F469082

General Info

Members Datasets Scaffolds Average Seq Length
611 289 609 303

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0000007|Ga0373934_0000007_24814_25794
Length 326
Sequence LGSELRDAQQQGGLLGGPDPAALDPVPAELATRLDRVPALAGVPRTVSELPGGLTNRNYKVTTPAGAFVARVWSGGDYLAINRDHEYSNSVAAAQAGVGAPVVAYRPDDRLLVLRFIEGRTFGDADVRAPANIPRIARACRMLHAGPRFTGDFDMFAIQGRYAAVTAEQGFVVPAGYDALMPQMEAARRALAVRAEHTVPCNNDLLAANFIDDGSRIWLIDYEYSGNNDACFELGNIWGECGLSADALADLVTAYYGRTLRNKIARAMLLGMVGKYGWTLWGAIQAATSPIEFDFWSWAMERYEGAEAGFTGPDFPRLLDDVQRDD

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.65
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 7.53
Rhizosphere 85.43
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10047842 3300001990 Bacteria 1303
2 Ga0070658_10015728 3300005327 Bacteria 6051
3 Ga0070658_10034073 3300005327 Bacteria 4097
4 Ga0070658_10049392 3300005327 Bacteria 3408
5 Ga0070683_100001232 3300005329 Bacteria 19471
6 Ga0070683_100017715 3300005329 Bacteria 6294
7 Ga0070683_100102154 3300005329 Bacteria 2700
8 Ga0070683_100302787 3300005329 Bacteria 1521
9 Ga0070682_100057892 3300005337 Bacteria 2443
10 Ga0068868_100097208 3300005338 Bacteria 2379
11 Ga0070660_100015370 3300005339 Bacteria 5523
12 Ga0070660_100174863 3300005339 Bacteria 1736
13 Ga0070692_10009892 3300005345 Bacteria 4318
14 Ga0070668_100203540 3300005347 Bacteria 1626
15 Ga0070671_100115155 3300005355 Bacteria 2260
16 Ga0070659_100013610 3300005366 Bacteria 6060
17 Ga0070667_100117524 3300005367 Bacteria 2310
18 Ga0070667_100333395 3300005367 Bacteria 1371
19 Ga0070709_10000393 3300005434 Bacteria 26736
20 Ga0070709_10002150 3300005434 Bacteria 10671
21 Ga0070714_100007992 3300005435 Bacteria 8243
22 Ga0070714_100041324 3300005435 Bacteria 3890
23 Ga0070714_100052385 3300005435 Bacteria 3480
24 Ga0070713_100003090 3300005436 Bacteria 10950
25 Ga0070713_100019917 3300005436 Bacteria 5135
26 Ga0070713_100063827 3300005436 Bacteria 3089
27 Ga0070713_100133506 3300005436 Bacteria 2191
28 Ga0070710_10000118 3300005437 Bacteria 37278
29 Ga0070710_10008773 3300005437 Bacteria 4930
30 Ga0070701_10003175 3300005438 Bacteria 6460
31 Ga0070711_100002815 3300005439 Bacteria 9987
32 Ga0070711_100032679 3300005439 Bacteria 3461
33 Ga0070700_100011926 3300005441 Bacteria 4828
34 Ga0070708_100091932 3300005445 Bacteria 2764
35 Ga0070708_100141504 3300005445 Bacteria 2231
36 Ga0070663_100161679 3300005455 Bacteria 1724
37 Ga0070662_100263581 3300005457 Bacteria 1389
38 Ga0068867_100001433 3300005459 Bacteria 16515
39 Ga0070685_10010101 3300005466 Bacteria 4897
40 Ga0070706_100013883 3300005467 Bacteria 7446
41 Ga0070706_100055527 3300005467 Bacteria 3656
42 Ga0070706_100063721 3300005467 Bacteria 3406
43 Ga0070706_100398814 3300005467 Bacteria 1281
44 Ga0070706_100407684 3300005467 Bacteria 1265
45 Ga0070707_100009334 3300005468 Bacteria 9105
46 Ga0070707_100013452 3300005468 Bacteria 7657
47 Ga0070707_100087115 3300005468 Bacteria 3020
48 Ga0070707_100138215 3300005468 Bacteria 2370
49 Ga0070698_100001429 3300005471 Bacteria 26454
50 Ga0070698_100001988 3300005471 Bacteria 22693
51 Ga0070698_100012072 3300005471 Bacteria 9159
52 Ga0070698_100202410 3300005471 Bacteria 1921
53 Ga0070679_100163650 3300005530 Bacteria 2198
54 Ga0070684_100036154 3300005535 Bacteria 4231
55 Ga0070684_100037092 3300005535 Bacteria 4179
56 Ga0070684_100179335 3300005535 Bacteria 1925
57 Ga0070684_100345145 3300005535 Bacteria 1369
58 Ga0070697_100006356 3300005536 Bacteria 9144
59 Ga0068853_100106466 3300005539 Bacteria 2485
60 Ga0070672_100101955 3300005543 Bacteria 2329
61 Ga0070686_100128439 3300005544 Bacteria 1750
62 Ga0070695_100176528 3300005545 Bacteria 1511
63 Ga0070665_100001502 3300005548 Bacteria 27146
64 Ga0068855_100092310 3300005563 Bacteria 3492
65 Ga0070664_100319381 3300005564 Bacteria 1407
66 Ga0068857_100091898 3300005577 Bacteria 2717
67 Ga0068857_100229528 3300005577 Bacteria 1697
68 Ga0068856_100042986 3300005614 Bacteria 4446
69 Ga0068856_100216288 3300005614 Bacteria 1931
70 Ga0070702_100006960 3300005615 Bacteria 5386
71 Ga0070702_100027475 3300005615 Bacteria 3071
72 Ga0068852_100034917 3300005616 Bacteria 4188
73 Ga0068852_100179329 3300005616 Bacteria 1991
74 Ga0068864_100225139 3300005618 Bacteria 1732
75 Ga0068864_100563156 3300005618 Bacteria 1103
76 Ga0068861_100517640 3300005719 Bacteria 1081
77 Ga0068851_10233813 3300005834 Bacteria 1037
78 Ga0068870_10002785 3300005840 Bacteria 7353
79 Ga0068863_100065358 3300005841 Bacteria 3441
80 Ga0068858_100088044 3300005842 Bacteria 2889
81 Ga0068860_100013790 3300005843 Bacteria 7924
82 Ga0068860_100055713 3300005843 Bacteria 3759
83 Ga0081540_1000101 3300005983 Bacteria 91600
84 Ga0070717_10001162 3300006028 Bacteria 17781
85 Ga0070717_10038972 3300006028 Bacteria 3864
86 Ga0070717_10128987 3300006028 Bacteria 2173
87 Ga0070717_10137382 3300006028 Bacteria 2106
88 Ga0070717_10196157 3300006028 Bacteria 1766
89 Ga0070717_10233349 3300006028 Bacteria 1620
90 Ga0075365_10000395 3300006038 Bacteria 15977
91 Ga0075365_10001285 3300006038 Bacteria 11170
92 Ga0075365_10010292 3300006038 Bacteria 5434
93 Ga0075365_10063528 3300006038 Bacteria 2472
94 Ga0075365_10306835 3300006038 Bacteria 1117
95 Ga0075368_10000942 3300006042 Bacteria 9046
96 Ga0075368_10033381 3300006042 Bacteria 2002
97 Ga0075363_100004211 3300006048 Bacteria 6249
98 Ga0075363_100006959 3300006048 Bacteria 5171
99 Ga0075363_100031710 3300006048 Bacteria 2741
100 Ga0075363_100104692 3300006048 Bacteria 1569
101 Ga0075363_100156745 3300006048 Bacteria 1287
102 Ga0075364_10018466 3300006051 Bacteria 4365
103 Ga0075364_10030803 3300006051 Bacteria 3445
104 Ga0075364_10060428 3300006051 Bacteria 2485
105 Ga0075364_10179921 3300006051 Bacteria 1430
106 Ga0070715_10000355 3300006163 Bacteria 11423
107 Ga0070715_10010175 3300006163 Bacteria 3343
108 Ga0070715_10099150 3300006163 Bacteria 1355
109 Ga0070716_100000214 3300006173 Bacteria 23074
110 Ga0070716_100009383 3300006173 Bacteria 4874
111 Ga0070712_100093502 3300006175 Bacteria 2207
112 Ga0070712_100237153 3300006175 Bacteria 1451
113 Ga0070712_100324129 3300006175 Bacteria 1253
114 Ga0075367_10006133 3300006178 Bacteria 6047
115 Ga0075367_10010378 3300006178 Bacteria 4892
116 Ga0075367_10027364 3300006178 Bacteria 3244
117 Ga0075367_10045081 3300006178 Bacteria 2587
118 Ga0075370_10007754 3300006353 Bacteria 5482
119 Ga0075370_10008770 3300006353 Bacteria 5217
120 Ga0075370_10011275 3300006353 Bacteria 4693
121 Ga0075428_100133536 3300006844 Bacteria 2699
122 Ga0075433_10088296 3300006852 Bacteria 2739
123 Ga0075434_100024136 3300006871 Bacteria 5941
124 Ga0068865_100013659 3300006881 Bacteria 5140
125 Ga0068865_100015421 3300006881 Bacteria 4874
126 Ga0075436_100044651 3300006914 Bacteria 3056
127 Ga0075435_100007385 3300007076 Bacteria 7827
128 Ga0105240_10285827 3300009093 Bacteria 1893
129 Ga0111539_10196303 3300009094 Bacteria 2354
130 Ga0105245_10004191 3300009098 Bacteria 12802
131 Ga0105245_10024387 3300009098 Bacteria 5310
132 Ga0105245_10071017 3300009098 Bacteria 3161
133 Ga0105245_10276056 3300009098 Bacteria 1641
134 Ga0105245_10707028 3300009098 Bacteria 1041
135 Ga0105247_10037233 3300009101 Bacteria 2968
136 Ga0105247_10105222 3300009101 Bacteria 1809
137 Ga0114129_10252314 3300009147 Bacteria 2368
138 Ga0105243_10008568 3300009148 Bacteria 7847
139 Ga0105243_10140887 3300009148 Bacteria 2057
140 Ga0105242_10096588 3300009176 Bacteria 2497
141 Ga0105248_10016577 3300009177 Bacteria 8113
142 Ga0105248_10030379 3300009177 Bacteria 6033
143 Ga0105248_10126709 3300009177 Bacteria 2880
144 Ga0105237_10083279 3300009545 Bacteria 3190
145 Ga0105249_10046879 3300009553 Bacteria 3935
146 Ga0105249_10407822 3300009553 Bacteria 1390
147 Ga0105249_10557130 3300009553 Bacteria 1197
148 Ga0105239_10001401 3300010375 Bacteria 32259
149 Ga0105239_10039937 3300010375 Bacteria 5140
150 Ga0105239_10377457 3300010375 Bacteria 1603
151 Ga0105239_10540018 3300010375 Bacteria 1327
152 Ga0105246_10020346 3300011119 Bacteria 4254
153 Ga0157373_10152051 3300013100 Bacteria 1628
154 Ga0157370_10045919 3300013104 Bacteria 4190
155 Ga0157370_10307197 3300013104 Bacteria 1464
156 Ga0157369_10010249 3300013105 Bacteria 10695
157 Ga0157374_10353924 3300013296 Bacteria 1459
158 Ga0163162_10842078 3300013306 Bacteria 1033
159 Ga0157372_10003488 3300013307 Bacteria 16951
160 Ga0157372_10069745 3300013307 Bacteria 3954
161 Ga0157372_10560519 3300013307 Bacteria 1332
162 Ga0157375_10116640 3300013308 Bacteria 2775
163 Ga0157375_10386925 3300013308 Bacteria 1565
164 Ga0163163_10030323 3300014325 Bacteria 5210
165 Ga0163163_10165586 3300014325 Bacteria 2257
166 Ga0163163_10280569 3300014325 Bacteria 1717
167 Ga0163163_10297372 3300014325 Bacteria 1666
168 Ga0157380_10005423 3300014326 Bacteria 8909
169 Ga0182008_10037883 3300014497 Bacteria 2412
170 Ga0157377_10021132 3300014745 Bacteria 3420
171 Ga0157377_10298853 3300014745 Bacteria 1062
172 Ga0157379_10026415 3300014968 Bacteria 5168
173 Ga0157379_10150335 3300014968 Bacteria 2100
174 Ga0206353_11038000 3300020082 Bacteria 1855
175 Ga0206353_11472283 3300020082 Bacteria 1208
176 Ga0213875_10007239 3300021388 Bacteria 5754
177 Ga0224712_10002726 3300022467 Bacteria 4435
178 Ga0207697_10072134 3300025315 Bacteria 1448
179 Ga0207692_10000122 3300025898 Bacteria 23339
180 Ga0207692_10000713 3300025898 Bacteria 11699
181 Ga0207688_10003539 3300025901 Bacteria 8522
182 Ga0207688_10014711 3300025901 Bacteria 4248
183 Ga0207647_10023348 3300025904 Bacteria 4090
184 Ga0207647_10044393 3300025904 Bacteria 2778
185 Ga0207685_10000120 3300025905 Bacteria 11840
186 Ga0207699_10000714 3300025906 Bacteria 15864
187 Ga0207699_10001391 3300025906 Bacteria 11495
188 Ga0207699_10005177 3300025906 Bacteria 6238
189 Ga0207643_10002721 3300025908 Bacteria 9563
190 Ga0207705_10244464 3300025909 Bacteria 1367
191 Ga0207684_10284179 3300025910 Bacteria 1427
192 Ga0207684_10383877 3300025910 Bacteria 1208
193 Ga0207654_10202429 3300025911 Bacteria 1308
194 Ga0207671_10115066 3300025914 Bacteria 2050
195 Ga0207693_10009710 3300025915 Bacteria 7834
196 Ga0207693_10010893 3300025915 Bacteria 7376
197 Ga0207693_10088875 3300025915 Bacteria 2421
198 Ga0207693_10342507 3300025915 Bacteria 1170
199 Ga0207663_10019056 3300025916 Bacteria 3857
200 Ga0207663_10026721 3300025916 Bacteria 3354
201 Ga0207663_10047859 3300025916 Bacteria 2642
202 Ga0207662_10078331 3300025918 Bacteria 2012
203 Ga0207657_10017156 3300025919 Bacteria 6955
204 Ga0207657_10017225 3300025919 Bacteria 6939
205 Ga0207646_10000259 3300025922 Bacteria 72047
206 Ga0207646_10005503 3300025922 Bacteria 13312
207 Ga0207646_10027514 3300025922 Bacteria 5186
208 Ga0207646_10065871 3300025922 Bacteria 3234
209 Ga0207659_10231374 3300025926 Bacteria 1491
210 Ga0207687_10011578 3300025927 Bacteria 5767
211 Ga0207687_10032642 3300025927 Bacteria 3527
212 Ga0207700_10000043 3300025928 Bacteria 92646
213 Ga0207700_10009579 3300025928 Bacteria 6064
214 Ga0207700_10013712 3300025928 Bacteria 5286
215 Ga0207700_10050730 3300025928 Bacteria 3093
216 Ga0207664_10000123 3300025929 Bacteria 68003
217 Ga0207664_10002506 3300025929 Bacteria 12162
218 Ga0207664_10009872 3300025929 Bacteria 6720
219 Ga0207664_10010144 3300025929 Bacteria 6645
220 Ga0207664_10081219 3300025929 Bacteria 2637
221 Ga0207664_10324735 3300025929 Bacteria 1358
222 Ga0207690_10026631 3300025932 Bacteria 3642
223 Ga0207690_10210344 3300025932 Bacteria 1482
224 Ga0207706_10078480 3300025933 Bacteria 2904
225 Ga0207686_10254455 3300025934 Bacteria 1285
226 Ga0207709_10191663 3300025935 Bacteria 1453
227 Ga0207670_10025135 3300025936 Bacteria 3734
228 Ga0207704_10031819 3300025938 Bacteria 2977
229 Ga0207704_10051806 3300025938 Bacteria 2485
230 Ga0207665_10000157 3300025939 Bacteria 46258
231 Ga0207665_10000755 3300025939 Bacteria 21758
232 Ga0207665_10003518 3300025939 Bacteria 10464
233 Ga0207665_10054130 3300025939 Bacteria 2706
234 Ga0207665_10054643 3300025939 Bacteria 2693
235 Ga0207691_10005262 3300025940 Bacteria 12490
236 Ga0207711_10070477 3300025941 Bacteria 3032
237 Ga0207661_10008301 3300025944 Bacteria 7420
238 Ga0207661_10022346 3300025944 Bacteria 4762
239 Ga0207679_10417354 3300025945 Bacteria 1184
240 Ga0207667_10285091 3300025949 Bacteria 1688
241 Ga0207651_10044292 3300025960 Bacteria 2977
242 Ga0207712_10254773 3300025961 Bacteria 1420
243 Ga0207658_10091510 3300025986 Bacteria 2360
244 Ga0207677_10023021 3300026023 Bacteria 3839
245 Ga0207703_10074893 3300026035 Bacteria 2804
246 Ga0207639_10025957 3300026041 Bacteria 4253
247 Ga0207678_10189221 3300026067 Bacteria 1759
248 Ga0207708_10000918 3300026075 Bacteria 22067
249 Ga0207702_10213434 3300026078 Bacteria 1795
250 Ga0207641_10020519 3300026088 Bacteria 5428
251 Ga0207648_10003123 3300026089 Bacteria 17493
252 Ga0207674_10001502 3300026116 Bacteria 30105
253 Ga0207674_10069839 3300026116 Bacteria 3532
254 Ga0207675_100062252 3300026118 Bacteria 3484
255 Ga0207698_10003844 3300026142 Bacteria 9087
256 Ga0207698_10022798 3300026142 Bacteria 4361
257 Ga0268266_10005197 3300028379 Bacteria 12253
258 Ga0268265_10177735 3300028380 Bacteria 1826
259 Ga0268264_10001927 3300028381 Bacteria 18714
260 Ga0268264_10161826 3300028381 Bacteria 2017
261 Ga0268264_10317185 3300028381 Bacteria 1473
262 Ga0307408_100048770 3300031548 Bacteria 3039
263 Ga0307413_10006671 3300031824 Bacteria 5295
264 Ga0307410_10013937 3300031852 Bacteria 4710
265 Ga0307407_10038630 3300031903 Bacteria 2647
266 Ga0307412_10014999 3300031911 Bacteria 4583
267 Ga0307412_10109353 3300031911 Bacteria 1971
268 Ga0307409_100028243 3300031995 Bacteria 3992
269 Ga0307409_100866629 3300031995 Bacteria 915
270 Ga0307411_10018246 3300032005 Bacteria 4020
271 Ga0307415_100041277 3300032126 Bacteria 3062
272 Ga0307415_100301410 3300032126 Bacteria 1328
273 Ga0373938_0003218 3300034957 Bacteria 2658
274 Ga0373926_0007070 3300035083 Bacteria 3735
275 Ga0373928_0046399 3300035084 Bacteria 1014
276 Ga0373934_0000007 3300035086 Bacteria 74186
277 Ga0373951_0004215 3300035091 Bacteria 3425
278 Ga0373923_0022285 3300035111 Bacteria 2482
279 Ga0373932_0008942 3300035112 Bacteria 2401
280 Ga0373953_0000069 3300035117 Bacteria 25378
281 Ga0373953_0048168 3300035117 Bacteria 1716
282 Ga0373953_0093010 3300035117 Bacteria 1263
283 Ga0373954_0017481 3300035118 Bacteria 3222
284 Ga0373954_0061644 3300035118 Bacteria 1770
285 Ga0373956_0000247 3300035119 Bacteria 21461
286 Ga0373956_0008600 3300035119 Bacteria 4135
287 Ga0373956_0010223 3300035119 Bacteria 3839
288 Ga0373956_0034487 3300035119 Bacteria 2229
289 Ga0373957_0000104 3300035120 Bacteria 20587
290 Ga0373946_0090128 3300035171 Bacteria 1357
291 Ga0373955_0000062 3300035172 Bacteria 42579
292 Ga0373955_0042049 3300035172 Bacteria 2452
293 Ga0373955_0082803 3300035172 Bacteria 1816
294 Ga0373955_0285400 3300035172 Bacteria 993
295 Ga0373942_0044935 3300035207 Bacteria 1218
296 Ga0373924_0003207 3300035410 Bacteria 5594
297 Ga0373924_0007699 3300035410 Bacteria 3892
298 Ga0373924_0019431 3300035410 Bacteria 2632
299 Ga0373924_0037253 3300035410 Bacteria 1979
300 Ga0373935_0001373 3300035692 Bacteria 13454
301 Ga0373935_0007490 3300035692 Bacteria 6535
302 Ga0373935_0053401 3300035692 Bacteria 2571
303 Ga0373935_0117939 3300035692 Bacteria 1769
304 Ga0373933_0000021 3300035724 Bacteria 96820
305 Ga0373933_0077063 3300035724 Bacteria 2037
306 Ga0373933_0085242 3300035724 Bacteria 1942
307 Ga0373947_0000004 3300035725 Bacteria 248228
308 Ga0373947_0025009 3300035725 Bacteria 3482
309 Ga0373937_0000032 3300036401 Bacteria 120148
310 Ga0373937_0013811 3300036401 Bacteria 7115
311 Ga0373937_0043208 3300036401 Bacteria 4112
312 Ga0373937_0064399 3300036401 Bacteria 3371
313 Ga0373937_0077743 3300036401 Bacteria 3066
314 Ga0373937_0084631 3300036401 Bacteria 2934
315 Ga0372808_004530 3300036459 Bacteria 1778
316 Ga0373925_0001429 3300037068 Bacteria 20682
317 Ga0373925_0015549 3300037068 Bacteria 5505
318 Ga0395905_0037932 3300037471 Bacteria 4522
319 Ga0436364_1266718 3300037853 Bacteria 10125
320 Ga0395901_0009154 3300038443 Bacteria 10031
321 Ga0436363_0107859 3300039450 Bacteria 1560
322 Ga0451853_1321677 3300041512 Bacteria 1818
323 Ga0439464_0035403 3300042439 Bacteria 1410
324 Ga0466969_0067089 3300044656 Bacteria 1732
325 Ga0466965_0119424 3300044683 Bacteria 1360
326 Ga0466965_0121151 3300044683 Bacteria 1351
327 Ga0466966_0017700 3300044684 Bacteria 4705
328 Ga0466961_0026780 3300044693 Bacteria 3707
329 Ga0466961_0047290 3300044693 Bacteria 2751
330 Ga0466963_0052342 3300044694 Bacteria 2709
331 Ga0466963_0097794 3300044694 Bacteria 2006
332 Ga0466963_0325653 3300044694 Bacteria 1081
333 Ga0466964_0075862 3300044706 Bacteria 1432
334 Ga0466968_0066565 3300044735 Bacteria 1561
335 Ga0466957_0007038 3300044842 Bacteria 6358
336 Ga0466960_0000222 3300044901 Bacteria 19771
337 Ga0466960_0009779 3300044901 Bacteria 3965
338 Ga0466960_0042557 3300044901 Bacteria 2157
339 Ga0466960_0066981 3300044901 Bacteria 1777
340 Ga0466959_0041338 3300045049 Bacteria 3403
341 Ga0451576_0314327 3300045051 Bacteria 1639
342 Ga0466958_0073391 3300045836 Bacteria 2096
343 Ga0466958_0232739 3300045836 Bacteria 1177
344 Ga0466967_0000340 3300045976 Bacteria 21475
345 Ga0466967_0032331 3300045976 Bacteria 4416
346 Ga0466967_0039503 3300045976 Bacteria 4057
347 Ga0466967_0383544 3300045976 Bacteria 1365
348 Ga0495592_0000143 3300046454 Bacteria 63228
349 Ga0495592_0016975 3300046454 Bacteria 5526
350 Ga0495592_0216174 3300046454 Bacteria 1284
351 Ga0495592_0217543 3300046454 Bacteria 1279
352 Ga0495603_0230327 3300046455 Bacteria 1068
353 Ga0495629_0007909 3300046459 Bacteria 7822
354 Ga0495641_0006091 3300046461 Bacteria 7916
355 Ga0495641_0044260 3300046461 Bacteria 2054
356 Ga0495651_0000010 3300046462 Bacteria 148763
357 Ga0495651_0014433 3300046462 Bacteria 6106
358 Ga0495651_0025106 3300046462 Bacteria 4637
359 Ga0495651_0030726 3300046462 Bacteria 4188
360 Ga0495653_0016054 3300046463 Bacteria 6103
361 Ga0495653_0022865 3300046463 Bacteria 5055
362 Ga0495653_0074820 3300046463 Bacteria 2522
363 Ga0495653_0096628 3300046463 Bacteria 2147
364 Ga0495639_0087471 3300046475 Bacteria 1458
365 Ga0495662_0088515 3300046476 Bacteria 1508
366 Ga0495664_0014990 3300046477 Bacteria 4401
367 Ga0495608_0000037 3300046511 Bacteria 125064
368 Ga0495608_0022320 3300046511 Bacteria 4339
369 Ga0495608_0038804 3300046511 Bacteria 3196
370 Ga0495608_0102908 3300046511 Bacteria 1840
371 Ga0495618_0020453 3300046514 Bacteria 4073
372 Ga0495618_0023354 3300046514 Bacteria 3823
373 Ga0495618_0053713 3300046514 Bacteria 2547
374 Ga0495628_0000884 3300046516 Bacteria 27634
375 Ga0495628_0025452 3300046516 Bacteria 4834
376 Ga0495628_0095225 3300046516 Bacteria 2300
377 Ga0495652_0000135 3300046529 Bacteria 82725
378 Ga0495652_0003503 3300046529 Bacteria 15454
379 Ga0495652_0017198 3300046529 Bacteria 6455
380 Ga0495652_0064009 3300046529 Bacteria 3095
381 Ga0495652_0090789 3300046529 Bacteria 2498
382 Ga0495652_0137325 3300046529 Bacteria 1927
383 Ga0495665_0001237 3300046531 Bacteria 13619
384 Ga0495665_0036246 3300046531 Bacteria 2633
385 Ga0495640_0011881 3300046533 Bacteria 6677
386 Ga0495640_0018076 3300046533 Bacteria 5238
387 Ga0495640_0131786 3300046533 Bacteria 1617
388 Ga0495640_0142003 3300046533 Bacteria 1547
389 Ga0495640_0242594 3300046533 Bacteria 1130
390 Ga0495586_0034438 3300046535 Bacteria 2720
391 Ga0495586_0051369 3300046535 Bacteria 2231
392 Ga0495587_0000024 3300046536 Bacteria 148753
393 Ga0495587_0007488 3300046536 Bacteria 7069
394 Ga0495587_0008644 3300046536 Bacteria 6544
395 Ga0495587_0028474 3300046536 Bacteria 3397
396 Ga0495587_0070670 3300046536 Bacteria 2031
397 Ga0495587_0158434 3300046536 Bacteria 1289
398 Ga0495645_0020033 3300046543 Bacteria 4822
399 Ga0495645_0059982 3300046543 Bacteria 2758
400 Ga0495645_0082565 3300046543 Bacteria 2304
401 Ga0495645_0088972 3300046543 Bacteria 2208
402 Ga0495645_0229439 3300046543 Bacteria 1244
403 Ga0495667_0000024 3300046559 Bacteria 168313
404 Ga0495667_0003687 3300046559 Bacteria 10306
405 Ga0495667_0069221 3300046559 Bacteria 2303
406 Ga0495634_0023000 3300046642 Bacteria 4387
407 Ga0495634_0023699 3300046642 Bacteria 4311
408 Ga0495634_0298811 3300046642 Bacteria 974
409 Ga0495635_0010469 3300046663 Bacteria 6486
410 Ga0495635_0026588 3300046663 Bacteria 4025
411 Ga0495635_0030003 3300046663 Bacteria 3780
412 Ga0495635_0061238 3300046663 Bacteria 2585
413 Ga0495657_0000057 3300046675 Bacteria 98920
414 Ga0495657_0031985 3300046675 Bacteria 3674
415 Ga0495657_0082163 3300046675 Bacteria 2082
416 Ga0495657_0195246 3300046675 Bacteria 1235
417 Ga0495599_0028132 3300046678 Bacteria 3522
418 Ga0495599_0038901 3300046678 Bacteria 2989
419 Ga0495599_0097561 3300046678 Bacteria 1832
420 Ga0495623_0001532 3300046679 Bacteria 15609
421 Ga0495623_0017468 3300046679 Bacteria 4635
422 Ga0495623_0032106 3300046679 Bacteria 3375
423 Ga0495623_0074386 3300046679 Bacteria 2111
424 Ga0495623_0136971 3300046679 Bacteria 1460
425 Ga0495646_0003118 3300046680 Bacteria 10281
426 Ga0495646_0016513 3300046680 Bacteria 4686
427 Ga0495646_0099995 3300046680 Bacteria 1664
428 Ga0495646_0269185 3300046680 Bacteria 908
429 Ga0495658_0009836 3300046683 Bacteria 4769
430 Ga0495658_0109318 3300046683 Bacteria 1660
431 Ga0495613_0005908 3300046689 Bacteria 9161
432 Ga0495613_0192298 3300046689 Bacteria 1442
433 Ga0495613_0337681 3300046689 Bacteria 1037
434 Ga0495600_0003738 3300046809 Bacteria 9003
435 Ga0495600_0013347 3300046809 Bacteria 5159
436 Ga0495600_0016761 3300046809 Bacteria 4656
437 Ga0495600_0071273 3300046809 Bacteria 2270
438 Ga0495600_0146150 3300046809 Bacteria 1532
439 Ga0495581_0100935 3300047315 Bacteria 1676
440 Ga0495604_0000024 3300047317 Bacteria 148542
441 Ga0495604_0023458 3300047317 Bacteria 4922
442 Ga0495604_0029704 3300047317 Bacteria 4348
443 Ga0495604_0057269 3300047317 Bacteria 2996
444 Ga0495604_0060913 3300047317 Bacteria 2888
445 Ga0495604_0173945 3300047317 Bacteria 1511
446 Ga0495674_0003692 3300047319 Bacteria 14889
447 Ga0495674_0069252 3300047319 Bacteria 3051
448 Ga0495674_0222776 3300047319 Bacteria 1558
449 Ga0495674_0312611 3300047319 Bacteria 1281
450 Ga0495680_0000005 3300047322 Bacteria 168308
451 Ga0495680_0023341 3300047322 Bacteria 5145
452 Ga0495680_0026914 3300047322 Bacteria 4733
453 Ga0495680_0072314 3300047322 Bacteria 2623
454 Ga0495680_0212442 3300047322 Bacteria 1384
455 Ga0495675_0000908 3300047444 Bacteria 18056
456 Ga0495675_0018111 3300047444 Bacteria 4467
457 Ga0495675_0119107 3300047444 Bacteria 1644
458 Ga0495684_0017914 3300047471 Bacteria 5456
459 Ga0495684_0061844 3300047471 Bacteria 2848
460 Ga0495684_0067556 3300047471 Bacteria 2718
461 Ga0495684_0296959 3300047471 Bacteria 1161
462 Ga0495593_0009206 3300047673 Bacteria 5726
463 Ga0495593_0143017 3300047673 Bacteria 1211
464 Ga0495602_0000203 3300048088 Bacteria 55275
465 Ga0495602_0018827 3300048088 Bacteria 6876
466 Ga0495602_0026255 3300048088 Bacteria 5620
467 Ga0495602_0046818 3300048088 Bacteria 3902
468 Ga0495602_0158839 3300048088 Bacteria 1767
469 Ga0495602_0177830 3300048088 Bacteria 1644
470 Ga0495614_0033262 3300048089 Bacteria 2218
471 Ga0496100_0046564 3300048903 Bacteria 2790
472 Ga0496100_0070452 3300048903 Bacteria 2332
473 Ga0496100_0198521 3300048903 Bacteria 1461
474 Ga0496101_0025095 3300048904 Bacteria 4132
475 Ga0496101_0060316 3300048904 Bacteria 2752
476 Ga0496101_0113108 3300048904 Bacteria 2045
477 Ga0496101_0144954 3300048904 Bacteria 1813
478 Ga0496101_0177346 3300048904 Bacteria 1640
479 Ga0496102_0045481 3300048905 Bacteria 3986
480 Ga0496102_0315017 3300048905 Bacteria 1474
481 Ga0496103_0025068 3300048906 Bacteria 3602
482 Ga0496104_0002161 3300048907 Bacteria 17061
483 Ga0496104_0004890 3300048907 Bacteria 11682
484 Ga0496104_0040795 3300048907 Bacteria 4351
485 Ga0496104_0077242 3300048907 Bacteria 3173
486 Ga0496105_0166655 3300048908 Bacteria 1807
487 Ga0496106_0064670 3300048909 Bacteria 2783
488 Ga0496106_0191325 3300048909 Bacteria 1627
489 Ga0496107_0021104 3300048910 Bacteria 4602
490 Ga0496107_0249637 3300048910 Bacteria 1320
491 Ga0496108_0002163 3300048911 Bacteria 15751
492 Ga0496108_0048410 3300048911 Bacteria 3554
493 Ga0496108_0059539 3300048911 Bacteria 3211
494 Ga0496109_0033853 3300048912 Bacteria 4599
495 Ga0496109_0034242 3300048912 Bacteria 4573
496 Ga0496109_0041191 3300048912 Bacteria 4185
497 Ga0496109_0056212 3300048912 Bacteria 3591
498 Ga0496109_0172874 3300048912 Bacteria 2027
499 Ga0496109_0328113 3300048912 Bacteria 1445
500 Ga0496110_0005591 3300048913 Bacteria 9869
501 Ga0496110_0028683 3300048913 Bacteria 4783
502 Ga0496110_0061400 3300048913 Bacteria 3317
503 Ga0496110_0065626 3300048913 Bacteria 3210
504 Ga0496110_0086799 3300048913 Bacteria 2794
505 Ga0496111_0003383 3300048914 Bacteria 9861
506 Ga0496111_0054503 3300048914 Bacteria 2891
507 Ga0496112_0033774 3300048915 Bacteria 4975
508 Ga0496114_0004149 3300048917 Bacteria 11211
509 Ga0496114_0016361 3300048917 Bacteria 5975
510 Ga0496114_0020218 3300048917 Bacteria 5402
511 Ga0496114_0054470 3300048917 Bacteria 3335
512 Ga0496114_0203393 3300048917 Bacteria 1735
513 Ga0496115_0002820 3300048918 Bacteria 12494
514 Ga0496115_0003989 3300048918 Bacteria 10647
515 Ga0496115_0018700 3300048918 Bacteria 5326
516 Ga0496115_0126428 3300048918 Bacteria 2106
517 Ga0496124_0072603 3300048927 Bacteria 2850
518 Ga0496126_0165434 3300048929 Bacteria 1888
519 Ga0501031_0012205 3300049568 Bacteria 5600
520 Ga0501032_0151509 3300049569 Bacteria 1525
521 Ga0501034_0024164 3300049571 Bacteria 6182
522 Ga0501036_0009566 3300049572 Bacteria 7973
523 Ga0501036_0151773 3300049572 Bacteria 1954
524 Ga0501038_0008824 3300049574 Bacteria 9248
525 Ga0501038_0260281 3300049574 Bacteria 1372
526 Ga0501039_0034837 3300049575 Bacteria 3885
527 Ga0501040_0041092 3300049576 Bacteria 3149
528 Ga0501040_0132121 3300049576 Bacteria 1756
529 Ga0501041_0004371 3300049577 Bacteria 8178
530 Ga0501043_0022733 3300049579 Bacteria 4918
531 Ga0501046_0007451 3300049580 Bacteria 9617
532 Ga0501048_0005560 3300049582 Bacteria 9586
533 Ga0501067_0005126 3300049583 Bacteria 7278
534 Ga0501067_0009030 3300049583 Bacteria 5521
535 Ga0501067_0029164 3300049583 Bacteria 3058
536 Ga0501067_0097538 3300049583 Bacteria 1632
537 Ga0501068_0013340 3300049584 Bacteria 4674
538 Ga0501068_0062470 3300049584 Bacteria 2265
539 Ga0501069_0023211 3300049585 Bacteria 3381
540 Ga0501069_0049483 3300049585 Bacteria 2336
541 Ga0501069_0071438 3300049585 Bacteria 1945
542 Ga0501069_0071904 3300049585 Bacteria 1939
543 Ga0501069_0075860 3300049585 Bacteria 1889
544 Ga0501070_0001128 3300049586 Bacteria 23951
545 Ga0501070_0010181 3300049586 Bacteria 7959
546 Ga0501070_0020291 3300049586 Bacteria 5575
547 Ga0501070_0026305 3300049586 Bacteria 4883
548 Ga0501070_0055795 3300049586 Bacteria 3275
549 Ga0501070_0068149 3300049586 Bacteria 2946
550 Ga0501070_0081652 3300049586 Bacteria 2675
551 Ga0501071_0013342 3300049587 Bacteria 5597
552 Ga0501071_0020255 3300049587 Bacteria 4621
553 Ga0501071_0057905 3300049587 Bacteria 2801
554 Ga0501072_0010330 3300049588 Bacteria 7112
555 Ga0501072_0013391 3300049588 Bacteria 6278
556 Ga0501072_0044182 3300049588 Bacteria 3503
557 Ga0501073_0022755 3300049589 Bacteria 4509
558 Ga0501073_0069504 3300049589 Bacteria 2453
559 Ga0501073_0136037 3300049589 Bacteria 1703
560 Ga0501074_0002190 3300049590 Bacteria 13535
561 Ga0501074_0014132 3300049590 Bacteria 5804
562 Ga0501074_0094897 3300049590 Bacteria 2136
563 Ga0501076_0016612 3300049592 Bacteria 5580
564 Ga0501076_0109942 3300049592 Bacteria 2228
565 Ga0501076_0128422 3300049592 Bacteria 2055
566 Ga0501077_0028325 3300049593 Bacteria 3560
567 Ga0501077_0236228 3300049593 Bacteria 1162
568 Ga0501079_0014589 3300049741 Bacteria 5992
569 Ga0501080_0032083 3300049742 Bacteria 4897
570 Ga0501080_0032198 3300049742 Bacteria 4888
571 Ga0501081_0004570 3300049743 Bacteria 8888
572 Ga0501083_0067510 3300049744 Bacteria 2380
573 Ga0501035_0070828 3300049822 Bacteria 3088
574 Ga0501035_0218710 3300049822 Bacteria 1627
575 Ga0501044_0374824 3300049823 Bacteria 1339
576 nmdc:mga03n38_202457_c1 3300050490 Bacteria 1028
577 nmdc:mga00v17_15403_c1 3300050491 Bacteria 4290
578 nmdc:mga00v17_168765_c1 3300050491 Bacteria 1410
579 nmdc:mga00v17_62769_c1 3300050491 Bacteria 2287
580 nmdc:mga00v17_7464_c1 3300050491 Bacteria 5836
581 nmdc:mga0yw44_4801_c2 3300050492 Bacteria 3603
582 nmdc:mga0yw44_49760_c1 3300050492 Bacteria 2531
583 nmdc:mga0yw44_683_c1 3300050492 Bacteria 12392
584 nmdc:mga06z11_17654_c1 3300050494 Bacteria 3244
585 nmdc:mga05p37_163999_c1 3300050507 Bacteria 2713
586 nmdc:mga08y16_142249_c1 3300050511 Bacteria 2494
587 nmdc:mga0n895_101584_c1 3300050512 Bacteria 2886
588 nmdc:mga0n895_39270_c1 3300050512 Bacteria 4592
589 nmdc:mga0rr50_13618_c1 3300050513 Bacteria 5304
590 nmdc:mga08x19_22498_c1 3300050514 Bacteria 3904
591 nmdc:mga08x19_274917_c1 3300050514 Bacteria 1166
592 Ga0495601_0044837 3300053077 Bacteria 2779
593 Ga0495601_0060812 3300053077 Bacteria 2397
594 Ga0495601_0114848 3300053077 Bacteria 1745
595 Ga0495612_0025612 3300053078 Bacteria 2369
596 Ga0495595_0005587 3300053084 Bacteria 5091
597 Ga0495595_0006117 3300053084 Bacteria 4890
598 Ga0495595_0061027 3300053084 Bacteria 1765
599 Ga0495619_0009226 3300053085 Bacteria 6233
600 Ga0495619_0043398 3300053085 Bacteria 2947
601 Ga0495619_0128668 3300053085 Bacteria 1739
602 Ga0495619_0161586 3300053085 Bacteria 1547
603 Ga0500644_0000047 3300053088 Bacteria 73844
604 Ga0500556_0006831 3300053104 Bacteria 3248
605 Ga0501084_0007175 3300054114 Bacteria 9179
606 Ga0501082_0005438 3300060353 Bacteria 11055
607 Ga0501082_0025779 3300060353 Bacteria 5066
608 Ga0501082_0143039 3300060353 Bacteria 2076
609 Ga0530510_0010929 3300061734 Bacteria 6369

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100866629 Ga0307409_1008666292 246
2 3300006038 Ga0075365_10063528 Ga0075365_100635282 257
3 3300006178 Ga0075367_10010378 Ga0075367_100103783 257
4 3300050490 nmdc:mga03n38_202457_c1 nmdc:mga03n38_202457_c1_213_992 259
5 3300050492 nmdc:mga0yw44_49760_c1 nmdc:mga0yw44_49760_c1_953_1732 259
6 3300046536 Ga0495587_0158434 Ga0495587_0158434_457_1248 262
7 3300048904 Ga0496101_0113108 Ga0496101_0113108_39_914 264
8 3300005467 Ga0070706_100407684 Ga0070706_1004076842 265
9 3300013307 Ga0157372_10560519 Ga0157372_105605192 266
10 3300035724 Ga0373933_0085242 Ga0373933_0085242_1084_1929 266
11 3300046642 Ga0495634_0298811 Ga0495634_0298811_96_941 266
12 3300046680 Ga0495646_0269185 Ga0495646_0269185_53_895 266
13 3300048904 Ga0496101_0060316 Ga0496101_0060316_982_1785 266
14 3300048905 Ga0496102_0045481 Ga0496102_0045481_1182_1985 266
15 3300048906 Ga0496103_0025068 Ga0496103_0025068_17_820 266
16 3300048909 Ga0496106_0064670 Ga0496106_0064670_1580_2383 266
17 3300048910 Ga0496107_0021104 Ga0496107_0021104_2807_3610 266
18 3300048917 Ga0496114_0016361 Ga0496114_0016361_3700_4503 266
19 3300048918 Ga0496115_0126428 Ga0496115_0126428_865_1668 266
20 3300049572 Ga0501036_0009566 Ga0501036_0009566_2391_3293 267
21 3300049574 Ga0501038_0008824 Ga0501038_0008824_7198_8100 267
22 3300049575 Ga0501039_0034837 Ga0501039_0034837_2024_2926 267
23 3300049577 Ga0501041_0004371 Ga0501041_0004371_2208_3110 267
24 3300049579 Ga0501043_0022733 Ga0501043_0022733_1372_2274 267
25 3300049582 Ga0501048_0005560 Ga0501048_0005560_2337_3239 267
26 3300049584 Ga0501068_0013340 Ga0501068_0013340_2629_3531 267
27 3300049586 Ga0501070_0068149 Ga0501070_0068149_1333_2235 267
28 3300049588 Ga0501072_0044182 Ga0501072_0044182_666_1568 267
29 3300049592 Ga0501076_0016612 Ga0501076_0016612_274_1176 267
30 3300049741 Ga0501079_0014589 Ga0501079_0014589_2102_3004 267
31 3300049743 Ga0501081_0004570 Ga0501081_0004570_7231_8133 267
32 3300060353 Ga0501082_0005438 Ga0501082_0005438_7319_8221 267
33 3300061734 Ga0530510_0010929 Ga0530510_0010929_3961_4863 267
34 3300049568 Ga0501031_0012205 Ga0501031_0012205_1071_1973 268
35 3300049580 Ga0501046_0007451 Ga0501046_0007451_7156_8058 268
36 3300049585 Ga0501069_0049483 Ga0501069_0049483_1101_2003 268
37 3300049587 Ga0501071_0013342 Ga0501071_0013342_1072_1974 268
38 3300049823 Ga0501044_0374824 Ga0501044_0374824_12_818 268
39 3300054114 Ga0501084_0007175 Ga0501084_0007175_1443_2345 268
40 3300048918 Ga0496115_0018700 Ga0496115_0018700_2132_3037 269
41 3300044656 Ga0466969_0067089 Ga0466969_0067089_611_1480 271
42 3300044683 Ga0466965_0121151 Ga0466965_0121151_128_997 271
43 3300044684 Ga0466966_0017700 Ga0466966_0017700_954_1823 271
44 3300044693 Ga0466961_0026780 Ga0466961_0026780_1233_2102 271
45 3300044735 Ga0466968_0066565 Ga0466968_0066565_34_903 271
46 3300044842 Ga0466957_0007038 Ga0466957_0007038_1424_2293 271
47 3300044901 Ga0466960_0009779 Ga0466960_0009779_1041_1910 271
48 3300045836 Ga0466958_0073391 Ga0466958_0073391_780_1649 271
49 3300045976 Ga0466967_0039503 Ga0466967_0039503_910_1779 271
50 3300048088 Ga0495602_0177830 Ga0495602_0177830_793_1614 271
51 3300048911 Ga0496108_0059539 Ga0496108_0059539_2375_3199 272
52 3300048903 Ga0496100_0046564 Ga0496100_0046564_1432_2346 277
53 3300048907 Ga0496104_0002161 Ga0496104_0002161_4131_5045 277
54 3300048908 Ga0496105_0166655 Ga0496105_0166655_38_952 277
55 3300048912 Ga0496109_0034242 Ga0496109_0034242_221_1135 277
56 3300048913 Ga0496110_0086799 Ga0496110_0086799_382_1296 277
57 3300048917 Ga0496114_0020218 Ga0496114_0020218_4157_5071 277
58 3300048918 Ga0496115_0003989 Ga0496115_0003989_4366_5280 277
59 3300013306 Ga0163162_10842078 Ga0163162_108420781 279
60 3300048903 Ga0496100_0198521 Ga0496100_0198521_122_1024 279
61 3300037068 Ga0373925_0015549 Ga0373925_0015549_4173_5120 280
62 3300044683 Ga0466965_0119424 Ga0466965_0119424_257_1114 281
63 3300048912 Ga0496109_0056212 Ga0496109_0056212_503_1357 281
64 3300049576 Ga0501040_0132121 Ga0501040_0132121_302_1231 281
65 3300005548 Ga0070665_100001502 Ga0070665_10000150215 282
66 3300028379 Ga0268266_10005197 Ga0268266_1000519712 282
67 3300044694 Ga0466963_0097794 Ga0466963_0097794_198_1055 282
68 3300044901 Ga0466960_0042557 Ga0466960_0042557_92_940 282
69 3300048909 Ga0496106_0191325 Ga0496106_0191325_736_1584 282
70 3300035117 Ga0373953_0093010 Ga0373953_0093010_32_943 283
71 3300035172 Ga0373955_0082803 Ga0373955_0082803_516_1427 283
72 3300035692 Ga0373935_0053401 Ga0373935_0053401_1359_2267 283
73 3300035725 Ga0373947_0025009 Ga0373947_0025009_1712_2620 283
74 3300036401 Ga0373937_0043208 Ga0373937_0043208_912_1823 283
75 3300037068 Ga0373925_0001429 Ga0373925_0001429_11681_12592 283
76 3300046454 Ga0495592_0216174 Ga0495592_0216174_13_924 283
77 3300046462 Ga0495651_0025106 Ga0495651_0025106_942_1853 283
78 3300046463 Ga0495653_0016054 Ga0495653_0016054_2875_3786 283
79 3300046511 Ga0495608_0022320 Ga0495608_0022320_2408_3319 283
80 3300046514 Ga0495618_0023354 Ga0495618_0023354_2404_3315 283
81 3300046529 Ga0495652_0003503 Ga0495652_0003503_32_943 283
82 3300046529 Ga0495652_0064009 Ga0495652_0064009_521_1429 283
83 3300046533 Ga0495640_0242594 Ga0495640_0242594_17_925 283
84 3300046536 Ga0495587_0028474 Ga0495587_0028474_1968_2879 283
85 3300046543 Ga0495645_0059982 Ga0495645_0059982_663_1571 283
86 3300046543 Ga0495645_0229439 Ga0495645_0229439_129_1040 283
87 3300046559 Ga0495667_0069221 Ga0495667_0069221_139_1050 283
88 3300046663 Ga0495635_0061238 Ga0495635_0061238_1167_2078 283
89 3300046675 Ga0495657_0082163 Ga0495657_0082163_902_1813 283
90 3300046678 Ga0495599_0097561 Ga0495599_0097561_579_1490 283
91 3300046679 Ga0495623_0074386 Ga0495623_0074386_820_1731 283
92 3300046680 Ga0495646_0099995 Ga0495646_0099995_559_1470 283
93 3300046809 Ga0495600_0013347 Ga0495600_0013347_1600_2511 283
94 3300047317 Ga0495604_0029704 Ga0495604_0029704_831_1742 283
95 3300047319 Ga0495674_0003692 Ga0495674_0003692_7249_8157 283
96 3300047322 Ga0495680_0212442 Ga0495680_0212442_236_1147 283
97 3300047471 Ga0495684_0061844 Ga0495684_0061844_928_1839 283
98 3300047471 Ga0495684_0296959 Ga0495684_0296959_174_1082 283
99 3300048088 Ga0495602_0158839 Ga0495602_0158839_164_1075 283
100 3300053077 Ga0495601_0060812 Ga0495601_0060812_272_1183 283
101 3300053077 Ga0495601_0114848 Ga0495601_0114848_405_1313 283
102 3300053085 Ga0495619_0161586 Ga0495619_0161586_334_1245 283
103 3300005434 Ga0070709_10000393 Ga0070709_100003939 284
104 3300005435 Ga0070714_100007992 Ga0070714_1000079924 284
105 3300005436 Ga0070713_100003090 Ga0070713_1000030907 284
106 3300005437 Ga0070710_10000118 Ga0070710_100001188 284
107 3300005439 Ga0070711_100002815 Ga0070711_10000281511 284
108 3300006028 Ga0070717_10001162 Ga0070717_100011627 284
109 3300006173 Ga0070716_100000214 Ga0070716_1000002145 284
110 3300022467 Ga0224712_10002726 Ga0224712_100027263 284
111 3300025898 Ga0207692_10000713 Ga0207692_100007136 284
112 3300025906 Ga0207699_10001391 Ga0207699_100013915 284
113 3300025916 Ga0207663_10019056 Ga0207663_100190562 284
114 3300025928 Ga0207700_10000043 Ga0207700_1000004381 284
115 3300025929 Ga0207664_10000123 Ga0207664_1000012360 284
116 3300025939 Ga0207665_10000157 Ga0207665_1000015747 284
117 3300045049 Ga0466959_0041338 Ga0466959_0041338_872_1813 286
118 3300047673 Ga0495593_0143017 Ga0495593_0143017_215_1114 287
119 3300048913 Ga0496110_0028683 Ga0496110_0028683_1874_2743 287
120 3300005544 Ga0070686_100128439 Ga0070686_1001284392 289
121 3300025915 Ga0207693_10010893 Ga0207693_100108937 289
122 3300049586 Ga0501070_0081652 Ga0501070_0081652_1083_1964 289
123 3300025910 Ga0207684_10383877 Ga0207684_103838772 290
124 3300049583 Ga0501067_0005126 Ga0501067_0005126_4400_5323 290
125 3300045976 Ga0466967_0383544 Ga0466967_0383544_56_940 292
126 3300048904 Ga0496101_0025095 Ga0496101_0025095_24_905 292
127 3300048907 Ga0496104_0077242 Ga0496104_0077242_521_1402 292
128 3300048917 Ga0496114_0004149 Ga0496114_0004149_4824_5705 292
129 3300050512 nmdc:mga0n895_39270_c1 nmdc:mga0n895_39270_c1_831_1715 292
130 3300050513 nmdc:mga0rr50_13618_c1 nmdc:mga0rr50_13618_c1_3590_4474 292
131 3300050514 nmdc:mga08x19_22498_c1 nmdc:mga08x19_22498_c1_2537_3421 292
132 3300005471 Ga0070698_100001988 Ga0070698_10000198813 293
133 3300005468 Ga0070707_100009334 Ga0070707_1000093344 294
134 3300005471 Ga0070698_100012072 Ga0070698_1000120723 294
135 3300010375 Ga0105239_10039937 Ga0105239_100399374 294
136 3300025922 Ga0207646_10000259 Ga0207646_100002594 294
137 3300005434 Ga0070709_10002150 Ga0070709_100021502 295
138 3300005435 Ga0070714_100041324 Ga0070714_1000413242 295
139 3300005435 Ga0070714_100052385 Ga0070714_1000523853 295
140 3300005436 Ga0070713_100019917 Ga0070713_1000199172 295
141 3300005436 Ga0070713_100063827 Ga0070713_1000638272 295
142 3300005436 Ga0070713_100133506 Ga0070713_1001335061 295
143 3300005437 Ga0070710_10008773 Ga0070710_100087732 295
144 3300005439 Ga0070711_100032679 Ga0070711_1000326792 295
145 3300005445 Ga0070708_100091932 Ga0070708_1000919322 295
146 3300005467 Ga0070706_100055527 Ga0070706_1000555272 295
147 3300005467 Ga0070706_100398814 Ga0070706_1003988141 295
148 3300005468 Ga0070707_100087115 Ga0070707_1000871152 295
149 3300005471 Ga0070698_100202410 Ga0070698_1002024102 295
150 3300005536 Ga0070697_100006356 Ga0070697_1000063565 295
151 3300006028 Ga0070717_10128987 Ga0070717_101289872 295
152 3300006028 Ga0070717_10137382 Ga0070717_101373822 295
153 3300006163 Ga0070715_10010175 Ga0070715_100101752 295
154 3300006173 Ga0070716_100009383 Ga0070716_1000093833 295
155 3300006175 Ga0070712_100093502 Ga0070712_1000935022 295
156 3300006175 Ga0070712_100324129 Ga0070712_1003241291 295
157 3300006871 Ga0075434_100024136 Ga0075434_1000241362 295
158 3300007076 Ga0075435_100007385 Ga0075435_1000073855 295
159 3300009098 Ga0105245_10707028 Ga0105245_107070281 295
160 3300020082 Ga0206353_11038000 Ga0206353_110380001 295
161 3300025898 Ga0207692_10000122 Ga0207692_1000012220 295
162 3300025906 Ga0207699_10000714 Ga0207699_100007149 295
163 3300025910 Ga0207684_10284179 Ga0207684_102841791 295
164 3300025915 Ga0207693_10342507 Ga0207693_103425071 295
165 3300025916 Ga0207663_10047859 Ga0207663_100478592 295
166 3300025928 Ga0207700_10009579 Ga0207700_100095794 295
167 3300025928 Ga0207700_10013712 Ga0207700_100137122 295
168 3300025929 Ga0207664_10009872 Ga0207664_100098724 295
169 3300025929 Ga0207664_10010144 Ga0207664_100101443 295
170 3300025939 Ga0207665_10000755 Ga0207665_100007552 295
171 3300039450 Ga0436363_0107859 Ga0436363_0107859_176_1078 295
172 3300045976 Ga0466967_0000340 Ga0466967_0000340_8266_9162 295
173 3300046477 Ga0495664_0014990 Ga0495664_0014990_2482_3384 295
174 3300046533 Ga0495640_0131786 Ga0495640_0131786_454_1356 295
175 3300046543 Ga0495645_0088972 Ga0495645_0088972_1203_2105 295
176 3300047319 Ga0495674_0069252 Ga0495674_0069252_1243_2145 295
177 3300050492 nmdc:mga0yw44_4801_c2 nmdc:mga0yw44_4801_c2_624_1520 295
178 3300053078 Ga0495612_0025612 Ga0495612_0025612_353_1255 295
179 iso_pu_bacteria 2643221615 2644089061 295
180 iso_pu_bacteria 2643221657 2644318906 295
181 3300005445 Ga0070708_100141504 Ga0070708_1001415042 296
182 3300005467 Ga0070706_100063721 Ga0070706_1000637212 296
183 3300005471 Ga0070698_100001429 Ga0070698_10000142913 296
184 3300005564 Ga0070664_100319381 Ga0070664_1003193812 296
185 3300005577 Ga0068857_100229528 Ga0068857_1002295282 296
186 3300005614 Ga0068856_100042986 Ga0068856_1000429862 296
187 3300005618 Ga0068864_100563156 Ga0068864_1005631561 296
188 3300006028 Ga0070717_10233349 Ga0070717_102333492 296
189 3300006163 Ga0070715_10099150 Ga0070715_100991502 296
190 3300006175 Ga0070712_100237153 Ga0070712_1002371532 296
191 3300009098 Ga0105245_10276056 Ga0105245_102760562 296
192 3300009101 Ga0105247_10037233 Ga0105247_100372332 296
193 3300009177 Ga0105248_10030379 Ga0105248_100303795 296
194 3300009545 Ga0105237_10083279 Ga0105237_100832792 296
195 3300009553 Ga0105249_10407822 Ga0105249_104078221 296
196 3300013104 Ga0157370_10045919 Ga0157370_100459192 296
197 3300013296 Ga0157374_10353924 Ga0157374_103539242 296
198 3300014745 Ga0157377_10298853 Ga0157377_102988531 296
199 3300014968 Ga0157379_10026415 Ga0157379_100264153 296
200 3300021388 Ga0213875_10007239 Ga0213875_100072392 296
201 3300025914 Ga0207671_10115066 Ga0207671_101150662 296
202 3300025915 Ga0207693_10088875 Ga0207693_100888752 296
203 3300025929 Ga0207664_10324735 Ga0207664_103247352 296
204 3300025939 Ga0207665_10054130 Ga0207665_100541302 296
205 3300026078 Ga0207702_10213434 Ga0207702_102134342 296
206 3300026088 Ga0207641_10020519 Ga0207641_100205193 296
207 3300026116 Ga0207674_10069839 Ga0207674_100698392 296
208 3300035083 Ga0373926_0007070 Ga0373926_0007070_1738_2655 296
209 3300035111 Ga0373923_0022285 Ga0373923_0022285_559_1476 296
210 3300035117 Ga0373953_0048168 Ga0373953_0048168_412_1329 296
211 3300035118 Ga0373954_0061644 Ga0373954_0061644_335_1252 296
212 3300035171 Ga0373946_0090128 Ga0373946_0090128_195_1112 296
213 3300035172 Ga0373955_0285400 Ga0373955_0285400_21_938 296
214 3300035410 Ga0373924_0003207 Ga0373924_0003207_4512_5429 296
215 3300035692 Ga0373935_0117939 Ga0373935_0117939_262_1179 296
216 3300035724 Ga0373933_0077063 Ga0373933_0077063_506_1423 296
217 3300037853 Ga0436364_1266718 Ga0436364_1266718_8274_9185 296
218 3300045836 Ga0466958_0232739 Ga0466958_0232739_137_1060 296
219 3300046454 Ga0495592_0016975 Ga0495592_0016975_3474_4391 296
220 3300046461 Ga0495641_0044260 Ga0495641_0044260_11_916 296
221 3300046462 Ga0495651_0014433 Ga0495651_0014433_4083_5000 296
222 3300046463 Ga0495653_0096628 Ga0495653_0096628_1107_2024 296
223 3300046475 Ga0495639_0087471 Ga0495639_0087471_37_954 296
224 3300046476 Ga0495662_0088515 Ga0495662_0088515_549_1466 296
225 3300046511 Ga0495608_0102908 Ga0495608_0102908_365_1282 296
226 3300046514 Ga0495618_0053713 Ga0495618_0053713_558_1475 296
227 3300046516 Ga0495628_0025452 Ga0495628_0025452_917_1834 296
228 3300046529 Ga0495652_0090789 Ga0495652_0090789_1037_1954 296
229 3300046531 Ga0495665_0036246 Ga0495665_0036246_929_1846 296
230 3300046533 Ga0495640_0011881 Ga0495640_0011881_2025_2942 296
231 3300046535 Ga0495586_0034438 Ga0495586_0034438_467_1384 296
232 3300046536 Ga0495587_0007488 Ga0495587_0007488_3225_4142 296
233 3300046543 Ga0495645_0082565 Ga0495645_0082565_621_1538 296
234 3300046642 Ga0495634_0023000 Ga0495634_0023000_478_1395 296
235 3300046663 Ga0495635_0010469 Ga0495635_0010469_482_1399 296
236 3300046675 Ga0495657_0195246 Ga0495657_0195246_308_1225 296
237 3300046678 Ga0495599_0028132 Ga0495599_0028132_1076_1993 296
238 3300046679 Ga0495623_0017468 Ga0495623_0017468_3214_4131 296
239 3300046809 Ga0495600_0146150 Ga0495600_0146150_128_1045 296
240 3300047315 Ga0495581_0100935 Ga0495581_0100935_221_1138 296
241 3300047317 Ga0495604_0060913 Ga0495604_0060913_1136_2053 296
242 3300047322 Ga0495680_0072314 Ga0495680_0072314_260_1177 296
243 3300048088 Ga0495602_0026255 Ga0495602_0026255_1168_2085 296
244 3300048914 Ga0496111_0054503 Ga0496111_0054503_1277_2194 296
245 3300050514 nmdc:mga08x19_274917_c1 nmdc:mga08x19_274917_c1_65_982 296
246 3300053084 Ga0495595_0006117 Ga0495595_0006117_3960_4877 296
247 3300053085 Ga0495619_0128668 Ga0495619_0128668_370_1287 296
248 3300005367 Ga0070667_100333395 Ga0070667_1003333952 297
249 3300005455 Ga0070663_100161679 Ga0070663_1001616792 297
250 3300005457 Ga0070662_100263581 Ga0070662_1002635812 297
251 3300005467 Ga0070706_100013883 Ga0070706_1000138832 297
252 3300005468 Ga0070707_100013452 Ga0070707_1000134524 297
253 3300005468 Ga0070707_100138215 Ga0070707_1001382152 297
254 3300005843 Ga0068860_100013790 Ga0068860_1000137902 297
255 3300006028 Ga0070717_10038972 Ga0070717_100389723 297
256 3300006038 Ga0075365_10001285 Ga0075365_1000128511 297
257 3300006042 Ga0075368_10000942 Ga0075368_100009422 297
258 3300006042 Ga0075368_10033381 Ga0075368_100333812 297
259 3300006048 Ga0075363_100004211 Ga0075363_1000042112 297
260 3300006048 Ga0075363_100006959 Ga0075363_1000069592 297
261 3300006048 Ga0075363_100031710 Ga0075363_1000317102 297
262 3300006048 Ga0075363_100104692 Ga0075363_1001046922 297
263 3300006048 Ga0075363_100156745 Ga0075363_1001567452 297
264 3300006051 Ga0075364_10018466 Ga0075364_100184664 297
265 3300006051 Ga0075364_10030803 Ga0075364_100308032 297
266 3300006051 Ga0075364_10060428 Ga0075364_100604282 297
267 3300006051 Ga0075364_10179921 Ga0075364_101799212 297
268 3300006178 Ga0075367_10006133 Ga0075367_100061332 297
269 3300006353 Ga0075370_10008770 Ga0075370_100087702 297
270 3300006353 Ga0075370_10011275 Ga0075370_100112752 297
271 3300014325 Ga0163163_10280569 Ga0163163_102805692 297
272 3300025922 Ga0207646_10005503 Ga0207646_100055038 297
273 3300025922 Ga0207646_10027514 Ga0207646_100275142 297
274 3300025922 Ga0207646_10065871 Ga0207646_100658712 297
275 3300025926 Ga0207659_10231374 Ga0207659_102313742 297
276 3300025933 Ga0207706_10078480 Ga0207706_100784802 297
277 3300026067 Ga0207678_10189221 Ga0207678_101892212 297
278 3300028381 Ga0268264_10001927 Ga0268264_1000192714 297
279 3300035086 Ga0373934_0000007 Ga0373934_0000007_24814_25794 297
280 3300035117 Ga0373953_0000069 Ga0373953_0000069_10275_11255 297
281 3300035118 Ga0373954_0017481 Ga0373954_0017481_534_1514 297
282 3300035119 Ga0373956_0000247 Ga0373956_0000247_955_1935 297
283 3300035119 Ga0373956_0010223 Ga0373956_0010223_799_1728 297
284 3300035119 Ga0373956_0034487 Ga0373956_0034487_237_1166 297
285 3300035120 Ga0373957_0000104 Ga0373957_0000104_395_1375 297
286 3300035172 Ga0373955_0000062 Ga0373955_0000062_24836_25816 297
287 3300035410 Ga0373924_0007699 Ga0373924_0007699_1885_2865 297
288 3300035410 Ga0373924_0019431 Ga0373924_0019431_224_1168 297
289 3300035692 Ga0373935_0007490 Ga0373935_0007490_3953_4897 297
290 3300035724 Ga0373933_0000021 Ga0373933_0000021_71184_72164 297
291 3300036401 Ga0373937_0000032 Ga0373937_0000032_24884_25864 297
292 3300036401 Ga0373937_0013811 Ga0373937_0013811_4222_5151 297
293 3300036401 Ga0373937_0077743 Ga0373937_0077743_1614_2558 297
294 3300036401 Ga0373937_0084631 Ga0373937_0084631_1402_2331 297
295 3300037471 Ga0395905_0037932 Ga0395905_0037932_3087_3992 297
296 3300042439 Ga0439464_0035403 Ga0439464_0035403_233_1147 297
297 3300046454 Ga0495592_0000143 Ga0495592_0000143_37357_38337 297
298 3300046454 Ga0495592_0217543 Ga0495592_0217543_229_1158 297
299 3300046461 Ga0495641_0006091 Ga0495641_0006091_1681_2625 297
300 3300046462 Ga0495651_0000010 Ga0495651_0000010_122890_123870 297
301 3300046462 Ga0495651_0030726 Ga0495651_0030726_1857_2786 297
302 3300046463 Ga0495653_0022865 Ga0495653_0022865_1228_2172 297
303 3300046463 Ga0495653_0074820 Ga0495653_0074820_105_1085 297
304 3300046511 Ga0495608_0000037 Ga0495608_0000037_105488_106468 297
305 3300046511 Ga0495608_0038804 Ga0495608_0038804_377_1306 297
306 3300046514 Ga0495618_0020453 Ga0495618_0020453_1832_2776 297
307 3300046516 Ga0495628_0000884 Ga0495628_0000884_2498_3478 297
308 3300046529 Ga0495652_0000135 Ga0495652_0000135_44391_45371 297
309 3300046529 Ga0495652_0017198 Ga0495652_0017198_4129_5058 297
310 3300046529 Ga0495652_0137325 Ga0495652_0137325_156_1085 297
311 3300046531 Ga0495665_0001237 Ga0495665_0001237_5329_6273 297
312 3300046533 Ga0495640_0018076 Ga0495640_0018076_519_1463 297
313 3300046535 Ga0495586_0051369 Ga0495586_0051369_1240_2184 297
314 3300046536 Ga0495587_0000024 Ga0495587_0000024_24883_25863 297
315 3300046536 Ga0495587_0008644 Ga0495587_0008644_3769_4713 297
316 3300046543 Ga0495645_0020033 Ga0495645_0020033_3769_4713 297
317 3300046559 Ga0495667_0000024 Ga0495667_0000024_44442_45422 297
318 3300046559 Ga0495667_0003687 Ga0495667_0003687_9086_10015 297
319 3300046663 Ga0495635_0026588 Ga0495635_0026588_429_1373 297
320 3300046675 Ga0495657_0000057 Ga0495657_0000057_44419_45399 297
321 3300046675 Ga0495657_0031985 Ga0495657_0031985_2381_3310 297
322 3300046679 Ga0495623_0001532 Ga0495623_0001532_10685_11665 297
323 3300046679 Ga0495623_0136971 Ga0495623_0136971_53_982 297
324 3300046680 Ga0495646_0003118 Ga0495646_0003118_4659_5639 297
325 3300046683 Ga0495658_0009836 Ga0495658_0009836_1430_2374 297
326 3300046689 Ga0495613_0005908 Ga0495613_0005908_1622_2566 297
327 3300046689 Ga0495613_0337681 Ga0495613_0337681_84_998 297
328 3300046809 Ga0495600_0003738 Ga0495600_0003738_4644_5624 297
329 3300046809 Ga0495600_0071273 Ga0495600_0071273_1228_2172 297
330 3300047317 Ga0495604_0000024 Ga0495604_0000024_24700_25680 297
331 3300047317 Ga0495604_0023458 Ga0495604_0023458_1942_2871 297
332 3300047317 Ga0495604_0173945 Ga0495604_0173945_550_1494 297
333 3300047319 Ga0495674_0312611 Ga0495674_0312611_145_1089 297
334 3300047322 Ga0495680_0000005 Ga0495680_0000005_122866_123846 297
335 3300047322 Ga0495680_0026914 Ga0495680_0026914_3772_4716 297
336 3300047444 Ga0495675_0000908 Ga0495675_0000908_3378_4358 297
337 3300047444 Ga0495675_0018111 Ga0495675_0018111_3053_3982 297
338 3300047444 Ga0495675_0119107 Ga0495675_0119107_555_1499 297
339 3300047471 Ga0495684_0017914 Ga0495684_0017914_309_1253 297
340 3300047673 Ga0495593_0009206 Ga0495593_0009206_1018_1962 297
341 3300048088 Ga0495602_0000203 Ga0495602_0000203_9847_10827 297
342 3300048088 Ga0495602_0046818 Ga0495602_0046818_75_1019 297
343 3300048089 Ga0495614_0033262 Ga0495614_0033262_31_975 297
344 3300048912 Ga0496109_0328113 Ga0496109_0328113_497_1396 297
345 3300048927 Ga0496124_0072603 Ga0496124_0072603_586_1491 297
346 3300049592 Ga0501076_0128422 Ga0501076_0128422_957_1862 297
347 3300050491 nmdc:mga00v17_62769_c1 nmdc:mga00v17_62769_c1_113_1018 297
348 3300050491 nmdc:mga00v17_7464_c1 nmdc:mga00v17_7464_c1_3618_4523 297
349 3300050492 nmdc:mga0yw44_683_c1 nmdc:mga0yw44_683_c1_710_1615 297
350 3300050494 nmdc:mga06z11_17654_c1 nmdc:mga06z11_17654_c1_456_1361 297
351 3300053084 Ga0495595_0005587 Ga0495595_0005587_239_1219 297
352 3300053084 Ga0495595_0061027 Ga0495595_0061027_677_1612 297
353 3300053085 Ga0495619_0009226 Ga0495619_0009226_5179_6123 297
354 3300053088 Ga0500644_0000047 Ga0500644_0000047_1942_2847 297
355 3300005329 Ga0070683_100102154 Ga0070683_1001021542 298
356 3300005338 Ga0068868_100097208 Ga0068868_1000972082 298
357 3300005345 Ga0070692_10009892 Ga0070692_100098922 298
358 3300005355 Ga0070671_100115155 Ga0070671_1001151553 298
359 3300005367 Ga0070667_100117524 Ga0070667_1001175242 298
360 3300005438 Ga0070701_10003175 Ga0070701_100031754 298
361 3300005441 Ga0070700_100011926 Ga0070700_1000119264 298
362 3300005459 Ga0068867_100001433 Ga0068867_1000014332 298
363 3300005466 Ga0070685_10010101 Ga0070685_100101012 298
364 3300005535 Ga0070684_100036154 Ga0070684_1000361543 298
365 3300005535 Ga0070684_100179335 Ga0070684_1001793351 298
366 3300005539 Ga0068853_100106466 Ga0068853_1001064662 298
367 3300005543 Ga0070672_100101955 Ga0070672_1001019552 298
368 3300005545 Ga0070695_100176528 Ga0070695_1001765282 298
369 3300005563 Ga0068855_100092310 Ga0068855_1000923103 298
370 3300005614 Ga0068856_100216288 Ga0068856_1002162882 298
371 3300005615 Ga0070702_100006960 Ga0070702_1000069602 298
372 3300005616 Ga0068852_100034917 Ga0068852_1000349172 298
373 3300005719 Ga0068861_100517640 Ga0068861_1005176401 298
374 3300005840 Ga0068870_10002785 Ga0068870_100027855 298
375 3300005841 Ga0068863_100065358 Ga0068863_1000653582 298
376 3300005983 Ga0081540_1000101 Ga0081540_100010145 298
377 3300006028 Ga0070717_10196157 Ga0070717_101961572 298
378 3300006038 Ga0075365_10000395 Ga0075365_100003956 298
379 3300006038 Ga0075365_10010292 Ga0075365_100102923 298
380 3300006163 Ga0070715_10000355 Ga0070715_100003558 298
381 3300006178 Ga0075367_10027364 Ga0075367_100273641 298
382 3300006178 Ga0075367_10045081 Ga0075367_100450812 298
383 3300006353 Ga0075370_10007754 Ga0075370_100077542 298
384 3300006844 Ga0075428_100133536 Ga0075428_1001335362 298
385 3300006852 Ga0075433_10088296 Ga0075433_100882962 298
386 3300006881 Ga0068865_100013659 Ga0068865_1000136594 298
387 3300006914 Ga0075436_100044651 Ga0075436_1000446511 298
388 3300009093 Ga0105240_10285827 Ga0105240_102858272 298
389 3300009094 Ga0111539_10196303 Ga0111539_101963032 298
390 3300009098 Ga0105245_10024387 Ga0105245_100243874 298
391 3300009101 Ga0105247_10105222 Ga0105247_101052222 298
392 3300009147 Ga0114129_10252314 Ga0114129_102523142 298
393 3300009148 Ga0105243_10008568 Ga0105243_100085684 298
394 3300009177 Ga0105248_10016577 Ga0105248_100165777 298
395 3300009553 Ga0105249_10557130 Ga0105249_105571301 298
396 3300010375 Ga0105239_10377457 Ga0105239_103774572 298
397 3300013100 Ga0157373_10152051 Ga0157373_101520512 298
398 3300013104 Ga0157370_10307197 Ga0157370_103071972 298
399 3300013307 Ga0157372_10069745 Ga0157372_100697452 298
400 3300014326 Ga0157380_10005423 Ga0157380_100054232 298
401 3300014745 Ga0157377_10021132 Ga0157377_100211322 298
402 3300025315 Ga0207697_10072134 Ga0207697_100721342 298
403 3300025901 Ga0207688_10003539 Ga0207688_100035394 298
404 3300025905 Ga0207685_10000120 Ga0207685_1000012010 298
405 3300025906 Ga0207699_10005177 Ga0207699_100051773 298
406 3300025908 Ga0207643_10002721 Ga0207643_100027213 298
407 3300025911 Ga0207654_10202429 Ga0207654_102024292 298
408 3300025915 Ga0207693_10009710 Ga0207693_100097103 298
409 3300025916 Ga0207663_10026721 Ga0207663_100267212 298
410 3300025927 Ga0207687_10032642 Ga0207687_100326422 298
411 3300025928 Ga0207700_10050730 Ga0207700_100507302 298
412 3300025929 Ga0207664_10002506 Ga0207664_100025068 298
413 3300025929 Ga0207664_10081219 Ga0207664_100812192 298
414 3300025932 Ga0207690_10210344 Ga0207690_102103441 298
415 3300025935 Ga0207709_10191663 Ga0207709_101916632 298
416 3300025936 Ga0207670_10025135 Ga0207670_100251353 298
417 3300025938 Ga0207704_10031819 Ga0207704_100318192 298
418 3300025939 Ga0207665_10003518 Ga0207665_100035185 298
419 3300025939 Ga0207665_10054643 Ga0207665_100546432 298
420 3300025940 Ga0207691_10005262 Ga0207691_100052629 298
421 3300025944 Ga0207661_10022346 Ga0207661_100223463 298
422 3300025949 Ga0207667_10285091 Ga0207667_102850911 298
423 3300025960 Ga0207651_10044292 Ga0207651_100442922 298
424 3300025986 Ga0207658_10091510 Ga0207658_100915102 298
425 3300026023 Ga0207677_10023021 Ga0207677_100230214 298
426 3300026041 Ga0207639_10025957 Ga0207639_100259572 298
427 3300026075 Ga0207708_10000918 Ga0207708_1000091820 298
428 3300026089 Ga0207648_10003123 Ga0207648_100031237 298
429 3300026118 Ga0207675_100062252 Ga0207675_1000622524 298
430 3300026142 Ga0207698_10003844 Ga0207698_100038446 298
431 3300031911 Ga0307412_10014999 Ga0307412_100149993 298
432 3300034957 Ga0373938_0003218 Ga0373938_0003218_922_1854 298
433 3300035084 Ga0373928_0046399 Ga0373928_0046399_31_963 298
434 3300035091 Ga0373951_0004215 Ga0373951_0004215_1869_2801 298
435 3300035112 Ga0373932_0008942 Ga0373932_0008942_1378_2310 298
436 3300035119 Ga0373956_0008600 Ga0373956_0008600_41_973 298
437 3300035172 Ga0373955_0042049 Ga0373955_0042049_716_1648 298
438 3300035207 Ga0373942_0044935 Ga0373942_0044935_230_1162 298
439 3300035410 Ga0373924_0037253 Ga0373924_0037253_432_1364 298
440 3300035692 Ga0373935_0001373 Ga0373935_0001373_6941_7915 298
441 3300035725 Ga0373947_0000004 Ga0373947_0000004_124307_125281 298
442 3300036401 Ga0373937_0064399 Ga0373937_0064399_404_1336 298
443 3300036459 Ga0372808_004530 Ga0372808_004530_787_1752 298
444 3300038443 Ga0395901_0009154 Ga0395901_0009154_2889_3794 298
445 3300046455 Ga0495603_0230327 Ga0495603_0230327_52_984 298
446 3300046459 Ga0495629_0007909 Ga0495629_0007909_453_1385 298
447 3300046516 Ga0495628_0095225 Ga0495628_0095225_98_1030 298
448 3300046533 Ga0495640_0142003 Ga0495640_0142003_543_1475 298
449 3300046536 Ga0495587_0070670 Ga0495587_0070670_1041_1973 298
450 3300046642 Ga0495634_0023699 Ga0495634_0023699_2070_3002 298
451 3300046663 Ga0495635_0030003 Ga0495635_0030003_819_1751 298
452 3300046678 Ga0495599_0038901 Ga0495599_0038901_1493_2425 298
453 3300046679 Ga0495623_0032106 Ga0495623_0032106_1942_2874 298
454 3300046680 Ga0495646_0016513 Ga0495646_0016513_87_1019 298
455 3300046683 Ga0495658_0109318 Ga0495658_0109318_633_1565 298
456 3300046809 Ga0495600_0016761 Ga0495600_0016761_2114_3046 298
457 3300047317 Ga0495604_0057269 Ga0495604_0057269_1451_2383 298
458 3300047319 Ga0495674_0222776 Ga0495674_0222776_98_1030 298
459 3300047322 Ga0495680_0023341 Ga0495680_0023341_764_1696 298
460 3300047471 Ga0495684_0067556 Ga0495684_0067556_88_1020 298
461 3300048088 Ga0495602_0018827 Ga0495602_0018827_3287_4219 298
462 3300048903 Ga0496100_0070452 Ga0496100_0070452_621_1544 298
463 3300048904 Ga0496101_0144954 Ga0496101_0144954_50_973 298
464 3300048907 Ga0496104_0004890 Ga0496104_0004890_3198_4121 298
465 3300048907 Ga0496104_0040795 Ga0496104_0040795_305_1237 298
466 3300048910 Ga0496107_0249637 Ga0496107_0249637_322_1254 298
467 3300048911 Ga0496108_0002163 Ga0496108_0002163_1755_2678 298
468 3300048912 Ga0496109_0041191 Ga0496109_0041191_2375_3298 298
469 3300048912 Ga0496109_0172874 Ga0496109_0172874_529_1452 298
470 3300048913 Ga0496110_0061400 Ga0496110_0061400_1869_2792 298
471 3300048913 Ga0496110_0065626 Ga0496110_0065626_95_1018 298
472 3300048915 Ga0496112_0033774 Ga0496112_0033774_2766_3698 298
473 3300048917 Ga0496114_0054470 Ga0496114_0054470_2329_3261 298
474 3300048917 Ga0496114_0203393 Ga0496114_0203393_672_1595 298
475 3300048918 Ga0496115_0002820 Ga0496115_0002820_6381_7304 298
476 3300048929 Ga0496126_0165434 Ga0496126_0165434_836_1789 298
477 3300049572 Ga0501036_0151773 Ga0501036_0151773_88_999 298
478 3300049576 Ga0501040_0041092 Ga0501040_0041092_1107_2018 298
479 3300049583 Ga0501067_0029164 Ga0501067_0029164_687_1610 298
480 3300049584 Ga0501068_0062470 Ga0501068_0062470_423_1331 298
481 3300049585 Ga0501069_0023211 Ga0501069_0023211_529_1452 298
482 3300049585 Ga0501069_0075860 Ga0501069_0075860_36_965 298
483 3300049586 Ga0501070_0001128 Ga0501070_0001128_13335_14264 298
484 3300049587 Ga0501071_0057905 Ga0501071_0057905_692_1603 298
485 3300049589 Ga0501073_0136037 Ga0501073_0136037_522_1451 298
486 3300049590 Ga0501074_0094897 Ga0501074_0094897_1136_2065 298
487 3300049592 Ga0501076_0109942 Ga0501076_0109942_822_1733 298
488 3300049593 Ga0501077_0236228 Ga0501077_0236228_241_1152 298
489 3300049822 Ga0501035_0218710 Ga0501035_0218710_350_1261 298
490 3300050491 nmdc:mga00v17_15403_c1 nmdc:mga00v17_15403_c1_3251_4168 298
491 3300050491 nmdc:mga00v17_168765_c1 nmdc:mga00v17_168765_c1_257_1168 298
492 3300050507 nmdc:mga05p37_163999_c1 nmdc:mga05p37_163999_c1_1511_2479 298
493 3300050511 nmdc:mga08y16_142249_c1 nmdc:mga08y16_142249_c1_392_1315 298
494 3300050512 nmdc:mga0n895_101584_c1 nmdc:mga0n895_101584_c1_1435_2367 298
495 3300053077 Ga0495601_0044837 Ga0495601_0044837_54_986 298
496 3300053085 Ga0495619_0043398 Ga0495619_0043398_516_1448 298
497 3300060353 Ga0501082_0143039 Ga0501082_0143039_661_1572 298
498 3300005329 Ga0070683_100302787 Ga0070683_1003027871 299
499 3300005535 Ga0070684_100345145 Ga0070684_1003451452 299
500 3300006038 Ga0075365_10306835 Ga0075365_103068352 299
501 3300009098 Ga0105245_10071017 Ga0105245_100710172 299
502 3300009148 Ga0105243_10140887 Ga0105243_101408872 299
503 3300010375 Ga0105239_10540018 Ga0105239_105400181 299
504 3300014325 Ga0163163_10165586 Ga0163163_101655862 299
505 3300028381 Ga0268264_10317185 Ga0268264_103171852 299
506 3300032005 Ga0307411_10018246 Ga0307411_100182462 299
507 3300032126 Ga0307415_100301410 Ga0307415_1003014102 299
508 3300044901 Ga0466960_0000222 Ga0466960_0000222_13961_14863 299
509 3300046689 Ga0495613_0192298 Ga0495613_0192298_260_1189 299
510 3300005327 Ga0070658_10049392 Ga0070658_100493922 300
511 3300005339 Ga0070660_100174863 Ga0070660_1001748632 300
512 3300013308 Ga0157375_10386925 Ga0157375_103869251 300
513 3300025919 Ga0207657_10017225 Ga0207657_100172253 300
514 3300044693 Ga0466961_0047290 Ga0466961_0047290_1349_2263 300
515 3300044901 Ga0466960_0066981 Ga0466960_0066981_37_951 300
516 3300048904 Ga0496101_0177346 Ga0496101_0177346_542_1459 300
517 3300048905 Ga0496102_0315017 Ga0496102_0315017_264_1181 300
518 3300049583 Ga0501067_0097538 Ga0501067_0097538_434_1351 300
519 3300049585 Ga0501069_0071904 Ga0501069_0071904_89_1006 300
520 3300053104 Ga0500556_0006831 Ga0500556_0006831_2299_3219 300
521 3300005618 Ga0068864_100225139 Ga0068864_1002251392 301
522 3300031548 Ga0307408_100048770 Ga0307408_1000487702 301
523 3300031824 Ga0307413_10006671 Ga0307413_100066715 301
524 3300031852 Ga0307410_10013937 Ga0307410_100139373 301
525 3300031903 Ga0307407_10038630 Ga0307407_100386302 301
526 3300031911 Ga0307412_10109353 Ga0307412_101093532 301
527 3300031995 Ga0307409_100028243 Ga0307409_1000282433 301
528 3300032126 Ga0307415_100041277 Ga0307415_1000412772 301
529 3300041512 Ga0451853_1321677 Ga0451853_1321677_280_1197 301
530 3300044706 Ga0466964_0075862 Ga0466964_0075862_378_1292 301
531 3300045976 Ga0466967_0032331 Ga0466967_0032331_522_1436 301
532 3300049586 Ga0501070_0020291 Ga0501070_0020291_929_1858 301
533 3300001990 JGI24737J22298_10047842 JGI24737J22298_100478422 302
534 3300005327 Ga0070658_10015728 Ga0070658_100157284 302
535 3300005327 Ga0070658_10034073 Ga0070658_100340731 302
536 3300005329 Ga0070683_100001232 Ga0070683_10000123219 302
537 3300005329 Ga0070683_100017715 Ga0070683_1000177152 302
538 3300005337 Ga0070682_100057892 Ga0070682_1000578922 302
539 3300005339 Ga0070660_100015370 Ga0070660_1000153704 302
540 3300005347 Ga0070668_100203540 Ga0070668_1002035402 302
541 3300005366 Ga0070659_100013610 Ga0070659_1000136102 302
542 3300005530 Ga0070679_100163650 Ga0070679_1001636501 302
543 3300005535 Ga0070684_100037092 Ga0070684_1000370924 302
544 3300005577 Ga0068857_100091898 Ga0068857_1000918982 302
545 3300005615 Ga0070702_100027475 Ga0070702_1000274752 302
546 3300005616 Ga0068852_100179329 Ga0068852_1001793292 302
547 3300005834 Ga0068851_10233813 Ga0068851_102338132 302
548 3300005842 Ga0068858_100088044 Ga0068858_1000880442 302
549 3300005843 Ga0068860_100055713 Ga0068860_1000557133 302
550 3300006881 Ga0068865_100015421 Ga0068865_1000154212 302
551 3300009098 Ga0105245_10004191 Ga0105245_100041917 302
552 3300009176 Ga0105242_10096588 Ga0105242_100965882 302
553 3300009177 Ga0105248_10126709 Ga0105248_101267092 302
554 3300009553 Ga0105249_10046879 Ga0105249_100468794 302
555 3300010375 Ga0105239_10001401 Ga0105239_1000140125 302
556 3300011119 Ga0105246_10020346 Ga0105246_100203462 302
557 3300013105 Ga0157369_10010249 Ga0157369_100102495 302
558 3300013307 Ga0157372_10003488 Ga0157372_100034884 302
559 3300013308 Ga0157375_10116640 Ga0157375_101166402 302
560 3300014325 Ga0163163_10030323 Ga0163163_100303232 302
561 3300014325 Ga0163163_10297372 Ga0163163_102973722 302
562 3300014497 Ga0182008_10037883 Ga0182008_100378832 302
563 3300014968 Ga0157379_10150335 Ga0157379_101503352 302
564 3300020082 Ga0206353_11472283 Ga0206353_114722831 302
565 3300025901 Ga0207688_10014711 Ga0207688_100147112 302
566 3300025904 Ga0207647_10023348 Ga0207647_100233485 302
567 3300025904 Ga0207647_10044393 Ga0207647_100443932 302
568 3300025909 Ga0207705_10244464 Ga0207705_102444641 302
569 3300025918 Ga0207662_10078331 Ga0207662_100783312 302
570 3300025919 Ga0207657_10017156 Ga0207657_100171564 302
571 3300025927 Ga0207687_10011578 Ga0207687_100115785 302
572 3300025932 Ga0207690_10026631 Ga0207690_100266314 302
573 3300025934 Ga0207686_10254455 Ga0207686_102544552 302
574 3300025938 Ga0207704_10051806 Ga0207704_100518062 302
575 3300025941 Ga0207711_10070477 Ga0207711_100704772 302
576 3300025944 Ga0207661_10008301 Ga0207661_100083015 302
577 3300025945 Ga0207679_10417354 Ga0207679_104173542 302
578 3300025961 Ga0207712_10254773 Ga0207712_102547731 302
579 3300026035 Ga0207703_10074893 Ga0207703_100748932 302
580 3300026116 Ga0207674_10001502 Ga0207674_1000150228 302
581 3300026142 Ga0207698_10022798 Ga0207698_100227984 302
582 3300028380 Ga0268265_10177735 Ga0268265_101777351 302
583 3300028381 Ga0268264_10161826 Ga0268264_101618262 302
584 3300044694 Ga0466963_0052342 Ga0466963_0052342_310_1227 302
585 3300044694 Ga0466963_0325653 Ga0466963_0325653_42_980 302
586 3300045051 Ga0451576_0314327 Ga0451576_0314327_679_1587 302
587 3300048911 Ga0496108_0048410 Ga0496108_0048410_1786_2694 302
588 3300048912 Ga0496109_0033853 Ga0496109_0033853_3338_4246 302
589 3300048913 Ga0496110_0005591 Ga0496110_0005591_8874_9782 302
590 3300048914 Ga0496111_0003383 Ga0496111_0003383_6759_7667 302
591 3300049569 Ga0501032_0151509 Ga0501032_0151509_170_1093 302
592 3300049571 Ga0501034_0024164 Ga0501034_0024164_779_1702 302
593 3300049574 Ga0501038_0260281 Ga0501038_0260281_368_1291 302
594 3300049583 Ga0501067_0009030 Ga0501067_0009030_257_1180 302
595 3300049585 Ga0501069_0071438 Ga0501069_0071438_110_1042 302
596 3300049586 Ga0501070_0010181 Ga0501070_0010181_5938_6861 302
597 3300049586 Ga0501070_0026305 Ga0501070_0026305_3228_4151 302
598 3300049586 Ga0501070_0055795 Ga0501070_0055795_1738_2670 302
599 3300049587 Ga0501071_0020255 Ga0501071_0020255_3155_4078 302
600 3300049588 Ga0501072_0010330 Ga0501072_0010330_5770_6693 302
601 3300049588 Ga0501072_0013391 Ga0501072_0013391_1911_2834 302
602 3300049589 Ga0501073_0022755 Ga0501073_0022755_354_1277 302
603 3300049589 Ga0501073_0069504 Ga0501073_0069504_852_1775 302
604 3300049590 Ga0501074_0002190 Ga0501074_0002190_5746_6669 302
605 3300049590 Ga0501074_0014132 Ga0501074_0014132_1922_2845 302
606 3300049593 Ga0501077_0028325 Ga0501077_0028325_2217_3140 302
607 3300049742 Ga0501080_0032083 Ga0501080_0032083_702_1625 302
608 3300049742 Ga0501080_0032198 Ga0501080_0032198_3206_4129 302
609 3300049744 Ga0501083_0067510 Ga0501083_0067510_983_1906 302
610 3300049822 Ga0501035_0070828 Ga0501035_0070828_2087_3010 302
611 3300060353 Ga0501082_0025779 Ga0501082_0025779_1065_1988 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01633

Choline_kinase

Choline/ethanolamine kinase

65

256

0.93

PF01636

APH

Phosphotransferase enzyme family

46

268

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxq-assembly1.cif.gz_A crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8992 8 300
3dxq-assembly2.cif.gz_B crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8841 9 300
3dxq-assembly1.cif.gz_A crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8676 8 300
3dxq-assembly2.cif.gz_B crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8501 9 300
4r77-assembly3.cif.gz_A crystal structure of choline kinase lica from streptococcus pneumoniae 0.8421 23 293
ID Description Score Start End Superfamily
3dxqA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8959 98 299 3.90.1200.10
3dxqA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8752 98 299 3.90.1200.10
af_Q869T9_99_346_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.833 71 285 3.90.1200.10
af_A0A0R0JRE3_107_353_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8312 59 276 3.90.1200.10
af_Q22820_83_335_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8246 65 283 3.90.1200.10
ID Description Score Start End GO Terms
AF-A0A2S9FBP0-F1-model_v4 LPS biosynthesis choline kinase 0.9866 113 299 GO:0004305
GO:0005737
GO:0006646
AF-A0A7G8WLK2-F1-model_v4 Phosphotransferase 0.9836 9 300 GO:0004305
GO:0005737
GO:0006646
AF-A0A1M4SB83-F1-model_v4 Thiamine kinase 0.9827 20 298 GO:0004305
GO:0005737
GO:0006646
AF-A0A6J6QKH1-F1-model_v4 Unannotated protein 0.9825 22 299 GO:0004305
GO:0005737
GO:0006646
AF-A0A1E7JSB5-F1-model_v4 Choline kinase 0.9798 8 299 GO:0004305
GO:0005737
GO:0006646

Feature Viewer

pLDDT pTM Quality
94.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map