria | 49672 |
| 612 | Ga0495611_0048018 | 3300046648 | Bacteria | 1917 |
| 613 | Ga0495625_0096223 | 3300046660 | Bacteria | 2040 |
| 614 | Ga0495635_0143276 | 3300046663 | Unclassified | 1627 |
| 615 | Ga0495658_0025365 | 3300046683 | Unclassified | 3168 |
| 616 | Ga0495658_0182725 | 3300046683 | Bacteria | 1302 |
| 617 | Ga0495674_0081733 | 3300047319 | Unclassified | 2771 |
| 618 | Ga0495672_0046727 | 3300047320 | Bacteria | 2580 |
| 619 | Ga0495676_0197922 | 3300047321 | Bacteria | 1398 |
| 620 | Ga0495687_000006 | 3300047443 | Bacteria | 571936 |
| 621 | Ga0495684_0155414 | 3300047471 | Bacteria | 1709 |
| 622 | Ga0495686_0000078 | 3300047472 | Bacteria | 203927 |
| 623 | Ga0496101_0019332 | 3300048904 | Bacteria | 4650 |
| 624 | Ga0496104_0315165 | 3300048907 | Bacteria | 1477 |
| 625 | Ga0496110_0118808 | 3300048913 | Bacteria | 2381 |
| 626 | Ga0496111_0118855 | 3300048914 | Bacteria | 1951 |
| 627 | Ga0496112_0213058 | 3300048915 | Bacteria | 1889 |
| 628 | Ga0496115_0121040 | 3300048918 | Bacteria | 2154 |
| 629 | Ga0501034_0165896 | 3300049571 | Bacteria | 2177 |
| 630 | Ga0501037_0459996 | 3300049573 | Unclassified | 867 |
| 631 | Ga0501046_0292587 | 3300049580 | Unclassified | 1191 |
| 632 | Ga0501047_0350061 | 3300049581 | Unclassified | 1314 |
| 633 | Ga0501048_0215029 | 3300049582 | Unclassified | 1363 |
| 634 | Ga0501067_0102960 | 3300049583 | Unclassified | 1586 |
| 635 | Ga0501068_0282913 | 3300049584 | Unclassified | 1060 |
| 636 | Ga0501069_0018441 | 3300049585 | Bacteria | 3765 |
| 637 | Ga0501073_0014748 | 3300049589 | Bacteria | 5676 |
| 638 | Ga0501079_0727771 | 3300049741 | Unclassified | 781 |
| 639 | Ga0501083_0012904 | 3300049744 | Bacteria | 5839 |
| 640 | Ga0501044_0240296 | 3300049823 | Archaea | 1755 |
| 641 | nmdc:mga0k408_162134_c1 | 3300050493 | Unclassified | 1332 |
| 642 | nmdc:mga0n895_663492_c1 | 3300050512 | Bacteria | 1041 |
| 643 | Ga0500652_016281 | 3300053131 | Unclassified | 2702 |
| 644 | Ga0500568_0032490 | 3300053139 | Bacteria | 2146 |
| 645 | Ga0500622_0010155 | 3300053156 | Bacteria | 5178 |
| 646 | Ga0500637_0046561 | 3300053178 | Bacteria | 2462 |
| 647 | Ga0501084_0004894 | 3300054114 | Bacteria | 10945 |
| 648 | Ga0501082_0373692 | 3300060353 | Unclassified | 1243 |
| 649 | Ga0466962_0033092 | 3300061719 | Bacteria | 2473 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100558088 | Ga0070689_1005580881 | 204 |
| 2 | 3300005618 | Ga0068864_100501788 | Ga0068864_1005017881 | 204 |
| 3 | 3300005842 | Ga0068858_100321674 | Ga0068858_1003216742 | 204 |
| 4 | 3300006163 | Ga0070715_10326361 | Ga0070715_103263611 | 204 |
| 5 | 3300006358 | Ga0068871_100330850 | Ga0068871_1003308502 | 204 |
| 6 | 3300013306 | Ga0163162_10041455 | Ga0163162_100414553 | 204 |
| 7 | 3300025905 | Ga0207685_10181858 | Ga0207685_101818582 | 204 |
| 8 | 3300025931 | Ga0207644_10628299 | Ga0207644_106282992 | 204 |
| 9 | 3300025941 | Ga0207711_10437746 | Ga0207711_104377462 | 204 |
| 10 | 3300025961 | Ga0207712_10067880 | Ga0207712_100678801 | 204 |
| 11 | 3300026035 | Ga0207703_10126439 | Ga0207703_101264393 | 204 |
| 12 | 3300026095 | Ga0207676_10635879 | Ga0207676_106358792 | 204 |
| 13 | 3300009093 | Ga0105240_10384828 | Ga0105240_103848281 | 214 |
| 14 | 3300005290 | Ga0065712_10323773 | Ga0065712_103237731 | 216 |
| 15 | 3300005367 | Ga0070667_100245685 | Ga0070667_1002456852 | 218 |
| 16 | 3300005456 | Ga0070678_100098259 | Ga0070678_1000982593 | 218 |
| 17 | 3300005543 | Ga0070672_100600668 | Ga0070672_1006006683 | 218 |
| 18 | 3300009176 | Ga0105242_10881055 | Ga0105242_108810551 | 218 |
| 19 | 3300009177 | Ga0105248_10064000 | Ga0105248_100640005 | 218 |
| 20 | 3300009553 | Ga0105249_11031706 | Ga0105249_110317061 | 218 |
| 21 | 3300013308 | Ga0157375_10000125 | Ga0157375_1000012536 | 218 |
| 22 | 3300031730 | Ga0307516_10001487 | Ga0307516_100014876 | 218 |
| 23 | 3300013102 | Ga0157371_10131699 | Ga0157371_101316992 | 223 |
| 24 | 3300025297 | Ga0209758_1006769 | Ga0209758_10067694 | 223 |
| 25 | 3300003354 | JGI25160J50197_1002488 | JGI25160J50197_10024886 | 225 |
| 26 | 3300003771 | Ga0055526_1010370 | Ga0055526_10103704 | 225 |
| 27 | 3300003771 | Ga0055526_1032649 | Ga0055526_10326492 | 225 |
| 28 | 3300003790 | Ga0055528_1000572 | Ga0055528_10005723 | 225 |
| 29 | 3300003791 | Ga0055530_10000789 | Ga0055530_1000078916 | 225 |
| 30 | 3300005262 | Ga0065165_1000017 | Ga0065165_100001726 | 225 |
| 31 | 3300025273 | Ga0209673_1000354 | Ga0209673_100035437 | 225 |
| 32 | 3300025273 | Ga0209673_1054118 | Ga0209673_10541181 | 225 |
| 33 | 3300025295 | Ga0209564_1004026 | Ga0209564_10040264 | 225 |
| 34 | 3300025295 | Ga0209564_1006922 | Ga0209564_10069225 | 225 |
| 35 | 3300025295 | Ga0209564_1010412 | Ga0209564_10104125 | 225 |
| 36 | 3300025297 | Ga0209758_1003300 | Ga0209758_10033008 | 225 |
| 37 | 3300025298 | Ga0209050_1000163 | Ga0209050_100016329 | 225 |
| 38 | 3300025302 | Ga0207426_1002866 | Ga0207426_10028665 | 225 |
| 39 | 3300025304 | Ga0209257_1011230 | Ga0209257_10112302 | 225 |
| 40 | 3300050493 | nmdc:mga0k408_162134_c1 | nmdc:mga0k408_162134_c1_31_780 | 225 |
| 41 | 3300003320 | rootH2_10001414 | rootH2_100014145 | 226 |
| 42 | 3300003320 | rootH2_10187887 | rootH2_101878872 | 227 |
| 43 | 3300014325 | Ga0163163_10038726 | Ga0163163_100387261 | 227 |
| 44 | 3300005577 | Ga0068857_100429115 | Ga0068857_1004291152 | 228 |
| 45 | 3300014325 | Ga0163163_10053081 | Ga0163163_100530813 | 228 |
| 46 | 3300009093 | Ga0105240_10411375 | Ga0105240_104113753 | 229 |
| 47 | 3300005329 | Ga0070683_100093238 | Ga0070683_1000932382 | 230 |
| 48 | 3300005335 | Ga0070666_10043983 | Ga0070666_100439832 | 230 |
| 49 | 3300005616 | Ga0068852_100250059 | Ga0068852_1002500592 | 230 |
| 50 | 3300009093 | Ga0105240_10002002 | Ga0105240_1000200220 | 230 |
| 51 | 3300009174 | Ga0105241_10023243 | Ga0105241_100232434 | 230 |
| 52 | 3300009545 | Ga0105237_10022543 | Ga0105237_100225432 | 230 |
| 53 | 3300009551 | Ga0105238_10000422 | Ga0105238_1000042229 | 230 |
| 54 | 3300010375 | Ga0105239_10075665 | Ga0105239_100756652 | 230 |
| 55 | 3300013306 | Ga0163162_10526533 | Ga0163162_105265332 | 230 |
| 56 | 3300013307 | Ga0157372_10030550 | Ga0157372_100305505 | 230 |
| 57 | 3300025208 | Ga0209436_103440 | Ga0209436_1034402 | 230 |
| 58 | 3300025284 | Ga0209130_1001301 | Ga0209130_100130113 | 230 |
| 59 | 3300025302 | Ga0207426_1000096 | Ga0207426_100009682 | 230 |
| 60 | 3300025944 | Ga0207661_10390105 | Ga0207661_103901052 | 230 |
| 61 | 3300026088 | Ga0207641_10000690 | Ga0207641_1000069028 | 230 |
| 62 | 3300028381 | Ga0268264_10127345 | Ga0268264_101273455 | 230 |
| 63 | 3300044658 | Ga0466972_0028584 | Ga0466972_0028584_1636_2328 | 230 |
| 64 | 3300046460 | Ga0495638_0024301 | Ga0495638_0024301_1219_1911 | 230 |
| 65 | 3300046524 | Ga0495648_0023003 | Ga0495648_0023003_208_900 | 230 |
| 66 | 3300047443 | Ga0495687_000006 | Ga0495687_000006_197996_198688 | 230 |
| 67 | 3300053156 | Ga0500622_0010155 | Ga0500622_0010155_1009_1701 | 230 |
| 68 | 3300009174 | Ga0105241_10275042 | Ga0105241_102750422 | 231 |
| 69 | 3300009553 | Ga0105249_10172233 | Ga0105249_101722333 | 231 |
| 70 | 3300013306 | Ga0163162_10003837 | Ga0163162_100038371 | 231 |
| 71 | 3300014325 | Ga0163163_10631200 | Ga0163163_106312002 | 231 |
| 72 | 3300014968 | Ga0157379_10016848 | Ga0157379_100168486 | 231 |
| 73 | 3300017792 | Ga0163161_10012849 | Ga0163161_100128496 | 231 |
| 74 | 3300046472 | Ga0495580_0089987 | Ga0495580_0089987_24_773 | 231 |
| 75 | 3300003322 | rootL2_10300232 | rootL2_103002323 | 232 |
| 76 | 3300005328 | Ga0070676_10029614 | Ga0070676_100296143 | 232 |
| 77 | 3300005338 | Ga0068868_100002455 | Ga0068868_1000024552 | 232 |
| 78 | 3300005355 | Ga0070671_100030079 | Ga0070671_1000300792 | 232 |
| 79 | 3300005364 | Ga0070673_100089533 | Ga0070673_1000895332 | 232 |
| 80 | 3300005365 | Ga0070688_100078898 | Ga0070688_1000788982 | 232 |
| 81 | 3300005614 | Ga0068856_100014177 | Ga0068856_1000141773 | 232 |
| 82 | 3300005834 | Ga0068851_10059600 | Ga0068851_100596001 | 232 |
| 83 | 3300005841 | Ga0068863_100065602 | Ga0068863_1000656022 | 232 |
| 84 | 3300006358 | Ga0068871_100075370 | Ga0068871_1000753703 | 232 |
| 85 | 3300013296 | Ga0157374_10481645 | Ga0157374_104816452 | 232 |
| 86 | 3300013308 | Ga0157375_10679369 | Ga0157375_106793692 | 232 |
| 87 | 3300014325 | Ga0163163_10079543 | Ga0163163_100795432 | 232 |
| 88 | 3300025907 | Ga0207645_10031006 | Ga0207645_100310063 | 232 |
| 89 | 3300025925 | Ga0207650_10112539 | Ga0207650_101125392 | 232 |
| 90 | 3300026023 | Ga0207677_10016626 | Ga0207677_100166262 | 232 |
| 91 | 3300026088 | Ga0207641_10080123 | Ga0207641_100801233 | 232 |
| 92 | 3300003323 | rootH1_10018525 | rootH1_100185254 | 233 |
| 93 | 3300005293 | Ga0065715_10154051 | Ga0065715_101540511 | 233 |
| 94 | 3300005337 | Ga0070682_100083516 | Ga0070682_1000835161 | 233 |
| 95 | 3300005338 | Ga0068868_100180587 | Ga0068868_1001805871 | 233 |
| 96 | 3300005355 | Ga0070671_100190123 | Ga0070671_1001901232 | 233 |
| 97 | 3300005364 | Ga0070673_100505524 | Ga0070673_1005055241 | 233 |
| 98 | 3300005563 | Ga0068855_100077427 | Ga0068855_1000774275 | 233 |
| 99 | 3300005616 | Ga0068852_100251949 | Ga0068852_1002519492 | 233 |
| 100 | 3300005719 | Ga0068861_100046054 | Ga0068861_1000460542 | 233 |
| 101 | 3300005841 | Ga0068863_100091159 | Ga0068863_1000911593 | 233 |
| 102 | 3300005843 | Ga0068860_100125138 | Ga0068860_1001251383 | 233 |
| 103 | 3300005844 | Ga0068862_100179448 | Ga0068862_1001794482 | 233 |
| 104 | 3300006237 | Ga0097621_100006155 | Ga0097621_10000615512 | 233 |
| 105 | 3300009176 | Ga0105242_10007074 | Ga0105242_100070745 | 233 |
| 106 | 3300009176 | Ga0105242_10520817 | Ga0105242_105208172 | 233 |
| 107 | 3300009553 | Ga0105249_10765594 | Ga0105249_107655942 | 233 |
| 108 | 3300013296 | Ga0157374_10446791 | Ga0157374_104467911 | 233 |
| 109 | 3300013297 | Ga0157378_10600165 | Ga0157378_106001651 | 233 |
| 110 | 3300013297 | Ga0157378_10934909 | Ga0157378_109349091 | 233 |
| 111 | 3300014745 | Ga0157377_10043178 | Ga0157377_100431784 | 233 |
| 112 | 3300017792 | Ga0163161_10017410 | Ga0163161_100174102 | 233 |
| 113 | 3300025899 | Ga0207642_10040479 | Ga0207642_100404792 | 233 |
| 114 | 3300025913 | Ga0207695_10038940 | Ga0207695_100389404 | 233 |
| 115 | 3300025925 | Ga0207650_10450412 | Ga0207650_104504122 | 233 |
| 116 | 3300025934 | Ga0207686_10000375 | Ga0207686_100003757 | 233 |
| 117 | 3300025940 | Ga0207691_10005439 | Ga0207691_1000543916 | 233 |
| 118 | 3300025949 | Ga0207667_10132744 | Ga0207667_101327442 | 233 |
| 119 | 3300026075 | Ga0207708_10127057 | Ga0207708_101270573 | 233 |
| 120 | 3300026118 | Ga0207675_100025171 | Ga0207675_1000251714 | 233 |
| 121 | 3300028381 | Ga0268264_10130451 | Ga0268264_101304513 | 233 |
| 122 | 3300031507 | Ga0307509_10061686 | Ga0307509_100616864 | 233 |
| 123 | 3300041452 | Ga0451793_1724395 | Ga0451793_1724395_98_847 | 233 |
| 124 | 3300001979 | JGI24740J21852_10002328 | JGI24740J21852_100023285 | 234 |
| 125 | 3300005341 | Ga0070691_10002772 | Ga0070691_100027724 | 234 |
| 126 | 3300010375 | Ga0105239_10200529 | Ga0105239_102005292 | 234 |
| 127 | 3300013104 | Ga0157370_10761226 | Ga0157370_107612261 | 234 |
| 128 | 3300013105 | Ga0157369_10703170 | Ga0157369_107031702 | 234 |
| 129 | 3300013297 | Ga0157378_10003261 | Ga0157378_1000326111 | 234 |
| 130 | 3300031730 | Ga0307516_10087877 | Ga0307516_100878772 | 234 |
| 131 | 3300035170 | Ga0373943_0167537 | Ga0373943_0167537_78_824 | 234 |
| 132 | 3300035172 | Ga0373955_0011356 | Ga0373955_0011356_3449_4195 | 234 |
| 133 | 3300041496 | Ga0451839_1285172 | Ga0451839_1285172_72_818 | 234 |
| 134 | 3300046533 | Ga0495640_0064438 | Ga0495640_0064438_1091_1837 | 234 |
| 135 | 3300046535 | Ga0495586_0258167 | Ga0495586_0258167_27_773 | 234 |
| 136 | 3300046683 | Ga0495658_0182725 | Ga0495658_0182725_139_885 | 234 |
| 137 | iso_pu_bacteria | 2929177148 | 2929181259 | 234 |
| 138 | iso_pu_bacteria | 2945977869 | 2945983663 | 234 |
| 139 | iso_pu_bacteria | 2946013367 | 2946016927 | 234 |
| 140 | 3300009545 | Ga0105237_10007233 | Ga0105237_100072339 | 235 |
| 141 | 3300025272 | Ga0209455_1004518 | Ga0209455_10045184 | 235 |
| 142 | 3300025914 | Ga0207671_10004263 | Ga0207671_1000426312 | 235 |
| 143 | 3300048918 | Ga0496115_0121040 | Ga0496115_0121040_539_1294 | 235 |
| 144 | 3300014969 | Ga0157376_10158383 | Ga0157376_101583832 | 236 |
| 145 | 3300044658 | Ga0466972_0105570 | Ga0466972_0105570_122_871 | 236 |
| 146 | 3300013306 | Ga0163162_10591449 | Ga0163162_105914492 | 237 |
| 147 | 3300005530 | Ga0070679_100128370 | Ga0070679_1001283702 | 238 |
| 148 | 3300013296 | Ga0157374_10633810 | Ga0157374_106338101 | 238 |
| 149 | 3300013306 | Ga0163162_10559152 | Ga0163162_105591521 | 238 |
| 150 | 3300025921 | Ga0207652_10101134 | Ga0207652_101011341 | 238 |
| 151 | 3300003316 | rootH1_10104481 | rootH1_101044812 | 239 |
| 152 | 3300003320 | rootH2_10191691 | rootH2_101916914 | 239 |
| 153 | 3300003323 | rootH1_10112358 | rootH1_101123587 | 239 |
| 154 | 3300049741 | Ga0501079_0727771 | Ga0501079_0727771_44_769 | 239 |
| 155 | 3300005843 | Ga0068860_100072581 | Ga0068860_1000725813 | 240 |
| 156 | 3300009093 | Ga0105240_10452127 | Ga0105240_104521271 | 240 |
| 157 | 3300025925 | Ga0207650_10650417 | Ga0207650_106504172 | 240 |
| 158 | 3300026041 | Ga0207639_10502938 | Ga0207639_105029382 | 240 |
| 159 | 3300026089 | Ga0207648_10053122 | Ga0207648_100531224 | 240 |
| 160 | 3300026095 | Ga0207676_10229463 | Ga0207676_102294632 | 240 |
| 161 | 3300026116 | Ga0207674_10914515 | Ga0207674_109145151 | 240 |
| 162 | 3300028381 | Ga0268264_10002439 | Ga0268264_100024393 | 240 |
| 163 | 3300053131 | Ga0500652_016281 | Ga0500652_016281_826_1575 | 240 |
| 164 | 3300053139 | Ga0500568_0032490 | Ga0500568_0032490_160_909 | 240 |
| 165 | 3300005329 | Ga0070683_100011222 | Ga0070683_1000112223 | 241 |
| 166 | 3300005535 | Ga0070684_100028964 | Ga0070684_1000289643 | 241 |
| 167 | 3300013306 | Ga0163162_10164531 | Ga0163162_101645314 | 241 |
| 168 | 3300025302 | Ga0207426_1038024 | Ga0207426_10380241 | 241 |
| 169 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001783 | 242 |
| 170 | 3300002738 | JGI25154J39366_1000044 | JGI25154J39366_100004488 | 243 |
| 171 | 3300005563 | Ga0068855_100244936 | Ga0068855_1002449363 | 243 |
| 172 | 3300014325 | Ga0163163_10416238 | Ga0163163_104162382 | 243 |
| 173 | 3300025246 | Ga0209646_1000006 | Ga0209646_1000006320 | 243 |
| 174 | 3300025250 | Ga0209026_1000262 | Ga0209026_100026239 | 243 |
| 175 | iso_pu_bacteria | 2884791551 | 2884792791 | 243 |
| 176 | iso_pu_bacteria | 2886627955 | 2886628836 | 244 |
| 177 | 3300003323 | rootH1_10154623 | rootH1_101546233 | 245 |
| 178 | 3300005539 | Ga0068853_100001368 | Ga0068853_1000013684 | 245 |
| 179 | 3300005577 | Ga0068857_100505751 | Ga0068857_1005057511 | 245 |
| 180 | 3300009093 | Ga0105240_10167551 | Ga0105240_101675512 | 245 |
| 181 | 3300009174 | Ga0105241_10825965 | Ga0105241_108259651 | 245 |
| 182 | 3300009545 | Ga0105237_10680015 | Ga0105237_106800151 | 245 |
| 183 | 3300009551 | Ga0105238_10018910 | Ga0105238_100189102 | 245 |
| 184 | 3300010375 | Ga0105239_10008727 | Ga0105239_100087275 | 245 |
| 185 | 3300025913 | Ga0207695_10049375 | Ga0207695_100493754 | 245 |
| 186 | 3300046660 | Ga0495625_0096223 | Ga0495625_0096223_922_1668 | 245 |
| 187 | 3300049583 | Ga0501067_0102960 | Ga0501067_0102960_366_1181 | 245 |
| 188 | 3300054114 | Ga0501084_0004894 | Ga0501084_0004894_10104_10919 | 245 |
| 189 | iso_pu_bacteria | 2818991460 | 2819681539 | 245 |
| 190 | iso_pu_bacteria | 2929921140 | 2929925027 | 245 |
| 191 | iso_pu_bacteria | 8003151029 | 8003157397 | 245 |
| 192 | 3300005578 | Ga0068854_100019070 | Ga0068854_1000190705 | 246 |
| 193 | 3300009093 | Ga0105240_10012550 | Ga0105240_100125504 | 246 |
| 194 | 3300009174 | Ga0105241_10012190 | Ga0105241_100121902 | 246 |
| 195 | 3300010375 | Ga0105239_10003229 | Ga0105239_1000322924 | 246 |
| 196 | 3300025913 | Ga0207695_10154492 | Ga0207695_101544921 | 246 |
| 197 | 3300026078 | Ga0207702_10620940 | Ga0207702_106209401 | 246 |
| 198 | 3300031251 | Ga0265327_10000048 | Ga0265327_1000004893 | 246 |
| 199 | 3300031251 | Ga0265327_10102895 | Ga0265327_101028952 | 246 |
| 200 | 3300003322 | rootL2_10196379 | rootL2_101963792 | 247 |
| 201 | 3300004799 | Ga0058863_11690196 | Ga0058863_116901962 | 247 |
| 202 | 3300005327 | Ga0070658_10030999 | Ga0070658_100309992 | 247 |
| 203 | 3300005335 | Ga0070666_10117578 | Ga0070666_101175781 | 247 |
| 204 | 3300005355 | Ga0070671_100005460 | Ga0070671_1000054605 | 247 |
| 205 | 3300005530 | Ga0070679_100051407 | Ga0070679_1000514074 | 247 |
| 206 | 3300005530 | Ga0070679_100586346 | Ga0070679_1005863461 | 247 |
| 207 | 3300005563 | Ga0068855_100306734 | Ga0068855_1003067342 | 247 |
| 208 | 3300005614 | Ga0068856_100021104 | Ga0068856_1000211044 | 247 |
| 209 | 3300005614 | Ga0068856_100055918 | Ga0068856_1000559186 | 247 |
| 210 | 3300005718 | Ga0068866_10499861 | Ga0068866_104998611 | 247 |
| 211 | 3300006237 | Ga0097621_100000606 | Ga0097621_10000060624 | 247 |
| 212 | 3300006358 | Ga0068871_100000334 | Ga0068871_1000003349 | 247 |
| 213 | 3300009093 | Ga0105240_10000010 | Ga0105240_10000010365 | 247 |
| 214 | 3300009174 | Ga0105241_10033338 | Ga0105241_100333383 | 247 |
| 215 | 3300009545 | Ga0105237_10000227 | Ga0105237_1000022724 | 247 |
| 216 | 3300009545 | Ga0105237_10318064 | Ga0105237_103180642 | 247 |
| 217 | 3300010375 | Ga0105239_10002474 | Ga0105239_1000247414 | 247 |
| 218 | 3300013104 | Ga0157370_10290268 | Ga0157370_102902682 | 247 |
| 219 | 3300013297 | Ga0157378_10003577 | Ga0157378_100035774 | 247 |
| 220 | 3300013306 | Ga0163162_10000214 | Ga0163162_1000021413 | 247 |
| 221 | 3300013306 | Ga0163162_10004601 | Ga0163162_100046015 | 247 |
| 222 | 3300014968 | Ga0157379_10006414 | Ga0157379_100064149 | 247 |
| 223 | 3300014969 | Ga0157376_10001900 | Ga0157376_1000190011 | 247 |
| 224 | 3300017792 | Ga0163161_10007441 | Ga0163161_100074412 | 247 |
| 225 | 3300025903 | Ga0207680_10188301 | Ga0207680_101883012 | 247 |
| 226 | 3300025909 | Ga0207705_10027566 | Ga0207705_100275662 | 247 |
| 227 | 3300025911 | Ga0207654_10002076 | Ga0207654_100020762 | 247 |
| 228 | 3300025911 | Ga0207654_10002638 | Ga0207654_100026385 | 247 |
| 229 | 3300025913 | Ga0207695_10000019 | Ga0207695_1000001991 | 247 |
| 230 | 3300025913 | Ga0207695_10002809 | Ga0207695_1000280917 | 247 |
| 231 | 3300025913 | Ga0207695_10564871 | Ga0207695_105648712 | 247 |
| 232 | 3300025914 | Ga0207671_10000515 | Ga0207671_1000051538 | 247 |
| 233 | 3300025914 | Ga0207671_10001507 | Ga0207671_1000150718 | 247 |
| 234 | 3300025921 | Ga0207652_10038532 | Ga0207652_100385322 | 247 |
| 235 | 3300025931 | Ga0207644_10007168 | Ga0207644_100071682 | 247 |
| 236 | 3300025986 | Ga0207658_10012271 | Ga0207658_100122713 | 247 |
| 237 | 3300026078 | Ga0207702_10009624 | Ga0207702_100096245 | 247 |
| 238 | 3300026078 | Ga0207702_10041386 | Ga0207702_100413863 | 247 |
| 239 | 3300026121 | Ga0207683_10127576 | Ga0207683_101275762 | 247 |
| 240 | 3300026142 | Ga0207698_10064122 | Ga0207698_100641223 | 247 |
| 241 | 3300028800 | Ga0265338_10188139 | Ga0265338_101881392 | 247 |
| 242 | 3300048904 | Ga0496101_0019332 | Ga0496101_0019332_3147_3911 | 247 |
| 243 | 3300048907 | Ga0496104_0315165 | Ga0496104_0315165_250_1014 | 247 |
| 244 | 2162886011 | MRS1b_contig_2063463 | MRS1b_0353.00003400 | 248 |
| 245 | 3300001991 | JGI24743J22301_10009620 | JGI24743J22301_100096202 | 248 |
| 246 | 3300002077 | JGI24744J21845_10019369 | JGI24744J21845_100193692 | 248 |
| 247 | 3300002737 | JGI25162J39368_1000688 | JGI25162J39368_100068825 | 248 |
| 248 | 3300002772 | JGI25164J39214_1001043 | JGI25164J39214_10010439 | 248 |
| 249 | 3300003214 | JGI25165J46597_1003733 | JGI25165J46597_10037334 | 248 |
| 250 | 3300003215 | JGI25153J46596_10003613 | JGI25153J46596_100036135 | 248 |
| 251 | 3300003320 | rootH2_10002197 | rootH2_100021972 | 248 |
| 252 | 3300003320 | rootH2_10013265 | rootH2_100132655 | 248 |
| 253 | 3300003320 | rootH2_10230854 | rootH2_102308542 | 248 |
| 254 | 3300003322 | rootL2_10222192 | rootL2_102221923 | 248 |
| 255 | 3300003323 | rootH1_10001276 | rootH1_1000127636 | 248 |
| 256 | 3300003323 | rootH1_10052168 | rootH1_100521683 | 248 |
| 257 | 3300003323 | rootH1_10097619 | rootH1_100976192 | 248 |
| 258 | 3300003323 | rootH1_10338497 | rootH1_103384972 | 248 |
| 259 | 3300003323 | rootH1_10365013 | rootH1_103650132 | 248 |
| 260 | 3300003354 | JGI25160J50197_1004606 | JGI25160J50197_10046065 | 248 |
| 261 | 3300003354 | JGI25160J50197_1005692 | JGI25160J50197_10056924 | 248 |
| 262 | 3300005262 | Ga0065165_1019675 | Ga0065165_10196752 | 248 |
| 263 | 3300005327 | Ga0070658_10077787 | Ga0070658_100777874 | 248 |
| 264 | 3300005329 | Ga0070683_100026642 | Ga0070683_1000266424 | 248 |
| 265 | 3300005330 | Ga0070690_100040887 | Ga0070690_1000408872 | 248 |
| 266 | 3300005330 | Ga0070690_100079612 | Ga0070690_1000796122 | 248 |
| 267 | 3300005331 | Ga0070670_100073904 | Ga0070670_1000739042 | 248 |
| 268 | 3300005331 | Ga0070670_100261710 | Ga0070670_1002617102 | 248 |
| 269 | 3300005334 | Ga0068869_100004728 | Ga0068869_1000047289 | 248 |
| 270 | 3300005335 | Ga0070666_10000101 | Ga0070666_1000010123 | 248 |
| 271 | 3300005335 | Ga0070666_10015846 | Ga0070666_100158463 | 248 |
| 272 | 3300005335 | Ga0070666_10053096 | Ga0070666_100530963 | 248 |
| 273 | 3300005336 | Ga0070680_100000075 | Ga0070680_10000007532 | 248 |
| 274 | 3300005336 | Ga0070680_100049001 | Ga0070680_1000490013 | 248 |
| 275 | 3300005337 | Ga0070682_100000008 | Ga0070682_10000000896 | 248 |
| 276 | 3300005337 | Ga0070682_100000628 | Ga0070682_10000062818 | 248 |
| 277 | 3300005337 | Ga0070682_100025853 | Ga0070682_1000258533 | 248 |
| 278 | 3300005338 | Ga0068868_100000543 | Ga0068868_1000005434 | 248 |
| 279 | 3300005338 | Ga0068868_100041244 | Ga0068868_1000412443 | 248 |
| 280 | 3300005338 | Ga0068868_100051895 | Ga0068868_1000518953 | 248 |
| 281 | 3300005338 | Ga0068868_100053733 | Ga0068868_1000537334 | 248 |
| 282 | 3300005338 | Ga0068868_100139933 | Ga0068868_1001399331 | 248 |
| 283 | 3300005338 | Ga0068868_100232424 | Ga0068868_1002324241 | 248 |
| 284 | 3300005338 | Ga0068868_100373728 | Ga0068868_1003737282 | 248 |
| 285 | 3300005338 | Ga0068868_100426069 | Ga0068868_1004260692 | 248 |
| 286 | 3300005338 | Ga0068868_100673307 | Ga0068868_1006733071 | 248 |
| 287 | 3300005339 | Ga0070660_100007461 | Ga0070660_1000074616 | 248 |
| 288 | 3300005340 | Ga0070689_100009325 | Ga0070689_1000093251 | 248 |
| 289 | 3300005340 | Ga0070689_100022142 | Ga0070689_1000221425 | 248 |
| 290 | 3300005341 | Ga0070691_10000522 | Ga0070691_100005226 | 248 |
| 291 | 3300005344 | Ga0070661_100011271 | Ga0070661_1000112713 | 248 |
| 292 | 3300005344 | Ga0070661_100019628 | Ga0070661_1000196283 | 248 |
| 293 | 3300005344 | Ga0070661_100334427 | Ga0070661_1003344272 | 248 |
| 294 | 3300005347 | Ga0070668_100139122 | Ga0070668_1001391222 | 248 |
| 295 | 3300005347 | Ga0070668_100179030 | Ga0070668_1001790302 | 248 |
| 296 | 3300005353 | Ga0070669_100027806 | Ga0070669_1000278063 | 248 |
| 297 | 3300005354 | Ga0070675_100047970 | Ga0070675_1000479702 | 248 |
| 298 | 3300005354 | Ga0070675_100077145 | Ga0070675_1000771452 | 248 |
| 299 | 3300005355 | Ga0070671_100049820 | Ga0070671_1000498202 | 248 |
| 300 | 3300005355 | Ga0070671_100090307 | Ga0070671_1000903072 | 248 |
| 301 | 3300005355 | Ga0070671_100144949 | Ga0070671_1001449492 | 248 |
| 302 | 3300005355 | Ga0070671_100601032 | Ga0070671_1006010321 | 248 |
| 303 | 3300005364 | Ga0070673_100030800 | Ga0070673_1000308002 | 248 |
| 304 | 3300005364 | Ga0070673_100043944 | Ga0070673_1000439442 | 248 |
| 305 | 3300005365 | Ga0070688_100005011 | Ga0070688_1000050117 | 248 |
| 306 | 3300005365 | Ga0070688_100010942 | Ga0070688_1000109427 | 248 |
| 307 | 3300005366 | Ga0070659_100026039 | Ga0070659_1000260393 | 248 |
| 308 | 3300005366 | Ga0070659_100151898 | Ga0070659_1001518981 | 248 |
| 309 | 3300005367 | Ga0070667_100021007 | Ga0070667_1000210074 | 248 |
| 310 | 3300005367 | Ga0070667_100060561 | Ga0070667_1000605612 | 248 |
| 311 | 3300005367 | Ga0070667_100108083 | Ga0070667_1001080834 | 248 |
| 312 | 3300005455 | Ga0070663_100223193 | Ga0070663_1002231931 | 248 |
| 313 | 3300005457 | Ga0070662_100038027 | Ga0070662_1000380275 | 248 |
| 314 | 3300005457 | Ga0070662_100073798 | Ga0070662_1000737982 | 248 |
| 315 | 3300005457 | Ga0070662_100079156 | Ga0070662_1000791562 | 248 |
| 316 | 3300005457 | Ga0070662_100097015 | Ga0070662_1000970153 | 248 |
| 317 | 3300005457 | Ga0070662_100146349 | Ga0070662_1001463492 | 248 |
| 318 | 3300005458 | Ga0070681_10458403 | Ga0070681_104584032 | 248 |
| 319 | 3300005459 | Ga0068867_100015760 | Ga0068867_1000157602 | 248 |
| 320 | 3300005459 | Ga0068867_100079740 | Ga0068867_1000797403 | 248 |
| 321 | 3300005459 | Ga0068867_100476132 | Ga0068867_1004761322 | 248 |
| 322 | 3300005459 | Ga0068867_100629143 | Ga0068867_1006291431 | 248 |
| 323 | 3300005466 | Ga0070685_10205011 | Ga0070685_102050111 | 248 |
| 324 | 3300005530 | Ga0070679_100000892 | Ga0070679_10000089213 | 248 |
| 325 | 3300005530 | Ga0070679_100117894 | Ga0070679_1001178942 | 248 |
| 326 | 3300005530 | Ga0070679_100189896 | Ga0070679_1001898962 | 248 |
| 327 | 3300005535 | Ga0070684_100022795 | Ga0070684_1000227952 | 248 |
| 328 | 3300005535 | Ga0070684_100070959 | Ga0070684_1000709592 | 248 |
| 329 | 3300005535 | Ga0070684_100253583 | Ga0070684_1002535832 | 248 |
| 330 | 3300005535 | Ga0070684_100402297 | Ga0070684_1004022971 | 248 |
| 331 | 3300005539 | Ga0068853_100004852 | Ga0068853_1000048525 | 248 |
| 332 | 3300005539 | Ga0068853_100045996 | Ga0068853_1000459963 | 248 |
| 333 | 3300005539 | Ga0068853_100087849 | Ga0068853_1000878493 | 248 |
| 334 | 3300005539 | Ga0068853_100517052 | Ga0068853_1005170522 | 248 |
| 335 | 3300005539 | Ga0068853_100555712 | Ga0068853_1005557121 | 248 |
| 336 | 3300005543 | Ga0070672_100124457 | Ga0070672_1001244572 | 248 |
| 337 | 3300005544 | Ga0070686_100290334 | Ga0070686_1002903341 | 248 |
| 338 | 3300005547 | Ga0070693_100047893 | Ga0070693_1000478932 | 248 |
| 339 | 3300005548 | Ga0070665_100000052 | Ga0070665_10000005264 | 248 |
| 340 | 3300005563 | Ga0068855_100000041 | Ga0068855_100000041100 | 248 |
| 341 | 3300005563 | Ga0068855_100111620 | Ga0068855_1001116203 | 248 |
| 342 | 3300005563 | Ga0068855_100140750 | Ga0068855_1001407502 | 248 |
| 343 | 3300005564 | Ga0070664_100010888 | Ga0070664_1000108884 | 248 |
| 344 | 3300005564 | Ga0070664_100011721 | Ga0070664_1000117219 | 248 |
| 345 | 3300005564 | Ga0070664_100047316 | Ga0070664_1000473163 | 248 |
| 346 | 3300005564 | Ga0070664_100100310 | Ga0070664_1001003102 | 248 |
| 347 | 3300005564 | Ga0070664_100380831 | Ga0070664_1003808312 | 248 |
| 348 | 3300005578 | Ga0068854_100077604 | Ga0068854_1000776043 | 248 |
| 349 | 3300005578 | Ga0068854_100077861 | Ga0068854_1000778612 | 248 |
| 350 | 3300005614 | Ga0068856_100000204 | Ga0068856_10000020444 | 248 |
| 351 | 3300005614 | Ga0068856_100044321 | Ga0068856_1000443213 | 248 |
| 352 | 3300005615 | Ga0070702_100081623 | Ga0070702_1000816232 | 248 |
| 353 | 3300005616 | Ga0068852_100005196 | Ga0068852_1000051964 | 248 |
| 354 | 3300005616 | Ga0068852_100048454 | Ga0068852_1000484545 | 248 |
| 355 | 3300005616 | Ga0068852_100071912 | Ga0068852_1000719123 | 248 |
| 356 | 3300005616 | Ga0068852_100149714 | Ga0068852_1001497142 | 248 |
| 357 | 3300005617 | Ga0068859_100000007 | Ga0068859_100000007140 | 248 |
| 358 | 3300005617 | Ga0068859_100007965 | Ga0068859_1000079659 | 248 |
| 359 | 3300005617 | Ga0068859_100010183 | Ga0068859_1000101834 | 248 |
| 360 | 3300005618 | Ga0068864_100006739 | Ga0068864_1000067393 | 248 |
| 361 | 3300005618 | Ga0068864_100019953 | Ga0068864_1000199533 | 248 |
| 362 | 3300005618 | Ga0068864_100051718 | Ga0068864_1000517185 | 248 |
| 363 | 3300005719 | Ga0068861_100276430 | Ga0068861_1002764302 | 248 |
| 364 | 3300005719 | Ga0068861_100276520 | Ga0068861_1002765202 | 248 |
| 365 | 3300005841 | Ga0068863_100013437 | Ga0068863_1000134372 | 248 |
| 366 | 3300005841 | Ga0068863_100243676 | Ga0068863_1002436762 | 248 |
| 367 | 3300005841 | Ga0068863_100281736 | Ga0068863_1002817362 | 248 |
| 368 | 3300005841 | Ga0068863_101086932 | Ga0068863_1010869321 | 248 |
| 369 | 3300005842 | Ga0068858_100004375 | Ga0068858_1000043759 | 248 |
| 370 | 3300005842 | Ga0068858_100028234 | Ga0068858_1000282342 | 248 |
| 371 | 3300005842 | Ga0068858_100567197 | Ga0068858_1005671972 | 248 |
| 372 | 3300005843 | Ga0068860_100000004 | Ga0068860_100000004319 | 248 |
| 373 | 3300005843 | Ga0068860_100001504 | Ga0068860_10000150417 | 248 |
| 374 | 3300005843 | Ga0068860_100006976 | Ga0068860_1000069766 | 248 |
| 375 | 3300005843 | Ga0068860_100009791 | Ga0068860_1000097916 | 248 |
| 376 | 3300005843 | Ga0068860_100021982 | Ga0068860_1000219824 | 248 |
| 377 | 3300005843 | Ga0068860_100053680 | Ga0068860_1000536802 | 248 |
| 378 | 3300005844 | Ga0068862_100165726 | Ga0068862_1001657262 | 248 |
| 379 | 3300005983 | Ga0081540_1008682 | Ga0081540_10086822 | 248 |
| 380 | 3300006237 | Ga0097621_100061528 | Ga0097621_1000615281 | 248 |
| 381 | 3300006237 | Ga0097621_100143073 | Ga0097621_1001430732 | 248 |
| 382 | 3300006237 | Ga0097621_100284257 | Ga0097621_1002842571 | 248 |
| 383 | 3300006358 | Ga0068871_100013793 | Ga0068871_1000137935 | 248 |
| 384 | 3300006358 | Ga0068871_100032752 | Ga0068871_1000327522 | 248 |
| 385 | 3300006358 | Ga0068871_100037552 | Ga0068871_1000375522 | 248 |
| 386 | 3300006358 | Ga0068871_100042670 | Ga0068871_1000426705 | 248 |
| 387 | 3300006358 | Ga0068871_100109512 | Ga0068871_1001095122 | 248 |
| 388 | 3300006358 | Ga0068871_100179060 | Ga0068871_1001790603 | 248 |
| 389 | 3300006358 | Ga0068871_100201182 | Ga0068871_1002011822 | 248 |
| 390 | 3300006871 | Ga0075434_100715952 | Ga0075434_1007159521 | 248 |
| 391 | 3300006881 | Ga0068865_100045392 | Ga0068865_1000453922 | 248 |
| 392 | 3300006881 | Ga0068865_100363701 | Ga0068865_1003637012 | 248 |
| 393 | 3300006931 | Ga0097620_100000007 | Ga0097620_100000007141 | 248 |
| 394 | 3300006931 | Ga0097620_100007965 | Ga0097620_1000079659 | 248 |
| 395 | 3300006931 | Ga0097620_100010184 | Ga0097620_1000101847 | 248 |
| 396 | 3300009093 | Ga0105240_10000061 | Ga0105240_10000061150 | 248 |
| 397 | 3300009093 | Ga0105240_10001967 | Ga0105240_1000196719 | 248 |
| 398 | 3300009093 | Ga0105240_10051059 | Ga0105240_100510592 | 248 |
| 399 | 3300009093 | Ga0105240_10064030 | Ga0105240_100640302 | 248 |
| 400 | 3300009093 | Ga0105240_10441528 | Ga0105240_104415282 | 248 |
| 401 | 3300009101 | Ga0105247_10033116 | Ga0105247_100331162 | 248 |
| 402 | 3300009101 | Ga0105247_10213782 | Ga0105247_102137822 | 248 |
| 403 | 3300009174 | Ga0105241_10000206 | Ga0105241_1000020643 | 248 |
| 404 | 3300009174 | Ga0105241_10000622 | Ga0105241_1000062218 | 248 |
| 405 | 3300009174 | Ga0105241_10003350 | Ga0105241_100033508 | 248 |
| 406 | 3300009176 | Ga0105242_10014851 | Ga0105242_100148514 | 248 |
| 407 | 3300009176 | Ga0105242_10046006 | Ga0105242_100460063 | 248 |
| 408 | 3300009176 | Ga0105242_10866673 | Ga0105242_108666731 | 248 |
| 409 | 3300009177 | Ga0105248_10860398 | Ga0105248_108603982 | 248 |
| 410 | 3300009177 | Ga0105248_11167562 | Ga0105248_111675621 | 248 |
| 411 | 3300009545 | Ga0105237_10001595 | Ga0105237_1000159514 | 248 |
| 412 | 3300009545 | Ga0105237_10002803 | Ga0105237_100028034 | 248 |
| 413 | 3300009545 | Ga0105237_10006073 | Ga0105237_100060738 | 248 |
| 414 | 3300009545 | Ga0105237_10017867 | Ga0105237_100178673 | 248 |
| 415 | 3300009545 | Ga0105237_10084161 | Ga0105237_100841613 | 248 |
| 416 | 3300009545 | Ga0105237_10200402 | Ga0105237_102004022 | 248 |
| 417 | 3300009551 | Ga0105238_10081376 | Ga0105238_100813763 | 248 |
| 418 | 3300009551 | Ga0105238_10174489 | Ga0105238_101744892 | 248 |
| 419 | 3300009551 | Ga0105238_10728824 | Ga0105238_107288241 | 248 |
| 420 | 3300009553 | Ga0105249_10009474 | Ga0105249_100094743 | 248 |
| 421 | 3300009553 | Ga0105249_10067153 | Ga0105249_100671531 | 248 |
| 422 | 3300009553 | Ga0105249_10601587 | Ga0105249_106015872 | 248 |
| 423 | 3300009553 | Ga0105249_11007363 | Ga0105249_110073631 | 248 |
| 424 | 3300010375 | Ga0105239_10000017 | Ga0105239_10000017105 | 248 |
| 425 | 3300010375 | Ga0105239_10000126 | Ga0105239_1000012615 | 248 |
| 426 | 3300010375 | Ga0105239_10000566 | Ga0105239_1000056627 | 248 |
| 427 | 3300010375 | Ga0105239_10000958 | Ga0105239_1000095832 | 248 |
| 428 | 3300010375 | Ga0105239_10002026 | Ga0105239_1000202626 | 248 |
| 429 | 3300010375 | Ga0105239_10273728 | Ga0105239_102737283 | 248 |
| 430 | 3300011119 | Ga0105246_10188980 | Ga0105246_101889802 | 248 |
| 431 | 3300013100 | Ga0157373_10046724 | Ga0157373_100467243 | 248 |
| 432 | 3300013102 | Ga0157371_10000548 | Ga0157371_1000054840 | 248 |
| 433 | 3300013102 | Ga0157371_10064165 | Ga0157371_100641651 | 248 |
| 434 | 3300013102 | Ga0157371_10162604 | Ga0157371_101626041 | 248 |
| 435 | 3300013102 | Ga0157371_10286653 | Ga0157371_102866532 | 248 |
| 436 | 3300013104 | Ga0157370_10000426 | Ga0157370_1000042632 | 248 |
| 437 | 3300013104 | Ga0157370_10050996 | Ga0157370_100509963 | 248 |
| 438 | 3300013104 | Ga0157370_10196276 | Ga0157370_101962761 | 248 |
| 439 | 3300013105 | Ga0157369_10013765 | Ga0157369_100137653 | 248 |
| 440 | 3300013105 | Ga0157369_10101052 | Ga0157369_101010522 | 248 |
| 441 | 3300013105 | Ga0157369_10192759 | Ga0157369_101927591 | 248 |
| 442 | 3300013296 | Ga0157374_10013422 | Ga0157374_100134227 | 248 |
| 443 | 3300013296 | Ga0157374_10031377 | Ga0157374_100313772 | 248 |
| 444 | 3300013296 | Ga0157374_10081757 | Ga0157374_100817572 | 248 |
| 445 | 3300013296 | Ga0157374_10134490 | Ga0157374_101344904 | 248 |
| 446 | 3300013296 | Ga0157374_10157323 | Ga0157374_101573232 | 248 |
| 447 | 3300013297 | Ga0157378_10001036 | Ga0157378_1000103617 | 248 |
| 448 | 3300013297 | Ga0157378_10009825 | Ga0157378_100098254 | 248 |
| 449 | 3300013297 | Ga0157378_10058008 | Ga0157378_100580082 | 248 |
| 450 | 3300013297 | Ga0157378_10059847 | Ga0157378_100598472 | 248 |
| 451 | 3300013297 | Ga0157378_10118781 | Ga0157378_101187813 | 248 |
| 452 | 3300013297 | Ga0157378_10247866 | Ga0157378_102478662 | 248 |
| 453 | 3300013297 | Ga0157378_10254136 | Ga0157378_102541362 | 248 |
| 454 | 3300013306 | Ga0163162_10000746 | Ga0163162_100007464 | 248 |
| 455 | 3300013306 | Ga0163162_10008000 | Ga0163162_100080003 | 248 |
| 456 | 3300013306 | Ga0163162_10028558 | Ga0163162_100285584 | 248 |
| 457 | 3300013306 | Ga0163162_10033319 | Ga0163162_100333192 | 248 |
| 458 | 3300013306 | Ga0163162_10061096 | Ga0163162_100610962 | 248 |
| 459 | 3300013306 | Ga0163162_10065099 | Ga0163162_100650994 | 248 |
| 460 | 3300013306 | Ga0163162_10070938 | Ga0163162_100709382 | 248 |
| 461 | 3300013306 | Ga0163162_10555151 | Ga0163162_105551512 | 248 |
| 462 | 3300013307 | Ga0157372_10001870 | Ga0157372_1000187015 | 248 |
| 463 | 3300013307 | Ga0157372_10102911 | Ga0157372_101029112 | 248 |
| 464 | 3300013307 | Ga0157372_10127330 | Ga0157372_101273302 | 248 |
| 465 | 3300013307 | Ga0157372_10137662 | Ga0157372_101376622 | 248 |
| 466 | 3300013307 | Ga0157372_10182637 | Ga0157372_101826373 | 248 |
| 467 | 3300013307 | Ga0157372_10352840 | Ga0157372_103528402 | 248 |
| 468 | 3300013308 | Ga0157375_10015416 | Ga0157375_100154163 | 248 |
| 469 | 3300013308 | Ga0157375_10017332 | Ga0157375_100173327 | 248 |
| 470 | 3300013308 | Ga0157375_10075094 | Ga0157375_100750942 | 248 |
| 471 | 3300013308 | Ga0157375_10159592 | Ga0157375_101595922 | 248 |
| 472 | 3300013308 | Ga0157375_10531535 | Ga0157375_105315351 | 248 |
| 473 | 3300014325 | Ga0163163_10022878 | Ga0163163_100228782 | 248 |
| 474 | 3300014325 | Ga0163163_10028496 | Ga0163163_100284967 | 248 |
| 475 | 3300014325 | Ga0163163_10039355 | Ga0163163_100393552 | 248 |
| 476 | 3300014325 | Ga0163163_10808033 | Ga0163163_108080331 | 248 |
| 477 | 3300014326 | Ga0157380_10508528 | Ga0157380_105085282 | 248 |
| 478 | 3300014745 | Ga0157377_10062341 | Ga0157377_100623413 | 248 |
| 479 | 3300014968 | Ga0157379_10098454 | Ga0157379_100984542 | 248 |
| 480 | 3300014968 | Ga0157379_10176329 | Ga0157379_101763292 | 248 |
| 481 | 3300014969 | Ga0157376_10002389 | Ga0157376_100023894 | 248 |
| 482 | 3300014969 | Ga0157376_10048874 | Ga0157376_100488743 | 248 |
| 483 | 3300014969 | Ga0157376_10145558 | Ga0157376_101455582 | 248 |
| 484 | 3300014969 | Ga0157376_10168006 | Ga0157376_101680062 | 248 |
| 485 | 3300014969 | Ga0157376_10243315 | Ga0157376_102433152 | 248 |
| 486 | 3300017792 | Ga0163161_10139421 | Ga0163161_101394212 | 248 |
| 487 | 3300017792 | Ga0163161_10472952 | Ga0163161_104729522 | 248 |
| 488 | 3300025230 | Ga0209563_106089 | Ga0209563_1060893 | 248 |
| 489 | 3300025231 | Ga0207427_100138 | Ga0207427_10013818 | 248 |
| 490 | 3300025233 | Ga0209437_100010 | Ga0209437_10001083 | 248 |
| 491 | 3300025261 | Ga0209233_1000017 | Ga0209233_100001796 | 248 |
| 492 | 3300025297 | Ga0209758_1009028 | Ga0209758_10090283 | 248 |
| 493 | 3300025302 | Ga0207426_1000060 | Ga0207426_1000060175 | 248 |
| 494 | 3300025302 | Ga0207426_1000157 | Ga0207426_1000157125 | 248 |
| 495 | 3300025900 | Ga0207710_10090245 | Ga0207710_100902452 | 248 |
| 496 | 3300025903 | Ga0207680_10001183 | Ga0207680_100011834 | 248 |
| 497 | 3300025903 | Ga0207680_10015875 | Ga0207680_100158752 | 248 |
| 498 | 3300025903 | Ga0207680_10016256 | Ga0207680_100162562 | 248 |
| 499 | 3300025904 | Ga0207647_10052617 | Ga0207647_100526172 | 248 |
| 500 | 3300025904 | Ga0207647_10168329 | Ga0207647_101683292 | 248 |
| 501 | 3300025904 | Ga0207647_10172270 | Ga0207647_101722702 | 248 |
| 502 | 3300025907 | Ga0207645_10021368 | Ga0207645_100213683 | 248 |
| 503 | 3300025911 | Ga0207654_10004110 | Ga0207654_100041106 | 248 |
| 504 | 3300025911 | Ga0207654_10010271 | Ga0207654_100102715 | 248 |
| 505 | 3300025912 | Ga0207707_10000111 | Ga0207707_1000011132 | 248 |
| 506 | 3300025912 | Ga0207707_10092681 | Ga0207707_100926812 | 248 |
| 507 | 3300025912 | Ga0207707_10108977 | Ga0207707_101089772 | 248 |
| 508 | 3300025913 | Ga0207695_10000057 | Ga0207695_10000057252 | 248 |
| 509 | 3300025913 | Ga0207695_10000068 | Ga0207695_10000068153 | 248 |
| 510 | 3300025913 | Ga0207695_10022478 | Ga0207695_100224784 | 248 |
| 511 | 3300025913 | Ga0207695_10050172 | Ga0207695_100501722 | 248 |
| 512 | 3300025914 | Ga0207671_10001648 | Ga0207671_1000164817 | 248 |
| 513 | 3300025914 | Ga0207671_10007231 | Ga0207671_100072317 | 248 |
| 514 | 3300025914 | Ga0207671_10020022 | Ga0207671_100200226 | 248 |
| 515 | 3300025914 | Ga0207671_10032780 | Ga0207671_100327802 | 248 |
| 516 | 3300025917 | Ga0207660_10021100 | Ga0207660_100211002 | 248 |
| 517 | 3300025917 | Ga0207660_10054559 | Ga0207660_100545592 | 248 |
| 518 | 3300025919 | Ga0207657_10014655 | Ga0207657_100146553 | 248 |
| 519 | 3300025920 | Ga0207649_10047637 | Ga0207649_100476372 | 248 |
| 520 | 3300025920 | Ga0207649_10052351 | Ga0207649_100523512 | 248 |
| 521 | 3300025921 | Ga0207652_10000538 | Ga0207652_1000053839 | 248 |
| 522 | 3300025921 | Ga0207652_10053384 | Ga0207652_100533842 | 248 |
| 523 | 3300025923 | Ga0207681_10079696 | Ga0207681_100796963 | 248 |
| 524 | 3300025924 | Ga0207694_10142483 | Ga0207694_101424832 | 248 |
| 525 | 3300025924 | Ga0207694_10461784 | Ga0207694_104617842 | 248 |
| 526 | 3300025925 | Ga0207650_10101974 | Ga0207650_101019743 | 248 |
| 527 | 3300025925 | Ga0207650_10269473 | Ga0207650_102694732 | 248 |
| 528 | 3300025926 | Ga0207659_10116136 | Ga0207659_101161362 | 248 |
| 529 | 3300025926 | Ga0207659_10461968 | Ga0207659_104619682 | 248 |
| 530 | 3300025931 | Ga0207644_10079906 | Ga0207644_100799062 | 248 |
| 531 | 3300025931 | Ga0207644_10215029 | Ga0207644_102150292 | 248 |
| 532 | 3300025932 | Ga0207690_10019756 | Ga0207690_100197562 | 248 |
| 533 | 3300025933 | Ga0207706_10008179 | Ga0207706_100081794 | 248 |
| 534 | 3300025933 | Ga0207706_10020230 | Ga0207706_100202303 | 248 |
| 535 | 3300025933 | Ga0207706_10035883 | Ga0207706_100358835 | 248 |
| 536 | 3300025933 | Ga0207706_10075732 | Ga0207706_100757323 | 248 |
| 537 | 3300025933 | Ga0207706_10084043 | Ga0207706_100840432 | 248 |
| 538 | 3300025936 | Ga0207670_10056219 | Ga0207670_100562191 | 248 |
| 539 | 3300025936 | Ga0207670_10181717 | Ga0207670_101817172 | 248 |
| 540 | 3300025940 | Ga0207691_10114579 | Ga0207691_101145792 | 248 |
| 541 | 3300025940 | Ga0207691_10153153 | Ga0207691_101531532 | 248 |
| 542 | 3300025942 | Ga0207689_10003450 | Ga0207689_100034505 | 248 |
| 543 | 3300025942 | Ga0207689_10039074 | Ga0207689_100390745 | 248 |
| 544 | 3300025942 | Ga0207689_10435380 | Ga0207689_104353802 | 248 |
| 545 | 3300025944 | Ga0207661_10031975 | Ga0207661_100319753 | 248 |
| 546 | 3300025944 | Ga0207661_10042051 | Ga0207661_100420513 | 248 |
| 547 | 3300025944 | Ga0207661_10115041 | Ga0207661_101150412 | 248 |
| 548 | 3300025945 | Ga0207679_10043751 | Ga0207679_100437513 | 248 |
| 549 | 3300025945 | Ga0207679_10052795 | Ga0207679_100527952 | 248 |
| 550 | 3300025945 | Ga0207679_10075204 | Ga0207679_100752043 | 248 |
| 551 | 3300025945 | Ga0207679_10106918 | Ga0207679_101069182 | 248 |
| 552 | 3300025949 | Ga0207667_10000621 | Ga0207667_1000062147 | 248 |
| 553 | 3300025949 | Ga0207667_10116475 | Ga0207667_101164752 | 248 |
| 554 | 3300025949 | Ga0207667_10176490 | Ga0207667_101764902 | 248 |
| 555 | 3300025960 | Ga0207651_10205130 | Ga0207651_102051302 | 248 |
| 556 | 3300025960 | Ga0207651_10231544 | Ga0207651_102315441 | 248 |
| 557 | 3300025960 | Ga0207651_10267760 | Ga0207651_102677602 | 248 |
| 558 | 3300025960 | Ga0207651_10269722 | Ga0207651_102697222 | 248 |
| 559 | 3300025960 | Ga0207651_10297305 | Ga0207651_102973052 | 248 |
| 560 | 3300025960 | Ga0207651_10401578 | Ga0207651_104015782 | 248 |
| 561 | 3300025961 | Ga0207712_10025016 | Ga0207712_100250165 | 248 |
| 562 | 3300025961 | Ga0207712_10161561 | Ga0207712_101615612 | 248 |
| 563 | 3300025961 | Ga0207712_10793936 | Ga0207712_107939361 | 248 |
| 564 | 3300025972 | Ga0207668_10858205 | Ga0207668_108582051 | 248 |
| 565 | 3300025981 | Ga0207640_10062216 | Ga0207640_100622162 | 248 |
| 566 | 3300025981 | Ga0207640_10075009 | Ga0207640_100750092 | 248 |
| 567 | 3300025981 | Ga0207640_10192486 | Ga0207640_101924862 | 248 |
| 568 | 3300025986 | Ga0207658_10019797 | Ga0207658_100197975 | 248 |
| 569 | 3300025986 | Ga0207658_10043198 | Ga0207658_100431984 | 248 |
| 570 | 3300025986 | Ga0207658_10448883 | Ga0207658_104488832 | 248 |
| 571 | 3300026023 | Ga0207677_10298680 | Ga0207677_102986802 | 248 |
| 572 | 3300026035 | Ga0207703_10000798 | Ga0207703_1000079817 | 248 |
| 573 | 3300026035 | Ga0207703_10049018 | Ga0207703_100490182 | 248 |
| 574 | 3300026035 | Ga0207703_10354522 | Ga0207703_103545222 | 248 |
| 575 | 3300026041 | Ga0207639_10039989 | Ga0207639_100399892 | 248 |
| 576 | 3300026041 | Ga0207639_10427714 | Ga0207639_104277142 | 248 |
| 577 | 3300026067 | Ga0207678_10137935 | Ga0207678_101379353 | 248 |
| 578 | 3300026078 | Ga0207702_10002255 | Ga0207702_100022557 | 248 |
| 579 | 3300026078 | Ga0207702_10042062 | Ga0207702_100420622 | 248 |
| 580 | 3300026088 | Ga0207641_10000056 | Ga0207641_10000056131 | 248 |
| 581 | 3300026088 | Ga0207641_10269272 | Ga0207641_102692722 | 248 |
| 582 | 3300026088 | Ga0207641_10351457 | Ga0207641_103514571 | 248 |
| 583 | 3300026088 | Ga0207641_10717655 | Ga0207641_107176551 | 248 |
| 584 | 3300026089 | Ga0207648_10171436 | Ga0207648_101714362 | 248 |
| 585 | 3300026089 | Ga0207648_10222522 | Ga0207648_102225221 | 248 |
| 586 | 3300026089 | Ga0207648_10275919 | Ga0207648_102759191 | 248 |
| 587 | 3300026089 | Ga0207648_10432231 | Ga0207648_104322312 | 248 |
| 588 | 3300026095 | Ga0207676_10005956 | Ga0207676_100059567 | 248 |
| 589 | 3300026095 | Ga0207676_10055592 | Ga0207676_100555922 | 248 |
| 590 | 3300026095 | Ga0207676_10077417 | Ga0207676_100774173 | 248 |
| 591 | 3300026095 | Ga0207676_10264741 | Ga0207676_102647412 | 248 |
| 592 | 3300026116 | Ga0207674_10017345 | Ga0207674_100173458 | 248 |
| 593 | 3300026118 | Ga0207675_100146973 | Ga0207675_1001469732 | 248 |
| 594 | 3300026118 | Ga0207675_100474663 | Ga0207675_1004746632 | 248 |
| 595 | 3300026121 | Ga0207683_10339664 | Ga0207683_103396642 | 248 |
| 596 | 3300026142 | Ga0207698_10034662 | Ga0207698_100346623 | 248 |
| 597 | 3300026142 | Ga0207698_10076314 | Ga0207698_100763142 | 248 |
| 598 | 3300026142 | Ga0207698_10201475 | Ga0207698_102014752 | 248 |
| 599 | 3300026142 | Ga0207698_10972432 | Ga0207698_109724321 | 248 |
| 600 | 3300028379 | Ga0268266_10000070 | Ga0268266_10000070117 | 248 |
| 601 | 3300028380 | Ga0268265_10299066 | Ga0268265_102990662 | 248 |
| 602 | 3300028381 | Ga0268264_10000011 | Ga0268264_1000001147 | 248 |
| 603 | 3300028381 | Ga0268264_10002267 | Ga0268264_100022676 | 248 |
| 604 | 3300028381 | Ga0268264_10002602 | Ga0268264_100026025 | 248 |
| 605 | 3300028381 | Ga0268264_10018085 | Ga0268264_100180856 | 248 |
| 606 | 3300028381 | Ga0268264_10032902 | Ga0268264_100329022 | 248 |
| 607 | 3300028654 | Ga0265322_10034698 | Ga0265322_100346981 | 248 |
| 608 | 3300028786 | Ga0307517_10002276 | Ga0307517_100022766 | 248 |
| 609 | 3300028794 | Ga0307515_10000078 | Ga0307515_10000078111 | 248 |
| 610 | 3300030521 | Ga0307511_10000304 | Ga0307511_1000030414 | 248 |
| 611 | 3300031507 | Ga0307509_10090538 | Ga0307509_100905384 | 248 |
| 612 | 3300031507 | Ga0307509_10141944 | Ga0307509_101419441 | 248 |
| 613 | 3300033180 | Ga0307510_10000062 | Ga0307510_1000006244 | 248 |
| 614 | 3300035170 | Ga0373943_0147067 | Ga0373943_0147067_234_989 | 248 |
| 615 | 3300035725 | Ga0373947_0119761 | Ga0373947_0119761_669_1415 | 248 |
| 616 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_776340_777101 | 248 |
| 617 | 3300037312 | Ga0395899_0013384 | Ga0395899_0013384_4849_5601 | 248 |
| 618 | 3300037418 | Ga0395900_0036349 | Ga0395900_0036349_786_1538 | 248 |
| 619 | 3300037418 | Ga0395900_0169747 | Ga0395900_0169747_634_1386 | 248 |
| 620 | 3300037466 | Ga0395898_0045550 | Ga0395898_0045550_1537_2289 | 248 |
| 621 | 3300037471 | Ga0395905_0324575 | Ga0395905_0324575_292_1044 | 248 |
| 622 | 3300038443 | Ga0395901_0361168 | Ga0395901_0361168_454_1206 | 248 |
| 623 | 3300044658 | Ga0466972_0000014 | Ga0466972_0000014_201836_202585 | 248 |
| 624 | 3300044683 | Ga0466965_0044649 | Ga0466965_0044649_710_1459 | 248 |
| 625 | 3300044684 | Ga0466966_0132644 | Ga0466966_0132644_403_1164 | 248 |
| 626 | 3300044693 | Ga0466961_0045509 | Ga0466961_0045509_466_1269 | 248 |
| 627 | 3300044765 | Ga0466970_0002409 | Ga0466970_0002409_4403_5152 | 248 |
| 628 | 3300045049 | Ga0466959_0026914 | Ga0466959_0026914_474_1277 | 248 |
| 629 | 3300046459 | Ga0495629_0172216 | Ga0495629_0172216_523_1278 | 248 |
| 630 | 3300046473 | Ga0495582_0077330 | Ga0495582_0077330_79_834 | 248 |
| 631 | 3300046648 | Ga0495611_0000150 | Ga0495611_0000150_12708_13508 | 248 |
| 632 | 3300046648 | Ga0495611_0048018 | Ga0495611_0048018_423_1172 | 248 |
| 633 | 3300046663 | Ga0495635_0143276 | Ga0495635_0143276_780_1535 | 248 |
| 634 | 3300046683 | Ga0495658_0025365 | Ga0495658_0025365_141_896 | 248 |
| 635 | 3300047319 | Ga0495674_0081733 | Ga0495674_0081733_1561_2316 | 248 |
| 636 | 3300047320 | Ga0495672_0046727 | Ga0495672_0046727_1091_1840 | 248 |
| 637 | 3300047321 | Ga0495676_0197922 | Ga0495676_0197922_256_1011 | 248 |
| 638 | 3300047471 | Ga0495684_0155414 | Ga0495684_0155414_339_1094 | 248 |
| 639 | 3300047472 | Ga0495686_0000078 | Ga0495686_0000078_73232_74023 | 248 |
| 640 | 3300048913 | Ga0496110_0118808 | Ga0496110_0118808_1296_2042 | 248 |
| 641 | 3300048914 | Ga0496111_0118855 | Ga0496111_0118855_1009_1755 | 248 |
| 642 | 3300048915 | Ga0496112_0213058 | Ga0496112_0213058_763_1509 | 248 |
| 643 | 3300049571 | Ga0501034_0165896 | Ga0501034_0165896_1243_2088 | 248 |
| 644 | 3300049573 | Ga0501037_0459996 | Ga0501037_0459996_57_809 | 248 |
| 645 | 3300049580 | Ga0501046_0292587 | Ga0501046_0292587_23_868 | 248 |
| 646 | 3300049581 | Ga0501047_0350061 | Ga0501047_0350061_169_1014 | 248 |
| 647 | 3300049582 | Ga0501048_0215029 | Ga0501048_0215029_206_1051 | 248 |
| 648 | 3300049584 | Ga0501068_0282913 | Ga0501068_0282913_70_915 | 248 |
| 649 | 3300049585 | Ga0501069_0018441 | Ga0501069_0018441_318_1163 | 248 |
| 650 | 3300049589 | Ga0501073_0014748 | Ga0501073_0014748_1082_1927 | 248 |
| 651 | 3300049744 | Ga0501083_0012904 | Ga0501083_0012904_3419_4264 | 248 |
| 652 | 3300049823 | Ga0501044_0240296 | Ga0501044_0240296_853_1698 | 248 |
| 653 | 3300050512 | nmdc:mga0n895_663492_c1 | nmdc:mga0n895_663492_c1_230_979 | 248 |
| 654 | 3300053178 | Ga0500637_0046561 | Ga0500637_0046561_309_1058 | 248 |
| 655 | 3300060353 | Ga0501082_0373692 | Ga0501082_0373692_59_904 | 248 |
| 656 | 3300061719 | Ga0466962_0033092 | Ga0466962_0033092_584_1387 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7osf-assembly1.cif.gz_E | abc transporter complex nosdfyl, r-domain 1 | 0.7665 | 11 | 243 |
| 7o16-assembly1.cif.gz_D | abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 | 0.7591 | 11 | 243 |
| 7znq-assembly1.cif.gz_Y | abc transporter complex nosdfyl in gdn | 0.7493 | 11 | 243 |
| 8edw-assembly1.cif.gz_A | cryo-em structure of human abca7 in bpl/ch nanodiscs | 0.7367 | 56 | 242 |
| 7znq-assembly1.cif.gz_y | abc transporter complex nosdfyl in gdn | 0.728 | 11 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7961 | 53 | 244 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7887 | 52 | 243 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.736 | 53 | 241 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6245 | 53 | 244 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6189 | 52 | 243 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839MFU6-F1-model_v4 | deleted | 0.994 | 4 | 248 |
|
| AF-A0A839MFU6-F1-model_v4 | deleted | 0.9859 | 4 | 248 |
|
| AF-A0A317IFH4-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9801 | 1 | 151 |
GO:0016020
GO:0140359 |
| AF-A0A7W1NNY1-F1-model_v4 | ABC transporter permease | 0.9722 | 1 | 248 |
GO:0016020
GO:0140359 |
| AF-A0A7W1NNY1-F1-model_v4 | ABC transporter permease | 0.9684 | 1 | 248 |
GO:0016020
GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar