F469082
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 289 | 609 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0000007|Ga0373934_0000007_24814_25794 |
| Length | 326 |
| Sequence | LGSELRDAQQQGGLLGGPDPAALDPVPAELATRLDRVPALAGVPRTVSELPGGLTNRNYKVTTPAGAFVARVWSGGDYLAINRDHEYSNSVAAAQAGVGAPVVAYRPDDRLLVLRFIEGRTFGDADVRAPANIPRIARACRMLHAGPRFTGDFDMFAIQGRYAAVTAEQGFVVPAGYDALMPQMEAARRALAVRAEHTVPCNNDLLAANFIDDGSRIWLIDYEYSGNNDACFELGNIWGECGLSADALADLVTAYYGRTLRNKIARAMLLGMVGKYGWTLWGAIQAATSPIEFDFWSWAMERYEGAEAGFTGPDFPRLLDDVQRDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 2 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 152 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 153 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.65 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 0 |
| Rhizoplane | 7.53 |
| Rhizosphere | 85.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10047842 | 3300001990 | Bacteria | 1303 |
| 2 | Ga0070658_10015728 | 3300005327 | Bacteria | 6051 |
| 3 | Ga0070658_10034073 | 3300005327 | Bacteria | 4097 |
| 4 | Ga0070658_10049392 | 3300005327 | Bacteria | 3408 |
| 5 | Ga0070683_100001232 | 3300005329 | Bacteria | 19471 |
| 6 | Ga0070683_100017715 | 3300005329 | Bacteria | 6294 |
| 7 | Ga0070683_100102154 | 3300005329 | Bacteria | 2700 |
| 8 | Ga0070683_100302787 | 3300005329 | Bacteria | 1521 |
| 9 | Ga0070682_100057892 | 3300005337 | Bacteria | 2443 |
| 10 | Ga0068868_100097208 | 3300005338 | Bacteria | 2379 |
| 11 | Ga0070660_100015370 | 3300005339 | Bacteria | 5523 |
| 12 | Ga0070660_100174863 | 3300005339 | Bacteria | 1736 |
| 13 | Ga0070692_10009892 | 3300005345 | Bacteria | 4318 |
| 14 | Ga0070668_100203540 | 3300005347 | Bacteria | 1626 |
| 15 | Ga0070671_100115155 | 3300005355 | Bacteria | 2260 |
| 16 | Ga0070659_100013610 | 3300005366 | Bacteria | 6060 |
| 17 | Ga0070667_100117524 | 3300005367 | Bacteria | 2310 |
| 18 | Ga0070667_100333395 | 3300005367 | Bacteria | 1371 |
| 19 | Ga0070709_10000393 | 3300005434 | Bacteria | 26736 |
| 20 | Ga0070709_10002150 | 3300005434 | Bacteria | 10671 |
| 21 | Ga0070714_100007992 | 3300005435 | Bacteria | 8243 |
| 22 | Ga0070714_100041324 | 3300005435 | Bacteria | 3890 |
| 23 | Ga0070714_100052385 | 3300005435 | Bacteria | 3480 |
| 24 | Ga0070713_100003090 | 3300005436 | Bacteria | 10950 |
| 25 | Ga0070713_100019917 | 3300005436 | Bacteria | 5135 |
| 26 | Ga0070713_100063827 | 3300005436 | Bacteria | 3089 |
| 27 | Ga0070713_100133506 | 3300005436 | Bacteria | 2191 |
| 28 | Ga0070710_10000118 | 3300005437 | Bacteria | 37278 |
| 29 | Ga0070710_10008773 | 3300005437 | Bacteria | 4930 |
| 30 | Ga0070701_10003175 | 3300005438 | Bacteria | 6460 |
| 31 | Ga0070711_100002815 | 3300005439 | Bacteria | 9987 |
| 32 | Ga0070711_100032679 | 3300005439 | Bacteria | 3461 |
| 33 | Ga0070700_100011926 | 3300005441 | Bacteria | 4828 |
| 34 | Ga0070708_100091932 | 3300005445 | Bacteria | 2764 |
| 35 | Ga0070708_100141504 | 3300005445 | Bacteria | 2231 |
| 36 | Ga0070663_100161679 | 3300005455 | Bacteria | 1724 |
| 37 | Ga0070662_100263581 | 3300005457 | Bacteria | 1389 |
| 38 | Ga0068867_100001433 | 3300005459 | Bacteria | 16515 |
| 39 | Ga0070685_10010101 | 3300005466 | Bacteria | 4897 |
| 40 | Ga0070706_100013883 | 3300005467 | Bacteria | 7446 |
| 41 | Ga0070706_100055527 | 3300005467 | Bacteria | 3656 |
| 42 | Ga0070706_100063721 | 3300005467 | Bacteria | 3406 |
| 43 | Ga0070706_100398814 | 3300005467 | Bacteria | 1281 |
| 44 | Ga0070706_100407684 | 3300005467 | Bacteria | 1265 |
| 45 | Ga0070707_100009334 | 3300005468 | Bacteria | 9105 |
| 46 | Ga0070707_100013452 | 3300005468 | Bacteria | 7657 |
| 47 | Ga0070707_100087115 | 3300005468 | Bacteria | 3020 |
| 48 | Ga0070707_100138215 | 3300005468 | Bacteria | 2370 |
| 49 | Ga0070698_100001429 | 3300005471 | Bacteria | 26454 |
| 50 | Ga0070698_100001988 | 3300005471 | Bacteria | 22693 |
| 51 | Ga0070698_100012072 | 3300005471 | Bacteria | 9159 |
| 52 | Ga0070698_100202410 | 3300005471 | Bacteria | 1921 |
| 53 | Ga0070679_100163650 | 3300005530 | Bacteria | 2198 |
| 54 | Ga0070684_100036154 | 3300005535 | Bacteria | 4231 |
| 55 | Ga0070684_100037092 | 3300005535 | Bacteria | 4179 |
| 56 | Ga0070684_100179335 | 3300005535 | Bacteria | 1925 |
| 57 | Ga0070684_100345145 | 3300005535 | Bacteria | 1369 |
| 58 | Ga0070697_100006356 | 3300005536 | Bacteria | 9144 |
| 59 | Ga0068853_100106466 | 3300005539 | Bacteria | 2485 |
| 60 | Ga0070672_100101955 | 3300005543 | Bacteria | 2329 |
| 61 | Ga0070686_100128439 | 3300005544 | Bacteria | 1750 |
| 62 | Ga0070695_100176528 | 3300005545 | Bacteria | 1511 |
| 63 | Ga0070665_100001502 | 3300005548 | Bacteria | 27146 |
| 64 | Ga0068855_100092310 | 3300005563 | Bacteria | 3492 |
| 65 | Ga0070664_100319381 | 3300005564 | Bacteria | 1407 |
| 66 | Ga0068857_100091898 | 3300005577 | Bacteria | 2717 |
| 67 | Ga0068857_100229528 | 3300005577 | Bacteria | 1697 |
| 68 | Ga0068856_100042986 | 3300005614 | Bacteria | 4446 |
| 69 | Ga0068856_100216288 | 3300005614 | Bacteria | 1931 |
| 70 | Ga0070702_100006960 | 3300005615 | Bacteria | 5386 |
| 71 | Ga0070702_100027475 | 3300005615 | Bacteria | 3071 |
| 72 | Ga0068852_100034917 | 3300005616 | Bacteria | 4188 |
| 73 | Ga0068852_100179329 | 3300005616 | Bacteria | 1991 |
| 74 | Ga0068864_100225139 | 3300005618 | Bacteria | 1732 |
| 75 | Ga0068864_100563156 | 3300005618 | Bacteria | 1103 |
| 76 | Ga0068861_100517640 | 3300005719 | Bacteria | 1081 |
| 77 | Ga0068851_10233813 | 3300005834 | Bacteria | 1037 |
| 78 | Ga0068870_10002785 | 3300005840 | Bacteria | 7353 |
| 79 | Ga0068863_100065358 | 3300005841 | Bacteria | 3441 |
| 80 | Ga0068858_100088044 | 3300005842 | Bacteria | 2889 |
| 81 | Ga0068860_100013790 | 3300005843 | Bacteria | 7924 |
| 82 | Ga0068860_100055713 | 3300005843 | Bacteria | 3759 |
| 83 | Ga0081540_1000101 | 3300005983 | Bacteria | 91600 |
| 84 | Ga0070717_10001162 | 3300006028 | Bacteria | 17781 |
| 85 | Ga0070717_10038972 | 3300006028 | Bacteria | 3864 |
| 86 | Ga0070717_10128987 | 3300006028 | Bacteria | 2173 |
| 87 | Ga0070717_10137382 | 3300006028 | Bacteria | 2106 |
| 88 | Ga0070717_10196157 | 3300006028 | Bacteria | 1766 |
| 89 | Ga0070717_10233349 | 3300006028 | Bacteria | 1620 |
| 90 | Ga0075365_10000395 | 3300006038 | Bacteria | 15977 |
| 91 | Ga0075365_10001285 | 3300006038 | Bacteria | 11170 |
| 92 | Ga0075365_10010292 | 3300006038 | Bacteria | 5434 |
| 93 | Ga0075365_10063528 | 3300006038 | Bacteria | 2472 |
| 94 | Ga0075365_10306835 | 3300006038 | Bacteria | 1117 |
| 95 | Ga0075368_10000942 | 3300006042 | Bacteria | 9046 |
| 96 | Ga0075368_10033381 | 3300006042 | Bacteria | 2002 |
| 97 | Ga0075363_100004211 | 3300006048 | Bacteria | 6249 |
| 98 | Ga0075363_100006959 | 3300006048 | Bacteria | 5171 |
| 99 | Ga0075363_100031710 | 3300006048 | Bacteria | 2741 |
| 100 | Ga0075363_100104692 | 3300006048 | Bacteria | 1569 |
| 101 | Ga0075363_100156745 | 3300006048 | Bacteria | 1287 |
| 102 | Ga0075364_10018466 | 3300006051 | Bacteria | 4365 |
| 103 | Ga0075364_10030803 | 3300006051 | Bacteria | 3445 |
| 104 | Ga0075364_10060428 | 3300006051 | Bacteria | 2485 |
| 105 | Ga0075364_10179921 | 3300006051 | Bacteria | 1430 |
| 106 | Ga0070715_10000355 | 3300006163 | Bacteria | 11423 |
| 107 | Ga0070715_10010175 | 3300006163 | Bacteria | 3343 |
| 108 | Ga0070715_10099150 | 3300006163 | Bacteria | 1355 |
| 109 | Ga0070716_100000214 | 3300006173 | Bacteria | 23074 |
| 110 | Ga0070716_100009383 | 3300006173 | Bacteria | 4874 |
| 111 | Ga0070712_100093502 | 3300006175 | Bacteria | 2207 |
| 112 | Ga0070712_100237153 | 3300006175 | Bacteria | 1451 |
| 113 | Ga0070712_100324129 | 3300006175 | Bacteria | 1253 |
| 114 | Ga0075367_10006133 | 3300006178 | Bacteria | 6047 |
| 115 | Ga0075367_10010378 | 3300006178 | Bacteria | 4892 |
| 116 | Ga0075367_10027364 | 3300006178 | Bacteria | 3244 |
| 117 | Ga0075367_10045081 | 3300006178 | Bacteria | 2587 |
| 118 | Ga0075370_10007754 | 3300006353 | Bacteria | 5482 |
| 119 | Ga0075370_10008770 | 3300006353 | Bacteria | 5217 |
| 120 | Ga0075370_10011275 | 3300006353 | Bacteria | 4693 |
| 121 | Ga0075428_100133536 | 3300006844 | Bacteria | 2699 |
| 122 | Ga0075433_10088296 | 3300006852 | Bacteria | 2739 |
| 123 | Ga0075434_100024136 | 3300006871 | Bacteria | 5941 |
| 124 | Ga0068865_100013659 | 3300006881 | Bacteria | 5140 |
| 125 | Ga0068865_100015421 | 3300006881 | Bacteria | 4874 |
| 126 | Ga0075436_100044651 | 3300006914 | Bacteria | 3056 |
| 127 | Ga0075435_100007385 | 3300007076 | Bacteria | 7827 |
| 128 | Ga0105240_10285827 | 3300009093 | Bacteria | 1893 |
| 129 | Ga0111539_10196303 | 3300009094 | Bacteria | 2354 |
| 130 | Ga0105245_10004191 | 3300009098 | Bacteria | 12802 |
| 131 | Ga0105245_10024387 | 3300009098 | Bacteria | 5310 |
| 132 | Ga0105245_10071017 | 3300009098 | Bacteria | 3161 |
| 133 | Ga0105245_10276056 | 3300009098 | Bacteria | 1641 |
| 134 | Ga0105245_10707028 | 3300009098 | Bacteria | 1041 |
| 135 | Ga0105247_10037233 | 3300009101 | Bacteria | 2968 |
| 136 | Ga0105247_10105222 | 3300009101 | Bacteria | 1809 |
| 137 | Ga0114129_10252314 | 3300009147 | Bacteria | 2368 |
| 138 | Ga0105243_10008568 | 3300009148 | Bacteria | 7847 |
| 139 | Ga0105243_10140887 | 3300009148 | Bacteria | 2057 |
| 140 | Ga0105242_10096588 | 3300009176 | Bacteria | 2497 |
| 141 | Ga0105248_10016577 | 3300009177 | Bacteria | 8113 |
| 142 | Ga0105248_10030379 | 3300009177 | Bacteria | 6033 |
| 143 | Ga0105248_10126709 | 3300009177 | Bacteria | 2880 |
| 144 | Ga0105237_10083279 | 3300009545 | Bacteria | 3190 |
| 145 | Ga0105249_10046879 | 3300009553 | Bacteria | 3935 |
| 146 | Ga0105249_10407822 | 3300009553 | Bacteria | 1390 |
| 147 | Ga0105249_10557130 | 3300009553 | Bacteria | 1197 |
| 148 | Ga0105239_10001401 | 3300010375 | Bacteria | 32259 |
| 149 | Ga0105239_10039937 | 3300010375 | Bacteria | 5140 |
| 150 | Ga0105239_10377457 | 3300010375 | Bacteria | 1603 |
| 151 | Ga0105239_10540018 | 3300010375 | Bacteria | 1327 |
| 152 | Ga0105246_10020346 | 3300011119 | Bacteria | 4254 |
| 153 | Ga0157373_10152051 | 3300013100 | Bacteria | 1628 |
| 154 | Ga0157370_10045919 | 3300013104 | Bacteria | 4190 |
| 155 | Ga0157370_10307197 | 3300013104 | Bacteria | 1464 |
| 156 | Ga0157369_10010249 | 3300013105 | Bacteria | 10695 |
| 157 | Ga0157374_10353924 | 3300013296 | Bacteria | 1459 |
| 158 | Ga0163162_10842078 | 3300013306 | Bacteria | 1033 |
| 159 | Ga0157372_10003488 | 3300013307 | Bacteria | 16951 |
| 160 | Ga0157372_10069745 | 3300013307 | Bacteria | 3954 |
| 161 | Ga0157372_10560519 | 3300013307 | Bacteria | 1332 |
| 162 | Ga0157375_10116640 | 3300013308 | Bacteria | 2775 |
| 163 | Ga0157375_10386925 | 3300013308 | Bacteria | 1565 |
| 164 | Ga0163163_10030323 | 3300014325 | Bacteria | 5210 |
| 165 | Ga0163163_10165586 | 3300014325 | Bacteria | 2257 |
| 166 | Ga0163163_10280569 | 3300014325 | Bacteria | 1717 |
| 167 | Ga0163163_10297372 | 3300014325 | Bacteria | 1666 |
| 168 | Ga0157380_10005423 | 3300014326 | Bacteria | 8909 |
| 169 | Ga0182008_10037883 | 3300014497 | Bacteria | 2412 |
| 170 | Ga0157377_10021132 | 3300014745 | Bacteria | 3420 |
| 171 | Ga0157377_10298853 | 3300014745 | Bacteria | 1062 |
| 172 | Ga0157379_10026415 | 3300014968 | Bacteria | 5168 |
| 173 | Ga0157379_10150335 | 3300014968 | Bacteria | 2100 |
| 174 | Ga0206353_11038000 | 3300020082 | Bacteria | 1855 |
| 175 | Ga0206353_11472283 | 3300020082 | Bacteria | 1208 |
| 176 | Ga0213875_10007239 | 3300021388 | Bacteria | 5754 |
| 177 | Ga0224712_10002726 | 3300022467 | Bacteria | 4435 |
| 178 | Ga0207697_10072134 | 3300025315 | Bacteria | 1448 |
| 179 | Ga0207692_10000122 | 3300025898 | Bacteria | 23339 |
| 180 | Ga0207692_10000713 | 3300025898 | Bacteria | 11699 |
| 181 | Ga0207688_10003539 | 3300025901 | Bacteria | 8522 |
| 182 | Ga0207688_10014711 | 3300025901 | Bacteria | 4248 |
| 183 | Ga0207647_10023348 | 3300025904 | Bacteria | 4090 |
| 184 | Ga0207647_10044393 | 3300025904 | Bacteria | 2778 |
| 185 | Ga0207685_10000120 | 3300025905 | Bacteria | 11840 |
| 186 | Ga0207699_10000714 | 3300025906 | Bacteria | 15864 |
| 187 | Ga0207699_10001391 | 3300025906 | Bacteria | 11495 |
| 188 | Ga0207699_10005177 | 3300025906 | Bacteria | 6238 |
| 189 | Ga0207643_10002721 | 3300025908 | Bacteria | 9563 |
| 190 | Ga0207705_10244464 | 3300025909 | Bacteria | 1367 |
| 191 | Ga0207684_10284179 | 3300025910 | Bacteria | 1427 |
| 192 | Ga0207684_10383877 | 3300025910 | Bacteria | 1208 |
| 193 | Ga0207654_10202429 | 3300025911 | Bacteria | 1308 |
| 194 | Ga0207671_10115066 | 3300025914 | Bacteria | 2050 |
| 195 | Ga0207693_10009710 | 3300025915 | Bacteria | 7834 |
| 196 | Ga0207693_10010893 | 3300025915 | Bacteria | 7376 |
| 197 | Ga0207693_10088875 | 3300025915 | Bacteria | 2421 |
| 198 | Ga0207693_10342507 | 3300025915 | Bacteria | 1170 |
| 199 | Ga0207663_10019056 | 3300025916 | Bacteria | 3857 |
| 200 | Ga0207663_10026721 | 3300025916 | Bacteria | 3354 |
| 201 | Ga0207663_10047859 | 3300025916 | Bacteria | 2642 |
| 202 | Ga0207662_10078331 | 3300025918 | Bacteria | 2012 |
| 203 | Ga0207657_10017156 | 3300025919 | Bacteria | 6955 |
| 204 | Ga0207657_10017225 | 3300025919 | Bacteria | 6939 |
| 205 | Ga0207646_10000259 | 3300025922 | Bacteria | 72047 |
| 206 | Ga0207646_10005503 | 3300025922 | Bacteria | 13312 |
| 207 | Ga0207646_10027514 | 3300025922 | Bacteria | 5186 |
| 208 | Ga0207646_10065871 | 3300025922 | Bacteria | 3234 |
| 209 | Ga0207659_10231374 | 3300025926 | Bacteria | 1491 |
| 210 | Ga0207687_10011578 | 3300025927 | Bacteria | 5767 |
| 211 | Ga0207687_10032642 | 3300025927 | Bacteria | 3527 |
| 212 | Ga0207700_10000043 | 3300025928 | Bacteria | 92646 |
| 213 | Ga0207700_10009579 | 3300025928 | Bacteria | 6064 |
| 214 | Ga0207700_10013712 | 3300025928 | Bacteria | 5286 |
| 215 | Ga0207700_10050730 | 3300025928 | Bacteria | 3093 |
| 216 | Ga0207664_10000123 | 3300025929 | Bacteria | 68003 |
| 217 | Ga0207664_10002506 | 3300025929 | Bacteria | 12162 |
| 218 | Ga0207664_10009872 | 3300025929 | Bacteria | 6720 |
| 219 | Ga0207664_10010144 | 3300025929 | Bacteria | 6645 |
| 220 | Ga0207664_10081219 | 3300025929 | Bacteria | 2637 |
| 221 | Ga0207664_10324735 | 3300025929 | Bacteria | 1358 |
| 222 | Ga0207690_10026631 | 3300025932 | Bacteria | 3642 |
| 223 | Ga0207690_10210344 | 3300025932 | Bacteria | 1482 |
| 224 | Ga0207706_10078480 | 3300025933 | Bacteria | 2904 |
| 225 | Ga0207686_10254455 | 3300025934 | Bacteria | 1285 |
| 226 | Ga0207709_10191663 | 3300025935 | Bacteria | 1453 |
| 227 | Ga0207670_10025135 | 3300025936 | Bacteria | 3734 |
| 228 | Ga0207704_10031819 | 3300025938 | Bacteria | 2977 |
| 229 | Ga0207704_10051806 | 3300025938 | Bacteria | 2485 |
| 230 | Ga0207665_10000157 | 3300025939 | Bacteria | 46258 |
| 231 | Ga0207665_10000755 | 3300025939 | Bacteria | 21758 |
| 232 | Ga0207665_10003518 | 3300025939 | Bacteria | 10464 |
| 233 | Ga0207665_10054130 | 3300025939 | Bacteria | 2706 |
| 234 | Ga0207665_10054643 | 3300025939 | Bacteria | 2693 |
| 235 | Ga0207691_10005262 | 3300025940 | Bacteria | 12490 |
| 236 | Ga0207711_10070477 | 3300025941 | Bacteria | 3032 |
| 237 | Ga0207661_10008301 | 3300025944 | Bacteria | 7420 |
| 238 | Ga0207661_10022346 | 3300025944 | Bacteria | 4762 |
| 239 | Ga0207679_10417354 | 3300025945 | Bacteria | 1184 |
| 240 | Ga0207667_10285091 | 3300025949 | Bacteria | 1688 |
| 241 | Ga0207651_10044292 | 3300025960 | Bacteria | 2977 |
| 242 | Ga0207712_10254773 | 3300025961 | Bacteria | 1420 |
| 243 | Ga0207658_10091510 | 3300025986 | Bacteria | 2360 |
| 244 | Ga0207677_10023021 | 3300026023 | Bacteria | 3839 |
| 245 | Ga0207703_10074893 | 3300026035 | Bacteria | 2804 |
| 246 | Ga0207639_10025957 | 3300026041 | Bacteria | 4253 |
| 247 | Ga0207678_10189221 | 3300026067 | Bacteria | 1759 |
| 248 | Ga0207708_10000918 | 3300026075 | Bacteria | 22067 |
| 249 | Ga0207702_10213434 | 3300026078 | Bacteria | 1795 |
| 250 | Ga0207641_10020519 | 3300026088 | Bacteria | 5428 |
| 251 | Ga0207648_10003123 | 3300026089 | Bacteria | 17493 |
| 252 | Ga0207674_10001502 | 3300026116 | Bacteria | 30105 |
| 253 | Ga0207674_10069839 | 3300026116 | Bacteria | 3532 |
| 254 | Ga0207675_100062252 | 3300026118 | Bacteria | 3484 |
| 255 | Ga0207698_10003844 | 3300026142 | Bacteria | 9087 |
| 256 | Ga0207698_10022798 | 3300026142 | Bacteria | 4361 |
| 257 | Ga0268266_10005197 | 3300028379 | Bacteria | 12253 |
| 258 | Ga0268265_10177735 | 3300028380 | Bacteria | 1826 |
| 259 | Ga0268264_10001927 | 3300028381 | Bacteria | 18714 |
| 260 | Ga0268264_10161826 | 3300028381 | Bacteria | 2017 |
| 261 | Ga0268264_10317185 | 3300028381 | Bacteria | 1473 |
| 262 | Ga0307408_100048770 | 3300031548 | Bacteria | 3039 |
| 263 | Ga0307413_10006671 | 3300031824 | Bacteria | 5295 |
| 264 | Ga0307410_10013937 | 3300031852 | Bacteria | 4710 |
| 265 | Ga0307407_10038630 | 3300031903 | Bacteria | 2647 |
| 266 | Ga0307412_10014999 | 3300031911 | Bacteria | 4583 |
| 267 | Ga0307412_10109353 | 3300031911 | Bacteria | 1971 |
| 268 | Ga0307409_100028243 | 3300031995 | Bacteria | 3992 |
| 269 | Ga0307409_100866629 | 3300031995 | Bacteria | 915 |
| 270 | Ga0307411_10018246 | 3300032005 | Bacteria | 4020 |
| 271 | Ga0307415_100041277 | 3300032126 | Bacteria | 3062 |
| 272 | Ga0307415_100301410 | 3300032126 | Bacteria | 1328 |
| 273 | Ga0373938_0003218 | 3300034957 | Bacteria | 2658 |
| 274 | Ga0373926_0007070 | 3300035083 | Bacteria | 3735 |
| 275 | Ga0373928_0046399 | 3300035084 | Bacteria | 1014 |
| 276 | Ga0373934_0000007 | 3300035086 | Bacteria | 74186 |
| 277 | Ga0373951_0004215 | 3300035091 | Bacteria | 3425 |
| 278 | Ga0373923_0022285 | 3300035111 | Bacteria | 2482 |
| 279 | Ga0373932_0008942 | 3300035112 | Bacteria | 2401 |
| 280 | Ga0373953_0000069 | 3300035117 | Bacteria | 25378 |
| 281 | Ga0373953_0048168 | 3300035117 | Bacteria | 1716 |
| 282 | Ga0373953_0093010 | 3300035117 | Bacteria | 1263 |
| 283 | Ga0373954_0017481 | 3300035118 | Bacteria | 3222 |
| 284 | Ga0373954_0061644 | 3300035118 | Bacteria | 1770 |
| 285 | Ga0373956_0000247 | 3300035119 | Bacteria | 21461 |
| 286 | Ga0373956_0008600 | 3300035119 | Bacteria | 4135 |
| 287 | Ga0373956_0010223 | 3300035119 | Bacteria | 3839 |
| 288 | Ga0373956_0034487 | 3300035119 | Bacteria | 2229 |
| 289 | Ga0373957_0000104 | 3300035120 | Bacteria | 20587 |
| 290 | Ga0373946_0090128 | 3300035171 | Bacteria | 1357 |
| 291 | Ga0373955_0000062 | 3300035172 | Bacteria | 42579 |
| 292 | Ga0373955_0042049 | 3300035172 | Bacteria | 2452 |
| 293 | Ga0373955_0082803 | 3300035172 | Bacteria | 1816 |
| 294 | Ga0373955_0285400 | 3300035172 | Bacteria | 993 |
| 295 | Ga0373942_0044935 | 3300035207 | Bacteria | 1218 |
| 296 | Ga0373924_0003207 | 3300035410 | Bacteria | 5594 |
| 297 | Ga0373924_0007699 | 3300035410 | Bacteria | 3892 |
| 298 | Ga0373924_0019431 | 3300035410 | Bacteria | 2632 |
| 299 | Ga0373924_0037253 | 3300035410 | Bacteria | 1979 |
| 300 | Ga0373935_0001373 | 3300035692 | Bacteria | 13454 |
| 301 | Ga0373935_0007490 | 3300035692 | Bacteria | 6535 |
| 302 | Ga0373935_0053401 | 3300035692 | Bacteria | 2571 |
| 303 | Ga0373935_0117939 | 3300035692 | Bacteria | 1769 |
| 304 | Ga0373933_0000021 | 3300035724 | Bacteria | 96820 |
| 305 | Ga0373933_0077063 | 3300035724 | Bacteria | 2037 |
| 306 | Ga0373933_0085242 | 3300035724 | Bacteria | 1942 |
| 307 | Ga0373947_0000004 | 3300035725 | Bacteria | 248228 |
| 308 | Ga0373947_0025009 | 3300035725 | Bacteria | 3482 |
| 309 | Ga0373937_0000032 | 3300036401 | Bacteria | 120148 |
| 310 | Ga0373937_0013811 | 3300036401 | Bacteria | 7115 |
| 311 | Ga0373937_0043208 | 3300036401 | Bacteria | 4112 |
| 312 | Ga0373937_0064399 | 3300036401 | Bacteria | 3371 |
| 313 | Ga0373937_0077743 | 3300036401 | Bacteria | 3066 |
| 314 | Ga0373937_0084631 | 3300036401 | Bacteria | 2934 |
| 315 | Ga0372808_004530 | 3300036459 | Bacteria | 1778 |
| 316 | Ga0373925_0001429 | 3300037068 | Bacteria | 20682 |
| 317 | Ga0373925_0015549 | 3300037068 | Bacteria | 5505 |
| 318 | Ga0395905_0037932 | 3300037471 | Bacteria | 4522 |
| 319 | Ga0436364_1266718 | 3300037853 | Bacteria | 10125 |
| 320 | Ga0395901_0009154 | 3300038443 | Bacteria | 10031 |
| 321 | Ga0436363_0107859 | 3300039450 | Bacteria | 1560 |
| 322 | Ga0451853_1321677 | 3300041512 | Bacteria | 1818 |
| 323 | Ga0439464_0035403 | 3300042439 | Bacteria | 1410 |
| 324 | Ga0466969_0067089 | 3300044656 | Bacteria | 1732 |
| 325 | Ga0466965_0119424 | 3300044683 | Bacteria | 1360 |
| 326 | Ga0466965_0121151 | 3300044683 | Bacteria | 1351 |
| 327 | Ga0466966_0017700 | 3300044684 | Bacteria | 4705 |
| 328 | Ga0466961_0026780 | 3300044693 | Bacteria | 3707 |
| 329 | Ga0466961_0047290 | 3300044693 | Bacteria | 2751 |
| 330 | Ga0466963_0052342 | 3300044694 | Bacteria | 2709 |
| 331 | Ga0466963_0097794 | 3300044694 | Bacteria | 2006 |
| 332 | Ga0466963_0325653 | 3300044694 | Bacteria | 1081 |
| 333 | Ga0466964_0075862 | 3300044706 | Bacteria | 1432 |
| 334 | Ga0466968_0066565 | 3300044735 | Bacteria | 1561 |
| 335 | Ga0466957_0007038 | 3300044842 | Bacteria | 6358 |
| 336 | Ga0466960_0000222 | 3300044901 | Bacteria | 19771 |
| 337 | Ga0466960_0009779 | 3300044901 | Bacteria | 3965 |
| 338 | Ga0466960_0042557 | 3300044901 | Bacteria | 2157 |
| 339 | Ga0466960_0066981 | 3300044901 | Bacteria | 1777 |
| 340 | Ga0466959_0041338 | 3300045049 | Bacteria | 3403 |
| 341 | Ga0451576_0314327 | 3300045051 | Bacteria | 1639 |
| 342 | Ga0466958_0073391 | 3300045836 | Bacteria | 2096 |
| 343 | Ga0466958_0232739 | 3300045836 | Bacteria | 1177 |
| 344 | Ga0466967_0000340 | 3300045976 | Bacteria | 21475 |
| 345 | Ga0466967_0032331 | 3300045976 | Bacteria | 4416 |
| 346 | Ga0466967_0039503 | 3300045976 | Bacteria | 4057 |
| 347 | Ga0466967_0383544 | 3300045976 | Bacteria | 1365 |
| 348 | Ga0495592_0000143 | 3300046454 | Bacteria | 63228 |
| 349 | Ga0495592_0016975 | 3300046454 | Bacteria | 5526 |
| 350 | Ga0495592_0216174 | 3300046454 | Bacteria | 1284 |
| 351 | Ga0495592_0217543 | 3300046454 | Bacteria | 1279 |
| 352 | Ga0495603_0230327 | 3300046455 | Bacteria | 1068 |
| 353 | Ga0495629_0007909 | 3300046459 | Bacteria | 7822 |
| 354 | Ga0495641_0006091 | 3300046461 | Bacteria | 7916 |
| 355 | Ga0495641_0044260 | 3300046461 | Bacteria | 2054 |
| 356 | Ga0495651_0000010 | 3300046462 | Bacteria | 148763 |
| 357 | Ga0495651_0014433 | 3300046462 | Bacteria | 6106 |
| 358 | Ga0495651_0025106 | 3300046462 | Bacteria | 4637 |
| 359 | Ga0495651_0030726 | 3300046462 | Bacteria | 4188 |
| 360 | Ga0495653_0016054 | 3300046463 | Bacteria | 6103 |
| 361 | Ga0495653_0022865 | 3300046463 | Bacteria | 5055 |
| 362 | Ga0495653_0074820 | 3300046463 | Bacteria | 2522 |
| 363 | Ga0495653_0096628 | 3300046463 | Bacteria | 2147 |
| 364 | Ga0495639_0087471 | 3300046475 | Bacteria | 1458 |
| 365 | Ga0495662_0088515 | 3300046476 | Bacteria | 1508 |
| 366 | Ga0495664_0014990 | 3300046477 | Bacteria | 4401 |
| 367 | Ga0495608_0000037 | 3300046511 | Bacteria | 125064 |
| 368 | Ga0495608_0022320 | 3300046511 | Bacteria | 4339 |
| 369 | Ga0495608_0038804 | 3300046511 | Bacteria | 3196 |
| 370 | Ga0495608_0102908 | 3300046511 | Bacteria | 1840 |
| 371 | Ga0495618_0020453 | 3300046514 | Bacteria | 4073 |
| 372 | Ga0495618_0023354 | 3300046514 | Bacteria | 3823 |
| 373 | Ga0495618_0053713 | 3300046514 | Bacteria | 2547 |
| 374 | Ga0495628_0000884 | 3300046516 | Bacteria | 27634 |
| 375 | Ga0495628_0025452 | 3300046516 | Bacteria | 4834 |
| 376 | Ga0495628_0095225 | 3300046516 | Bacteria | 2300 |
| 377 | Ga0495652_0000135 | 3300046529 | Bacteria | 82725 |
| 378 | Ga0495652_0003503 | 3300046529 | Bacteria | 15454 |
| 379 | Ga0495652_0017198 | 3300046529 | Bacteria | 6455 |
| 380 | Ga0495652_0064009 | 3300046529 | Bacteria | 3095 |
| 381 | Ga0495652_0090789 | 3300046529 | Bacteria | 2498 |
| 382 | Ga0495652_0137325 | 3300046529 | Bacteria | 1927 |
| 383 | Ga0495665_0001237 | 3300046531 | Bacteria | 13619 |
| 384 | Ga0495665_0036246 | 3300046531 | Bacteria | 2633 |
| 385 | Ga0495640_0011881 | 3300046533 | Bacteria | 6677 |
| 386 | Ga0495640_0018076 | 3300046533 | Bacteria | 5238 |
| 387 | Ga0495640_0131786 | 3300046533 | Bacteria | 1617 |
| 388 | Ga0495640_0142003 | 3300046533 | Bacteria | 1547 |
| 389 | Ga0495640_0242594 | 3300046533 | Bacteria | 1130 |
| 390 | Ga0495586_0034438 | 3300046535 | Bacteria | 2720 |
| 391 | Ga0495586_0051369 | 3300046535 | Bacteria | 2231 |
| 392 | Ga0495587_0000024 | 3300046536 | Bacteria | 148753 |
| 393 | Ga0495587_0007488 | 3300046536 | Bacteria | 7069 |
| 394 | Ga0495587_0008644 | 3300046536 | Bacteria | 6544 |
| 395 | Ga0495587_0028474 | 3300046536 | Bacteria | 3397 |
| 396 | Ga0495587_0070670 | 3300046536 | Bacteria | 2031 |
| 397 | Ga0495587_0158434 | 3300046536 | Bacteria | 1289 |
| 398 | Ga0495645_0020033 | 3300046543 | Bacteria | 4822 |
| 399 | Ga0495645_0059982 | 3300046543 | Bacteria | 2758 |
| 400 | Ga0495645_0082565 | 3300046543 | Bacteria | 2304 |
| 401 | Ga0495645_0088972 | 3300046543 | Bacteria | 2208 |
| 402 | Ga0495645_0229439 | 3300046543 | Bacteria | 1244 |
| 403 | Ga0495667_0000024 | 3300046559 | Bacteria | 168313 |
| 404 | Ga0495667_0003687 | 3300046559 | Bacteria | 10306 |
| 405 | Ga0495667_0069221 | 3300046559 | Bacteria | 2303 |
| 406 | Ga0495634_0023000 | 3300046642 | Bacteria | 4387 |
| 407 | Ga0495634_0023699 | 3300046642 | Bacteria | 4311 |
| 408 | Ga0495634_0298811 | 3300046642 | Bacteria | 974 |
| 409 | Ga0495635_0010469 | 3300046663 | Bacteria | 6486 |
| 410 | Ga0495635_0026588 | 3300046663 | Bacteria | 4025 |
| 411 | Ga0495635_0030003 | 3300046663 | Bacteria | 3780 |
| 412 | Ga0495635_0061238 | 3300046663 | Bacteria | 2585 |
| 413 | Ga0495657_0000057 | 3300046675 | Bacteria | 98920 |
| 414 | Ga0495657_0031985 | 3300046675 | Bacteria | 3674 |
| 415 | Ga0495657_0082163 | 3300046675 | Bacteria | 2082 |
| 416 | Ga0495657_0195246 | 3300046675 | Bacteria | 1235 |
| 417 | Ga0495599_0028132 | 3300046678 | Bacteria | 3522 |
| 418 | Ga0495599_0038901 | 3300046678 | Bacteria | 2989 |
| 419 | Ga0495599_0097561 | 3300046678 | Bacteria | 1832 |
| 420 | Ga0495623_0001532 | 3300046679 | Bacteria | 15609 |
| 421 | Ga0495623_0017468 | 3300046679 | Bacteria | 4635 |
| 422 | Ga0495623_0032106 | 3300046679 | Bacteria | 3375 |
| 423 | Ga0495623_0074386 | 3300046679 | Bacteria | 2111 |
| 424 | Ga0495623_0136971 | 3300046679 | Bacteria | 1460 |
| 425 | Ga0495646_0003118 | 3300046680 | Bacteria | 10281 |
| 426 | Ga0495646_0016513 | 3300046680 | Bacteria | 4686 |
| 427 | Ga0495646_0099995 | 3300046680 | Bacteria | 1664 |
| 428 | Ga0495646_0269185 | 3300046680 | Bacteria | 908 |
| 429 | Ga0495658_0009836 | 3300046683 | Bacteria | 4769 |
| 430 | Ga0495658_0109318 | 3300046683 | Bacteria | 1660 |
| 431 | Ga0495613_0005908 | 3300046689 | Bacteria | 9161 |
| 432 | Ga0495613_0192298 | 3300046689 | Bacteria | 1442 |
| 433 | Ga0495613_0337681 | 3300046689 | Bacteria | 1037 |
| 434 | Ga0495600_0003738 | 3300046809 | Bacteria | 9003 |
| 435 | Ga0495600_0013347 | 3300046809 | Bacteria | 5159 |
| 436 | Ga0495600_0016761 | 3300046809 | Bacteria | 4656 |
| 437 | Ga0495600_0071273 | 3300046809 | Bacteria | 2270 |
| 438 | Ga0495600_0146150 | 3300046809 | Bacteria | 1532 |
| 439 | Ga0495581_0100935 | 3300047315 | Bacteria | 1676 |
| 440 | Ga0495604_0000024 | 3300047317 | Bacteria | 148542 |
| 441 | Ga0495604_0023458 | 3300047317 | Bacteria | 4922 |
| 442 | Ga0495604_0029704 | 3300047317 | Bacteria | 4348 |
| 443 | Ga0495604_0057269 | 3300047317 | Bacteria | 2996 |
| 444 | Ga0495604_0060913 | 3300047317 | Bacteria | 2888 |
| 445 | Ga0495604_0173945 | 3300047317 | Bacteria | 1511 |
| 446 | Ga0495674_0003692 | 3300047319 | Bacteria | 14889 |
| 447 | Ga0495674_0069252 | 3300047319 | Bacteria | 3051 |
| 448 | Ga0495674_0222776 | 3300047319 | Bacteria | 1558 |
| 449 | Ga0495674_0312611 | 3300047319 | Bacteria | 1281 |
| 450 | Ga0495680_0000005 | 3300047322 | Bacteria | 168308 |
| 451 | Ga0495680_0023341 | 3300047322 | Bacteria | 5145 |
| 452 | Ga0495680_0026914 | 3300047322 | Bacteria | 4733 |
| 453 | Ga0495680_0072314 | 3300047322 | Bacteria | 2623 |
| 454 | Ga0495680_0212442 | 3300047322 | Bacteria | 1384 |
| 455 | Ga0495675_0000908 | 3300047444 | Bacteria | 18056 |
| 456 | Ga0495675_0018111 | 3300047444 | Bacteria | 4467 |
| 457 | Ga0495675_0119107 | 3300047444 | Bacteria | 1644 |
| 458 | Ga0495684_0017914 | 3300047471 | Bacteria | 5456 |
| 459 | Ga0495684_0061844 | 3300047471 | Bacteria | 2848 |
| 460 | Ga0495684_0067556 | 3300047471 | Bacteria | 2718 |
| 461 | Ga0495684_0296959 | 3300047471 | Bacteria | 1161 |
| 462 | Ga0495593_0009206 | 3300047673 | Bacteria | 5726 |
| 463 | Ga0495593_0143017 | 3300047673 | Bacteria | 1211 |
| 464 | Ga0495602_0000203 | 3300048088 | Bacteria | 55275 |
| 465 | Ga0495602_0018827 | 3300048088 | Bacteria | 6876 |
| 466 | Ga0495602_0026255 | 3300048088 | Bacteria | 5620 |
| 467 | Ga0495602_0046818 | 3300048088 | Bacteria | 3902 |
| 468 | Ga0495602_0158839 | 3300048088 | Bacteria | 1767 |
| 469 | Ga0495602_0177830 | 3300048088 | Bacteria | 1644 |
| 470 | Ga0495614_0033262 | 3300048089 | Bacteria | 2218 |
| 471 | Ga0496100_0046564 | 3300048903 | Bacteria | 2790 |
| 472 | Ga0496100_0070452 | 3300048903 | Bacteria | 2332 |
| 473 | Ga0496100_0198521 | 3300048903 | Bacteria | 1461 |
| 474 | Ga0496101_0025095 | 3300048904 | Bacteria | 4132 |
| 475 | Ga0496101_0060316 | 3300048904 | Bacteria | 2752 |
| 476 | Ga0496101_0113108 | 3300048904 | Bacteria | 2045 |
| 477 | Ga0496101_0144954 | 3300048904 | Bacteria | 1813 |
| 478 | Ga0496101_0177346 | 3300048904 | Bacteria | 1640 |
| 479 | Ga0496102_0045481 | 3300048905 | Bacteria | 3986 |
| 480 | Ga0496102_0315017 | 3300048905 | Bacteria | 1474 |
| 481 | Ga0496103_0025068 | 3300048906 | Bacteria | 3602 |
| 482 | Ga0496104_0002161 | 3300048907 | Bacteria | 17061 |
| 483 | Ga0496104_0004890 | 3300048907 | Bacteria | 11682 |
| 484 | Ga0496104_0040795 | 3300048907 | Bacteria | 4351 |
| 485 | Ga0496104_0077242 | 3300048907 | Bacteria | 3173 |
| 486 | Ga0496105_0166655 | 3300048908 | Bacteria | 1807 |
| 487 | Ga0496106_0064670 | 3300048909 | Bacteria | 2783 |
| 488 | Ga0496106_0191325 | 3300048909 | Bacteria | 1627 |
| 489 | Ga0496107_0021104 | 3300048910 | Bacteria | 4602 |
| 490 | Ga0496107_0249637 | 3300048910 | Bacteria | 1320 |
| 491 | Ga0496108_0002163 | 3300048911 | Bacteria | 15751 |
| 492 | Ga0496108_0048410 | 3300048911 | Bacteria | 3554 |
| 493 | Ga0496108_0059539 | 3300048911 | Bacteria | 3211 |
| 494 | Ga0496109_0033853 | 3300048912 | Bacteria | 4599 |
| 495 | Ga0496109_0034242 | 3300048912 | Bacteria | 4573 |
| 496 | Ga0496109_0041191 | 3300048912 | Bacteria | 4185 |
| 497 | Ga0496109_0056212 | 3300048912 | Bacteria | 3591 |
| 498 | Ga0496109_0172874 | 3300048912 | Bacteria | 2027 |
| 499 | Ga0496109_0328113 | 3300048912 | Bacteria | 1445 |
| 500 | Ga0496110_0005591 | 3300048913 | Bacteria | 9869 |
| 501 | Ga0496110_0028683 | 3300048913 | Bacteria | 4783 |
| 502 | Ga0496110_0061400 | 3300048913 | Bacteria | 3317 |
| 503 | Ga0496110_0065626 | 3300048913 | Bacteria | 3210 |
| 504 | Ga0496110_0086799 | 3300048913 | Bacteria | 2794 |
| 505 | Ga0496111_0003383 | 3300048914 | Bacteria | 9861 |
| 506 | Ga0496111_0054503 | 3300048914 | Bacteria | 2891 |
| 507 | Ga0496112_0033774 | 3300048915 | Bacteria | 4975 |
| 508 | Ga0496114_0004149 | 3300048917 | Bacteria | 11211 |
| 509 | Ga0496114_0016361 | 3300048917 | Bacteria | 5975 |
| 510 | Ga0496114_0020218 | 3300048917 | Bacteria | 5402 |
| 511 | Ga0496114_0054470 | 3300048917 | Bacteria | 3335 |
| 512 | Ga0496114_0203393 | 3300048917 | Bacteria | 1735 |
| 513 | Ga0496115_0002820 | 3300048918 | Bacteria | 12494 |
| 514 | Ga0496115_0003989 | 3300048918 | Bacteria | 10647 |
| 515 | Ga0496115_0018700 | 3300048918 | Bacteria | 5326 |
| 516 | Ga0496115_0126428 | 3300048918 | Bacteria | 2106 |
| 517 | Ga0496124_0072603 | 3300048927 | Bacteria | 2850 |
| 518 | Ga0496126_0165434 | 3300048929 | Bacteria | 1888 |
| 519 | Ga0501031_0012205 | 3300049568 | Bacteria | 5600 |
| 520 | Ga0501032_0151509 | 3300049569 | Bacteria | 1525 |
| 521 | Ga0501034_0024164 | 3300049571 | Bacteria | 6182 |
| 522 | Ga0501036_0009566 | 3300049572 | Bacteria | 7973 |
| 523 | Ga0501036_0151773 | 3300049572 | Bacteria | 1954 |
| 524 | Ga0501038_0008824 | 3300049574 | Bacteria | 9248 |
| 525 | Ga0501038_0260281 | 3300049574 | Bacteria | 1372 |
| 526 | Ga0501039_0034837 | 3300049575 | Bacteria | 3885 |
| 527 | Ga0501040_0041092 | 3300049576 | Bacteria | 3149 |
| 528 | Ga0501040_0132121 | 3300049576 | Bacteria | 1756 |
| 529 | Ga0501041_0004371 | 3300049577 | Bacteria | 8178 |
| 530 | Ga0501043_0022733 | 3300049579 | Bacteria | 4918 |
| 531 | Ga0501046_0007451 | 3300049580 | Bacteria | 9617 |
| 532 | Ga0501048_0005560 | 3300049582 | Bacteria | 9586 |
| 533 | Ga0501067_0005126 | 3300049583 | Bacteria | 7278 |
| 534 | Ga0501067_0009030 | 3300049583 | Bacteria | 5521 |
| 535 | Ga0501067_0029164 | 3300049583 | Bacteria | 3058 |
| 536 | Ga0501067_0097538 | 3300049583 | Bacteria | 1632 |
| 537 | Ga0501068_0013340 | 3300049584 | Bacteria | 4674 |
| 538 | Ga0501068_0062470 | 3300049584 | Bacteria | 2265 |
| 539 | Ga0501069_0023211 | 3300049585 | Bacteria | 3381 |
| 540 | Ga0501069_0049483 | 3300049585 | Bacteria | 2336 |
| 541 | Ga0501069_0071438 | 3300049585 | Bacteria | 1945 |
| 542 | Ga0501069_0071904 | 3300049585 | Bacteria | 1939 |
| 543 | Ga0501069_0075860 | 3300049585 | Bacteria | 1889 |
| 544 | Ga0501070_0001128 | 3300049586 | Bacteria | 23951 |
| 545 | Ga0501070_0010181 | 3300049586 | Bacteria | 7959 |
| 546 | Ga0501070_0020291 | 3300049586 | Bacteria | 5575 |
| 547 | Ga0501070_0026305 | 3300049586 | Bacteria | 4883 |
| 548 | Ga0501070_0055795 | 3300049586 | Bacteria | 3275 |
| 549 | Ga0501070_0068149 | 3300049586 | Bacteria | 2946 |
| 550 | Ga0501070_0081652 | 3300049586 | Bacteria | 2675 |
| 551 | Ga0501071_0013342 | 3300049587 | Bacteria | 5597 |
| 552 | Ga0501071_0020255 | 3300049587 | Bacteria | 4621 |
| 553 | Ga0501071_0057905 | 3300049587 | Bacteria | 2801 |
| 554 | Ga0501072_0010330 | 3300049588 | Bacteria | 7112 |
| 555 | Ga0501072_0013391 | 3300049588 | Bacteria | 6278 |
| 556 | Ga0501072_0044182 | 3300049588 | Bacteria | 3503 |
| 557 | Ga0501073_0022755 | 3300049589 | Bacteria | 4509 |
| 558 | Ga0501073_0069504 | 3300049589 | Bacteria | 2453 |
| 559 | Ga0501073_0136037 | 3300049589 | Bacteria | 1703 |
| 560 | Ga0501074_0002190 | 3300049590 | Bacteria | 13535 |
| 561 | Ga0501074_0014132 | 3300049590 | Bacteria | 5804 |
| 562 | Ga0501074_0094897 | 3300049590 | Bacteria | 2136 |
| 563 | Ga0501076_0016612 | 3300049592 | Bacteria | 5580 |
| 564 | Ga0501076_0109942 | 3300049592 | Bacteria | 2228 |
| 565 | Ga0501076_0128422 | 3300049592 | Bacteria | 2055 |
| 566 | Ga0501077_0028325 | 3300049593 | Bacteria | 3560 |
| 567 | Ga0501077_0236228 | 3300049593 | Bacteria | 1162 |
| 568 | Ga0501079_0014589 | 3300049741 | Bacteria | 5992 |
| 569 | Ga0501080_0032083 | 3300049742 | Bacteria | 4897 |
| 570 | Ga0501080_0032198 | 3300049742 | Bacteria | 4888 |
| 571 | Ga0501081_0004570 | 3300049743 | Bacteria | 8888 |
| 572 | Ga0501083_0067510 | 3300049744 | Bacteria | 2380 |
| 573 | Ga0501035_0070828 | 3300049822 | Bacteria | 3088 |
| 574 | Ga0501035_0218710 | 3300049822 | Bacteria | 1627 |
| 575 | Ga0501044_0374824 | 3300049823 | Bacteria | 1339 |
| 576 | nmdc:mga03n38_202457_c1 | 3300050490 | Bacteria | 1028 |
| 577 | nmdc:mga00v17_15403_c1 | 3300050491 | Bacteria | 4290 |
| 578 | nmdc:mga00v17_168765_c1 | 3300050491 | Bacteria | 1410 |
| 579 | nmdc:mga00v17_62769_c1 | 3300050491 | Bacteria | 2287 |
| 580 | nmdc:mga00v17_7464_c1 | 3300050491 | Bacteria | 5836 |
| 581 | nmdc:mga0yw44_4801_c2 | 3300050492 | Bacteria | 3603 |
| 582 | nmdc:mga0yw44_49760_c1 | 3300050492 | Bacteria | 2531 |
| 583 | nmdc:mga0yw44_683_c1 | 3300050492 | Bacteria | 12392 |
| 584 | nmdc:mga06z11_17654_c1 | 3300050494 | Bacteria | 3244 |
| 585 | nmdc:mga05p37_163999_c1 | 3300050507 | Bacteria | 2713 |
| 586 | nmdc:mga08y16_142249_c1 | 3300050511 | Bacteria | 2494 |
| 587 | nmdc:mga0n895_101584_c1 | 3300050512 | Bacteria | 2886 |
| 588 | nmdc:mga0n895_39270_c1 | 3300050512 | Bacteria | 4592 |
| 589 | nmdc:mga0rr50_13618_c1 | 3300050513 | Bacteria | 5304 |
| 590 | nmdc:mga08x19_22498_c1 | 3300050514 | Bacteria | 3904 |
| 591 | nmdc:mga08x19_274917_c1 | 3300050514 | Bacteria | 1166 |
| 592 | Ga0495601_0044837 | 3300053077 | Bacteria | 2779 |
| 593 | Ga0495601_0060812 | 3300053077 | Bacteria | 2397 |
| 594 | Ga0495601_0114848 | 3300053077 | Bacteria | 1745 |
| 595 | Ga0495612_0025612 | 3300053078 | Bacteria | 2369 |
| 596 | Ga0495595_0005587 | 3300053084 | Bacteria | 5091 |
| 597 | Ga0495595_0006117 | 3300053084 | Bacteria | 4890 |
| 598 | Ga0495595_0061027 | 3300053084 | Bacteria | 1765 |
| 599 | Ga0495619_0009226 | 3300053085 | Bacteria | 6233 |
| 600 | Ga0495619_0043398 | 3300053085 | Bacteria | 2947 |
| 601 | Ga0495619_0128668 | 3300053085 | Bacteria | 1739 |
| 602 | Ga0495619_0161586 | 3300053085 | Bacteria | 1547 |
| 603 | Ga0500644_0000047 | 3300053088 | Bacteria | 73844 |
| 604 | Ga0500556_0006831 | 3300053104 | Bacteria | 3248 |
| 605 | Ga0501084_0007175 | 3300054114 | Bacteria | 9179 |
| 606 | Ga0501082_0005438 | 3300060353 | Bacteria | 11055 |
| 607 | Ga0501082_0025779 | 3300060353 | Bacteria | 5066 |
| 608 | Ga0501082_0143039 | 3300060353 | Bacteria | 2076 |
| 609 | Ga0530510_0010929 | 3300061734 | Bacteria | 6369 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100866629 | Ga0307409_1008666292 | 246 |
| 2 | 3300006038 | Ga0075365_10063528 | Ga0075365_100635282 | 257 |
| 3 | 3300006178 | Ga0075367_10010378 | Ga0075367_100103783 | 257 |
| 4 | 3300050490 | nmdc:mga03n38_202457_c1 | nmdc:mga03n38_202457_c1_213_992 | 259 |
| 5 | 3300050492 | nmdc:mga0yw44_49760_c1 | nmdc:mga0yw44_49760_c1_953_1732 | 259 |
| 6 | 3300046536 | Ga0495587_0158434 | Ga0495587_0158434_457_1248 | 262 |
| 7 | 3300048904 | Ga0496101_0113108 | Ga0496101_0113108_39_914 | 264 |
| 8 | 3300005467 | Ga0070706_100407684 | Ga0070706_1004076842 | 265 |
| 9 | 3300013307 | Ga0157372_10560519 | Ga0157372_105605192 | 266 |
| 10 | 3300035724 | Ga0373933_0085242 | Ga0373933_0085242_1084_1929 | 266 |
| 11 | 3300046642 | Ga0495634_0298811 | Ga0495634_0298811_96_941 | 266 |
| 12 | 3300046680 | Ga0495646_0269185 | Ga0495646_0269185_53_895 | 266 |
| 13 | 3300048904 | Ga0496101_0060316 | Ga0496101_0060316_982_1785 | 266 |
| 14 | 3300048905 | Ga0496102_0045481 | Ga0496102_0045481_1182_1985 | 266 |
| 15 | 3300048906 | Ga0496103_0025068 | Ga0496103_0025068_17_820 | 266 |
| 16 | 3300048909 | Ga0496106_0064670 | Ga0496106_0064670_1580_2383 | 266 |
| 17 | 3300048910 | Ga0496107_0021104 | Ga0496107_0021104_2807_3610 | 266 |
| 18 | 3300048917 | Ga0496114_0016361 | Ga0496114_0016361_3700_4503 | 266 |
| 19 | 3300048918 | Ga0496115_0126428 | Ga0496115_0126428_865_1668 | 266 |
| 20 | 3300049572 | Ga0501036_0009566 | Ga0501036_0009566_2391_3293 | 267 |
| 21 | 3300049574 | Ga0501038_0008824 | Ga0501038_0008824_7198_8100 | 267 |
| 22 | 3300049575 | Ga0501039_0034837 | Ga0501039_0034837_2024_2926 | 267 |
| 23 | 3300049577 | Ga0501041_0004371 | Ga0501041_0004371_2208_3110 | 267 |
| 24 | 3300049579 | Ga0501043_0022733 | Ga0501043_0022733_1372_2274 | 267 |
| 25 | 3300049582 | Ga0501048_0005560 | Ga0501048_0005560_2337_3239 | 267 |
| 26 | 3300049584 | Ga0501068_0013340 | Ga0501068_0013340_2629_3531 | 267 |
| 27 | 3300049586 | Ga0501070_0068149 | Ga0501070_0068149_1333_2235 | 267 |
| 28 | 3300049588 | Ga0501072_0044182 | Ga0501072_0044182_666_1568 | 267 |
| 29 | 3300049592 | Ga0501076_0016612 | Ga0501076_0016612_274_1176 | 267 |
| 30 | 3300049741 | Ga0501079_0014589 | Ga0501079_0014589_2102_3004 | 267 |
| 31 | 3300049743 | Ga0501081_0004570 | Ga0501081_0004570_7231_8133 | 267 |
| 32 | 3300060353 | Ga0501082_0005438 | Ga0501082_0005438_7319_8221 | 267 |
| 33 | 3300061734 | Ga0530510_0010929 | Ga0530510_0010929_3961_4863 | 267 |
| 34 | 3300049568 | Ga0501031_0012205 | Ga0501031_0012205_1071_1973 | 268 |
| 35 | 3300049580 | Ga0501046_0007451 | Ga0501046_0007451_7156_8058 | 268 |
| 36 | 3300049585 | Ga0501069_0049483 | Ga0501069_0049483_1101_2003 | 268 |
| 37 | 3300049587 | Ga0501071_0013342 | Ga0501071_0013342_1072_1974 | 268 |
| 38 | 3300049823 | Ga0501044_0374824 | Ga0501044_0374824_12_818 | 268 |
| 39 | 3300054114 | Ga0501084_0007175 | Ga0501084_0007175_1443_2345 | 268 |
| 40 | 3300048918 | Ga0496115_0018700 | Ga0496115_0018700_2132_3037 | 269 |
| 41 | 3300044656 | Ga0466969_0067089 | Ga0466969_0067089_611_1480 | 271 |
| 42 | 3300044683 | Ga0466965_0121151 | Ga0466965_0121151_128_997 | 271 |
| 43 | 3300044684 | Ga0466966_0017700 | Ga0466966_0017700_954_1823 | 271 |
| 44 | 3300044693 | Ga0466961_0026780 | Ga0466961_0026780_1233_2102 | 271 |
| 45 | 3300044735 | Ga0466968_0066565 | Ga0466968_0066565_34_903 | 271 |
| 46 | 3300044842 | Ga0466957_0007038 | Ga0466957_0007038_1424_2293 | 271 |
| 47 | 3300044901 | Ga0466960_0009779 | Ga0466960_0009779_1041_1910 | 271 |
| 48 | 3300045836 | Ga0466958_0073391 | Ga0466958_0073391_780_1649 | 271 |
| 49 | 3300045976 | Ga0466967_0039503 | Ga0466967_0039503_910_1779 | 271 |
| 50 | 3300048088 | Ga0495602_0177830 | Ga0495602_0177830_793_1614 | 271 |
| 51 | 3300048911 | Ga0496108_0059539 | Ga0496108_0059539_2375_3199 | 272 |
| 52 | 3300048903 | Ga0496100_0046564 | Ga0496100_0046564_1432_2346 | 277 |
| 53 | 3300048907 | Ga0496104_0002161 | Ga0496104_0002161_4131_5045 | 277 |
| 54 | 3300048908 | Ga0496105_0166655 | Ga0496105_0166655_38_952 | 277 |
| 55 | 3300048912 | Ga0496109_0034242 | Ga0496109_0034242_221_1135 | 277 |
| 56 | 3300048913 | Ga0496110_0086799 | Ga0496110_0086799_382_1296 | 277 |
| 57 | 3300048917 | Ga0496114_0020218 | Ga0496114_0020218_4157_5071 | 277 |
| 58 | 3300048918 | Ga0496115_0003989 | Ga0496115_0003989_4366_5280 | 277 |
| 59 | 3300013306 | Ga0163162_10842078 | Ga0163162_108420781 | 279 |
| 60 | 3300048903 | Ga0496100_0198521 | Ga0496100_0198521_122_1024 | 279 |
| 61 | 3300037068 | Ga0373925_0015549 | Ga0373925_0015549_4173_5120 | 280 |
| 62 | 3300044683 | Ga0466965_0119424 | Ga0466965_0119424_257_1114 | 281 |
| 63 | 3300048912 | Ga0496109_0056212 | Ga0496109_0056212_503_1357 | 281 |
| 64 | 3300049576 | Ga0501040_0132121 | Ga0501040_0132121_302_1231 | 281 |
| 65 | 3300005548 | Ga0070665_100001502 | Ga0070665_10000150215 | 282 |
| 66 | 3300028379 | Ga0268266_10005197 | Ga0268266_1000519712 | 282 |
| 67 | 3300044694 | Ga0466963_0097794 | Ga0466963_0097794_198_1055 | 282 |
| 68 | 3300044901 | Ga0466960_0042557 | Ga0466960_0042557_92_940 | 282 |
| 69 | 3300048909 | Ga0496106_0191325 | Ga0496106_0191325_736_1584 | 282 |
| 70 | 3300035117 | Ga0373953_0093010 | Ga0373953_0093010_32_943 | 283 |
| 71 | 3300035172 | Ga0373955_0082803 | Ga0373955_0082803_516_1427 | 283 |
| 72 | 3300035692 | Ga0373935_0053401 | Ga0373935_0053401_1359_2267 | 283 |
| 73 | 3300035725 | Ga0373947_0025009 | Ga0373947_0025009_1712_2620 | 283 |
| 74 | 3300036401 | Ga0373937_0043208 | Ga0373937_0043208_912_1823 | 283 |
| 75 | 3300037068 | Ga0373925_0001429 | Ga0373925_0001429_11681_12592 | 283 |
| 76 | 3300046454 | Ga0495592_0216174 | Ga0495592_0216174_13_924 | 283 |
| 77 | 3300046462 | Ga0495651_0025106 | Ga0495651_0025106_942_1853 | 283 |
| 78 | 3300046463 | Ga0495653_0016054 | Ga0495653_0016054_2875_3786 | 283 |
| 79 | 3300046511 | Ga0495608_0022320 | Ga0495608_0022320_2408_3319 | 283 |
| 80 | 3300046514 | Ga0495618_0023354 | Ga0495618_0023354_2404_3315 | 283 |
| 81 | 3300046529 | Ga0495652_0003503 | Ga0495652_0003503_32_943 | 283 |
| 82 | 3300046529 | Ga0495652_0064009 | Ga0495652_0064009_521_1429 | 283 |
| 83 | 3300046533 | Ga0495640_0242594 | Ga0495640_0242594_17_925 | 283 |
| 84 | 3300046536 | Ga0495587_0028474 | Ga0495587_0028474_1968_2879 | 283 |
| 85 | 3300046543 | Ga0495645_0059982 | Ga0495645_0059982_663_1571 | 283 |
| 86 | 3300046543 | Ga0495645_0229439 | Ga0495645_0229439_129_1040 | 283 |
| 87 | 3300046559 | Ga0495667_0069221 | Ga0495667_0069221_139_1050 | 283 |
| 88 | 3300046663 | Ga0495635_0061238 | Ga0495635_0061238_1167_2078 | 283 |
| 89 | 3300046675 | Ga0495657_0082163 | Ga0495657_0082163_902_1813 | 283 |
| 90 | 3300046678 | Ga0495599_0097561 | Ga0495599_0097561_579_1490 | 283 |
| 91 | 3300046679 | Ga0495623_0074386 | Ga0495623_0074386_820_1731 | 283 |
| 92 | 3300046680 | Ga0495646_0099995 | Ga0495646_0099995_559_1470 | 283 |
| 93 | 3300046809 | Ga0495600_0013347 | Ga0495600_0013347_1600_2511 | 283 |
| 94 | 3300047317 | Ga0495604_0029704 | Ga0495604_0029704_831_1742 | 283 |
| 95 | 3300047319 | Ga0495674_0003692 | Ga0495674_0003692_7249_8157 | 283 |
| 96 | 3300047322 | Ga0495680_0212442 | Ga0495680_0212442_236_1147 | 283 |
| 97 | 3300047471 | Ga0495684_0061844 | Ga0495684_0061844_928_1839 | 283 |
| 98 | 3300047471 | Ga0495684_0296959 | Ga0495684_0296959_174_1082 | 283 |
| 99 | 3300048088 | Ga0495602_0158839 | Ga0495602_0158839_164_1075 | 283 |
| 100 | 3300053077 | Ga0495601_0060812 | Ga0495601_0060812_272_1183 | 283 |
| 101 | 3300053077 | Ga0495601_0114848 | Ga0495601_0114848_405_1313 | 283 |
| 102 | 3300053085 | Ga0495619_0161586 | Ga0495619_0161586_334_1245 | 283 |
| 103 | 3300005434 | Ga0070709_10000393 | Ga0070709_100003939 | 284 |
| 104 | 3300005435 | Ga0070714_100007992 | Ga0070714_1000079924 | 284 |
| 105 | 3300005436 | Ga0070713_100003090 | Ga0070713_1000030907 | 284 |
| 106 | 3300005437 | Ga0070710_10000118 | Ga0070710_100001188 | 284 |
| 107 | 3300005439 | Ga0070711_100002815 | Ga0070711_10000281511 | 284 |
| 108 | 3300006028 | Ga0070717_10001162 | Ga0070717_100011627 | 284 |
| 109 | 3300006173 | Ga0070716_100000214 | Ga0070716_1000002145 | 284 |
| 110 | 3300022467 | Ga0224712_10002726 | Ga0224712_100027263 | 284 |
| 111 | 3300025898 | Ga0207692_10000713 | Ga0207692_100007136 | 284 |
| 112 | 3300025906 | Ga0207699_10001391 | Ga0207699_100013915 | 284 |
| 113 | 3300025916 | Ga0207663_10019056 | Ga0207663_100190562 | 284 |
| 114 | 3300025928 | Ga0207700_10000043 | Ga0207700_1000004381 | 284 |
| 115 | 3300025929 | Ga0207664_10000123 | Ga0207664_1000012360 | 284 |
| 116 | 3300025939 | Ga0207665_10000157 | Ga0207665_1000015747 | 284 |
| 117 | 3300045049 | Ga0466959_0041338 | Ga0466959_0041338_872_1813 | 286 |
| 118 | 3300047673 | Ga0495593_0143017 | Ga0495593_0143017_215_1114 | 287 |
| 119 | 3300048913 | Ga0496110_0028683 | Ga0496110_0028683_1874_2743 | 287 |
| 120 | 3300005544 | Ga0070686_100128439 | Ga0070686_1001284392 | 289 |
| 121 | 3300025915 | Ga0207693_10010893 | Ga0207693_100108937 | 289 |
| 122 | 3300049586 | Ga0501070_0081652 | Ga0501070_0081652_1083_1964 | 289 |
| 123 | 3300025910 | Ga0207684_10383877 | Ga0207684_103838772 | 290 |
| 124 | 3300049583 | Ga0501067_0005126 | Ga0501067_0005126_4400_5323 | 290 |
| 125 | 3300045976 | Ga0466967_0383544 | Ga0466967_0383544_56_940 | 292 |
| 126 | 3300048904 | Ga0496101_0025095 | Ga0496101_0025095_24_905 | 292 |
| 127 | 3300048907 | Ga0496104_0077242 | Ga0496104_0077242_521_1402 | 292 |
| 128 | 3300048917 | Ga0496114_0004149 | Ga0496114_0004149_4824_5705 | 292 |
| 129 | 3300050512 | nmdc:mga0n895_39270_c1 | nmdc:mga0n895_39270_c1_831_1715 | 292 |
| 130 | 3300050513 | nmdc:mga0rr50_13618_c1 | nmdc:mga0rr50_13618_c1_3590_4474 | 292 |
| 131 | 3300050514 | nmdc:mga08x19_22498_c1 | nmdc:mga08x19_22498_c1_2537_3421 | 292 |
| 132 | 3300005471 | Ga0070698_100001988 | Ga0070698_10000198813 | 293 |
| 133 | 3300005468 | Ga0070707_100009334 | Ga0070707_1000093344 | 294 |
| 134 | 3300005471 | Ga0070698_100012072 | Ga0070698_1000120723 | 294 |
| 135 | 3300010375 | Ga0105239_10039937 | Ga0105239_100399374 | 294 |
| 136 | 3300025922 | Ga0207646_10000259 | Ga0207646_100002594 | 294 |
| 137 | 3300005434 | Ga0070709_10002150 | Ga0070709_100021502 | 295 |
| 138 | 3300005435 | Ga0070714_100041324 | Ga0070714_1000413242 | 295 |
| 139 | 3300005435 | Ga0070714_100052385 | Ga0070714_1000523853 | 295 |
| 140 | 3300005436 | Ga0070713_100019917 | Ga0070713_1000199172 | 295 |
| 141 | 3300005436 | Ga0070713_100063827 | Ga0070713_1000638272 | 295 |
| 142 | 3300005436 | Ga0070713_100133506 | Ga0070713_1001335061 | 295 |
| 143 | 3300005437 | Ga0070710_10008773 | Ga0070710_100087732 | 295 |
| 144 | 3300005439 | Ga0070711_100032679 | Ga0070711_1000326792 | 295 |
| 145 | 3300005445 | Ga0070708_100091932 | Ga0070708_1000919322 | 295 |
| 146 | 3300005467 | Ga0070706_100055527 | Ga0070706_1000555272 | 295 |
| 147 | 3300005467 | Ga0070706_100398814 | Ga0070706_1003988141 | 295 |
| 148 | 3300005468 | Ga0070707_100087115 | Ga0070707_1000871152 | 295 |
| 149 | 3300005471 | Ga0070698_100202410 | Ga0070698_1002024102 | 295 |
| 150 | 3300005536 | Ga0070697_100006356 | Ga0070697_1000063565 | 295 |
| 151 | 3300006028 | Ga0070717_10128987 | Ga0070717_101289872 | 295 |
| 152 | 3300006028 | Ga0070717_10137382 | Ga0070717_101373822 | 295 |
| 153 | 3300006163 | Ga0070715_10010175 | Ga0070715_100101752 | 295 |
| 154 | 3300006173 | Ga0070716_100009383 | Ga0070716_1000093833 | 295 |
| 155 | 3300006175 | Ga0070712_100093502 | Ga0070712_1000935022 | 295 |
| 156 | 3300006175 | Ga0070712_100324129 | Ga0070712_1003241291 | 295 |
| 157 | 3300006871 | Ga0075434_100024136 | Ga0075434_1000241362 | 295 |
| 158 | 3300007076 | Ga0075435_100007385 | Ga0075435_1000073855 | 295 |
| 159 | 3300009098 | Ga0105245_10707028 | Ga0105245_107070281 | 295 |
| 160 | 3300020082 | Ga0206353_11038000 | Ga0206353_110380001 | 295 |
| 161 | 3300025898 | Ga0207692_10000122 | Ga0207692_1000012220 | 295 |
| 162 | 3300025906 | Ga0207699_10000714 | Ga0207699_100007149 | 295 |
| 163 | 3300025910 | Ga0207684_10284179 | Ga0207684_102841791 | 295 |
| 164 | 3300025915 | Ga0207693_10342507 | Ga0207693_103425071 | 295 |
| 165 | 3300025916 | Ga0207663_10047859 | Ga0207663_100478592 | 295 |
| 166 | 3300025928 | Ga0207700_10009579 | Ga0207700_100095794 | 295 |
| 167 | 3300025928 | Ga0207700_10013712 | Ga0207700_100137122 | 295 |
| 168 | 3300025929 | Ga0207664_10009872 | Ga0207664_100098724 | 295 |
| 169 | 3300025929 | Ga0207664_10010144 | Ga0207664_100101443 | 295 |
| 170 | 3300025939 | Ga0207665_10000755 | Ga0207665_100007552 | 295 |
| 171 | 3300039450 | Ga0436363_0107859 | Ga0436363_0107859_176_1078 | 295 |
| 172 | 3300045976 | Ga0466967_0000340 | Ga0466967_0000340_8266_9162 | 295 |
| 173 | 3300046477 | Ga0495664_0014990 | Ga0495664_0014990_2482_3384 | 295 |
| 174 | 3300046533 | Ga0495640_0131786 | Ga0495640_0131786_454_1356 | 295 |
| 175 | 3300046543 | Ga0495645_0088972 | Ga0495645_0088972_1203_2105 | 295 |
| 176 | 3300047319 | Ga0495674_0069252 | Ga0495674_0069252_1243_2145 | 295 |
| 177 | 3300050492 | nmdc:mga0yw44_4801_c2 | nmdc:mga0yw44_4801_c2_624_1520 | 295 |
| 178 | 3300053078 | Ga0495612_0025612 | Ga0495612_0025612_353_1255 | 295 |
| 179 | iso_pu_bacteria | 2643221615 | 2644089061 | 295 |
| 180 | iso_pu_bacteria | 2643221657 | 2644318906 | 295 |
| 181 | 3300005445 | Ga0070708_100141504 | Ga0070708_1001415042 | 296 |
| 182 | 3300005467 | Ga0070706_100063721 | Ga0070706_1000637212 | 296 |
| 183 | 3300005471 | Ga0070698_100001429 | Ga0070698_10000142913 | 296 |
| 184 | 3300005564 | Ga0070664_100319381 | Ga0070664_1003193812 | 296 |
| 185 | 3300005577 | Ga0068857_100229528 | Ga0068857_1002295282 | 296 |
| 186 | 3300005614 | Ga0068856_100042986 | Ga0068856_1000429862 | 296 |
| 187 | 3300005618 | Ga0068864_100563156 | Ga0068864_1005631561 | 296 |
| 188 | 3300006028 | Ga0070717_10233349 | Ga0070717_102333492 | 296 |
| 189 | 3300006163 | Ga0070715_10099150 | Ga0070715_100991502 | 296 |
| 190 | 3300006175 | Ga0070712_100237153 | Ga0070712_1002371532 | 296 |
| 191 | 3300009098 | Ga0105245_10276056 | Ga0105245_102760562 | 296 |
| 192 | 3300009101 | Ga0105247_10037233 | Ga0105247_100372332 | 296 |
| 193 | 3300009177 | Ga0105248_10030379 | Ga0105248_100303795 | 296 |
| 194 | 3300009545 | Ga0105237_10083279 | Ga0105237_100832792 | 296 |
| 195 | 3300009553 | Ga0105249_10407822 | Ga0105249_104078221 | 296 |
| 196 | 3300013104 | Ga0157370_10045919 | Ga0157370_100459192 | 296 |
| 197 | 3300013296 | Ga0157374_10353924 | Ga0157374_103539242 | 296 |
| 198 | 3300014745 | Ga0157377_10298853 | Ga0157377_102988531 | 296 |
| 199 | 3300014968 | Ga0157379_10026415 | Ga0157379_100264153 | 296 |
| 200 | 3300021388 | Ga0213875_10007239 | Ga0213875_100072392 | 296 |
| 201 | 3300025914 | Ga0207671_10115066 | Ga0207671_101150662 | 296 |
| 202 | 3300025915 | Ga0207693_10088875 | Ga0207693_100888752 | 296 |
| 203 | 3300025929 | Ga0207664_10324735 | Ga0207664_103247352 | 296 |
| 204 | 3300025939 | Ga0207665_10054130 | Ga0207665_100541302 | 296 |
| 205 | 3300026078 | Ga0207702_10213434 | Ga0207702_102134342 | 296 |
| 206 | 3300026088 | Ga0207641_10020519 | Ga0207641_100205193 | 296 |
| 207 | 3300026116 | Ga0207674_10069839 | Ga0207674_100698392 | 296 |
| 208 | 3300035083 | Ga0373926_0007070 | Ga0373926_0007070_1738_2655 | 296 |
| 209 | 3300035111 | Ga0373923_0022285 | Ga0373923_0022285_559_1476 | 296 |
| 210 | 3300035117 | Ga0373953_0048168 | Ga0373953_0048168_412_1329 | 296 |
| 211 | 3300035118 | Ga0373954_0061644 | Ga0373954_0061644_335_1252 | 296 |
| 212 | 3300035171 | Ga0373946_0090128 | Ga0373946_0090128_195_1112 | 296 |
| 213 | 3300035172 | Ga0373955_0285400 | Ga0373955_0285400_21_938 | 296 |
| 214 | 3300035410 | Ga0373924_0003207 | Ga0373924_0003207_4512_5429 | 296 |
| 215 | 3300035692 | Ga0373935_0117939 | Ga0373935_0117939_262_1179 | 296 |
| 216 | 3300035724 | Ga0373933_0077063 | Ga0373933_0077063_506_1423 | 296 |
| 217 | 3300037853 | Ga0436364_1266718 | Ga0436364_1266718_8274_9185 | 296 |
| 218 | 3300045836 | Ga0466958_0232739 | Ga0466958_0232739_137_1060 | 296 |
| 219 | 3300046454 | Ga0495592_0016975 | Ga0495592_0016975_3474_4391 | 296 |
| 220 | 3300046461 | Ga0495641_0044260 | Ga0495641_0044260_11_916 | 296 |
| 221 | 3300046462 | Ga0495651_0014433 | Ga0495651_0014433_4083_5000 | 296 |
| 222 | 3300046463 | Ga0495653_0096628 | Ga0495653_0096628_1107_2024 | 296 |
| 223 | 3300046475 | Ga0495639_0087471 | Ga0495639_0087471_37_954 | 296 |
| 224 | 3300046476 | Ga0495662_0088515 | Ga0495662_0088515_549_1466 | 296 |
| 225 | 3300046511 | Ga0495608_0102908 | Ga0495608_0102908_365_1282 | 296 |
| 226 | 3300046514 | Ga0495618_0053713 | Ga0495618_0053713_558_1475 | 296 |
| 227 | 3300046516 | Ga0495628_0025452 | Ga0495628_0025452_917_1834 | 296 |
| 228 | 3300046529 | Ga0495652_0090789 | Ga0495652_0090789_1037_1954 | 296 |
| 229 | 3300046531 | Ga0495665_0036246 | Ga0495665_0036246_929_1846 | 296 |
| 230 | 3300046533 | Ga0495640_0011881 | Ga0495640_0011881_2025_2942 | 296 |
| 231 | 3300046535 | Ga0495586_0034438 | Ga0495586_0034438_467_1384 | 296 |
| 232 | 3300046536 | Ga0495587_0007488 | Ga0495587_0007488_3225_4142 | 296 |
| 233 | 3300046543 | Ga0495645_0082565 | Ga0495645_0082565_621_1538 | 296 |
| 234 | 3300046642 | Ga0495634_0023000 | Ga0495634_0023000_478_1395 | 296 |
| 235 | 3300046663 | Ga0495635_0010469 | Ga0495635_0010469_482_1399 | 296 |
| 236 | 3300046675 | Ga0495657_0195246 | Ga0495657_0195246_308_1225 | 296 |
| 237 | 3300046678 | Ga0495599_0028132 | Ga0495599_0028132_1076_1993 | 296 |
| 238 | 3300046679 | Ga0495623_0017468 | Ga0495623_0017468_3214_4131 | 296 |
| 239 | 3300046809 | Ga0495600_0146150 | Ga0495600_0146150_128_1045 | 296 |
| 240 | 3300047315 | Ga0495581_0100935 | Ga0495581_0100935_221_1138 | 296 |
| 241 | 3300047317 | Ga0495604_0060913 | Ga0495604_0060913_1136_2053 | 296 |
| 242 | 3300047322 | Ga0495680_0072314 | Ga0495680_0072314_260_1177 | 296 |
| 243 | 3300048088 | Ga0495602_0026255 | Ga0495602_0026255_1168_2085 | 296 |
| 244 | 3300048914 | Ga0496111_0054503 | Ga0496111_0054503_1277_2194 | 296 |
| 245 | 3300050514 | nmdc:mga08x19_274917_c1 | nmdc:mga08x19_274917_c1_65_982 | 296 |
| 246 | 3300053084 | Ga0495595_0006117 | Ga0495595_0006117_3960_4877 | 296 |
| 247 | 3300053085 | Ga0495619_0128668 | Ga0495619_0128668_370_1287 | 296 |
| 248 | 3300005367 | Ga0070667_100333395 | Ga0070667_1003333952 | 297 |
| 249 | 3300005455 | Ga0070663_100161679 | Ga0070663_1001616792 | 297 |
| 250 | 3300005457 | Ga0070662_100263581 | Ga0070662_1002635812 | 297 |
| 251 | 3300005467 | Ga0070706_100013883 | Ga0070706_1000138832 | 297 |
| 252 | 3300005468 | Ga0070707_100013452 | Ga0070707_1000134524 | 297 |
| 253 | 3300005468 | Ga0070707_100138215 | Ga0070707_1001382152 | 297 |
| 254 | 3300005843 | Ga0068860_100013790 | Ga0068860_1000137902 | 297 |
| 255 | 3300006028 | Ga0070717_10038972 | Ga0070717_100389723 | 297 |
| 256 | 3300006038 | Ga0075365_10001285 | Ga0075365_1000128511 | 297 |
| 257 | 3300006042 | Ga0075368_10000942 | Ga0075368_100009422 | 297 |
| 258 | 3300006042 | Ga0075368_10033381 | Ga0075368_100333812 | 297 |
| 259 | 3300006048 | Ga0075363_100004211 | Ga0075363_1000042112 | 297 |
| 260 | 3300006048 | Ga0075363_100006959 | Ga0075363_1000069592 | 297 |
| 261 | 3300006048 | Ga0075363_100031710 | Ga0075363_1000317102 | 297 |
| 262 | 3300006048 | Ga0075363_100104692 | Ga0075363_1001046922 | 297 |
| 263 | 3300006048 | Ga0075363_100156745 | Ga0075363_1001567452 | 297 |
| 264 | 3300006051 | Ga0075364_10018466 | Ga0075364_100184664 | 297 |
| 265 | 3300006051 | Ga0075364_10030803 | Ga0075364_100308032 | 297 |
| 266 | 3300006051 | Ga0075364_10060428 | Ga0075364_100604282 | 297 |
| 267 | 3300006051 | Ga0075364_10179921 | Ga0075364_101799212 | 297 |
| 268 | 3300006178 | Ga0075367_10006133 | Ga0075367_100061332 | 297 |
| 269 | 3300006353 | Ga0075370_10008770 | Ga0075370_100087702 | 297 |
| 270 | 3300006353 | Ga0075370_10011275 | Ga0075370_100112752 | 297 |
| 271 | 3300014325 | Ga0163163_10280569 | Ga0163163_102805692 | 297 |
| 272 | 3300025922 | Ga0207646_10005503 | Ga0207646_100055038 | 297 |
| 273 | 3300025922 | Ga0207646_10027514 | Ga0207646_100275142 | 297 |
| 274 | 3300025922 | Ga0207646_10065871 | Ga0207646_100658712 | 297 |
| 275 | 3300025926 | Ga0207659_10231374 | Ga0207659_102313742 | 297 |
| 276 | 3300025933 | Ga0207706_10078480 | Ga0207706_100784802 | 297 |
| 277 | 3300026067 | Ga0207678_10189221 | Ga0207678_101892212 | 297 |
| 278 | 3300028381 | Ga0268264_10001927 | Ga0268264_1000192714 | 297 |
| 279 | 3300035086 | Ga0373934_0000007 | Ga0373934_0000007_24814_25794 | 297 |
| 280 | 3300035117 | Ga0373953_0000069 | Ga0373953_0000069_10275_11255 | 297 |
| 281 | 3300035118 | Ga0373954_0017481 | Ga0373954_0017481_534_1514 | 297 |
| 282 | 3300035119 | Ga0373956_0000247 | Ga0373956_0000247_955_1935 | 297 |
| 283 | 3300035119 | Ga0373956_0010223 | Ga0373956_0010223_799_1728 | 297 |
| 284 | 3300035119 | Ga0373956_0034487 | Ga0373956_0034487_237_1166 | 297 |
| 285 | 3300035120 | Ga0373957_0000104 | Ga0373957_0000104_395_1375 | 297 |
| 286 | 3300035172 | Ga0373955_0000062 | Ga0373955_0000062_24836_25816 | 297 |
| 287 | 3300035410 | Ga0373924_0007699 | Ga0373924_0007699_1885_2865 | 297 |
| 288 | 3300035410 | Ga0373924_0019431 | Ga0373924_0019431_224_1168 | 297 |
| 289 | 3300035692 | Ga0373935_0007490 | Ga0373935_0007490_3953_4897 | 297 |
| 290 | 3300035724 | Ga0373933_0000021 | Ga0373933_0000021_71184_72164 | 297 |
| 291 | 3300036401 | Ga0373937_0000032 | Ga0373937_0000032_24884_25864 | 297 |
| 292 | 3300036401 | Ga0373937_0013811 | Ga0373937_0013811_4222_5151 | 297 |
| 293 | 3300036401 | Ga0373937_0077743 | Ga0373937_0077743_1614_2558 | 297 |
| 294 | 3300036401 | Ga0373937_0084631 | Ga0373937_0084631_1402_2331 | 297 |
| 295 | 3300037471 | Ga0395905_0037932 | Ga0395905_0037932_3087_3992 | 297 |
| 296 | 3300042439 | Ga0439464_0035403 | Ga0439464_0035403_233_1147 | 297 |
| 297 | 3300046454 | Ga0495592_0000143 | Ga0495592_0000143_37357_38337 | 297 |
| 298 | 3300046454 | Ga0495592_0217543 | Ga0495592_0217543_229_1158 | 297 |
| 299 | 3300046461 | Ga0495641_0006091 | Ga0495641_0006091_1681_2625 | 297 |
| 300 | 3300046462 | Ga0495651_0000010 | Ga0495651_0000010_122890_123870 | 297 |
| 301 | 3300046462 | Ga0495651_0030726 | Ga0495651_0030726_1857_2786 | 297 |
| 302 | 3300046463 | Ga0495653_0022865 | Ga0495653_0022865_1228_2172 | 297 |
| 303 | 3300046463 | Ga0495653_0074820 | Ga0495653_0074820_105_1085 | 297 |
| 304 | 3300046511 | Ga0495608_0000037 | Ga0495608_0000037_105488_106468 | 297 |
| 305 | 3300046511 | Ga0495608_0038804 | Ga0495608_0038804_377_1306 | 297 |
| 306 | 3300046514 | Ga0495618_0020453 | Ga0495618_0020453_1832_2776 | 297 |
| 307 | 3300046516 | Ga0495628_0000884 | Ga0495628_0000884_2498_3478 | 297 |
| 308 | 3300046529 | Ga0495652_0000135 | Ga0495652_0000135_44391_45371 | 297 |
| 309 | 3300046529 | Ga0495652_0017198 | Ga0495652_0017198_4129_5058 | 297 |
| 310 | 3300046529 | Ga0495652_0137325 | Ga0495652_0137325_156_1085 | 297 |
| 311 | 3300046531 | Ga0495665_0001237 | Ga0495665_0001237_5329_6273 | 297 |
| 312 | 3300046533 | Ga0495640_0018076 | Ga0495640_0018076_519_1463 | 297 |
| 313 | 3300046535 | Ga0495586_0051369 | Ga0495586_0051369_1240_2184 | 297 |
| 314 | 3300046536 | Ga0495587_0000024 | Ga0495587_0000024_24883_25863 | 297 |
| 315 | 3300046536 | Ga0495587_0008644 | Ga0495587_0008644_3769_4713 | 297 |
| 316 | 3300046543 | Ga0495645_0020033 | Ga0495645_0020033_3769_4713 | 297 |
| 317 | 3300046559 | Ga0495667_0000024 | Ga0495667_0000024_44442_45422 | 297 |
| 318 | 3300046559 | Ga0495667_0003687 | Ga0495667_0003687_9086_10015 | 297 |
| 319 | 3300046663 | Ga0495635_0026588 | Ga0495635_0026588_429_1373 | 297 |
| 320 | 3300046675 | Ga0495657_0000057 | Ga0495657_0000057_44419_45399 | 297 |
| 321 | 3300046675 | Ga0495657_0031985 | Ga0495657_0031985_2381_3310 | 297 |
| 322 | 3300046679 | Ga0495623_0001532 | Ga0495623_0001532_10685_11665 | 297 |
| 323 | 3300046679 | Ga0495623_0136971 | Ga0495623_0136971_53_982 | 297 |
| 324 | 3300046680 | Ga0495646_0003118 | Ga0495646_0003118_4659_5639 | 297 |
| 325 | 3300046683 | Ga0495658_0009836 | Ga0495658_0009836_1430_2374 | 297 |
| 326 | 3300046689 | Ga0495613_0005908 | Ga0495613_0005908_1622_2566 | 297 |
| 327 | 3300046689 | Ga0495613_0337681 | Ga0495613_0337681_84_998 | 297 |
| 328 | 3300046809 | Ga0495600_0003738 | Ga0495600_0003738_4644_5624 | 297 |
| 329 | 3300046809 | Ga0495600_0071273 | Ga0495600_0071273_1228_2172 | 297 |
| 330 | 3300047317 | Ga0495604_0000024 | Ga0495604_0000024_24700_25680 | 297 |
| 331 | 3300047317 | Ga0495604_0023458 | Ga0495604_0023458_1942_2871 | 297 |
| 332 | 3300047317 | Ga0495604_0173945 | Ga0495604_0173945_550_1494 | 297 |
| 333 | 3300047319 | Ga0495674_0312611 | Ga0495674_0312611_145_1089 | 297 |
| 334 | 3300047322 | Ga0495680_0000005 | Ga0495680_0000005_122866_123846 | 297 |
| 335 | 3300047322 | Ga0495680_0026914 | Ga0495680_0026914_3772_4716 | 297 |
| 336 | 3300047444 | Ga0495675_0000908 | Ga0495675_0000908_3378_4358 | 297 |
| 337 | 3300047444 | Ga0495675_0018111 | Ga0495675_0018111_3053_3982 | 297 |
| 338 | 3300047444 | Ga0495675_0119107 | Ga0495675_0119107_555_1499 | 297 |
| 339 | 3300047471 | Ga0495684_0017914 | Ga0495684_0017914_309_1253 | 297 |
| 340 | 3300047673 | Ga0495593_0009206 | Ga0495593_0009206_1018_1962 | 297 |
| 341 | 3300048088 | Ga0495602_0000203 | Ga0495602_0000203_9847_10827 | 297 |
| 342 | 3300048088 | Ga0495602_0046818 | Ga0495602_0046818_75_1019 | 297 |
| 343 | 3300048089 | Ga0495614_0033262 | Ga0495614_0033262_31_975 | 297 |
| 344 | 3300048912 | Ga0496109_0328113 | Ga0496109_0328113_497_1396 | 297 |
| 345 | 3300048927 | Ga0496124_0072603 | Ga0496124_0072603_586_1491 | 297 |
| 346 | 3300049592 | Ga0501076_0128422 | Ga0501076_0128422_957_1862 | 297 |
| 347 | 3300050491 | nmdc:mga00v17_62769_c1 | nmdc:mga00v17_62769_c1_113_1018 | 297 |
| 348 | 3300050491 | nmdc:mga00v17_7464_c1 | nmdc:mga00v17_7464_c1_3618_4523 | 297 |
| 349 | 3300050492 | nmdc:mga0yw44_683_c1 | nmdc:mga0yw44_683_c1_710_1615 | 297 |
| 350 | 3300050494 | nmdc:mga06z11_17654_c1 | nmdc:mga06z11_17654_c1_456_1361 | 297 |
| 351 | 3300053084 | Ga0495595_0005587 | Ga0495595_0005587_239_1219 | 297 |
| 352 | 3300053084 | Ga0495595_0061027 | Ga0495595_0061027_677_1612 | 297 |
| 353 | 3300053085 | Ga0495619_0009226 | Ga0495619_0009226_5179_6123 | 297 |
| 354 | 3300053088 | Ga0500644_0000047 | Ga0500644_0000047_1942_2847 | 297 |
| 355 | 3300005329 | Ga0070683_100102154 | Ga0070683_1001021542 | 298 |
| 356 | 3300005338 | Ga0068868_100097208 | Ga0068868_1000972082 | 298 |
| 357 | 3300005345 | Ga0070692_10009892 | Ga0070692_100098922 | 298 |
| 358 | 3300005355 | Ga0070671_100115155 | Ga0070671_1001151553 | 298 |
| 359 | 3300005367 | Ga0070667_100117524 | Ga0070667_1001175242 | 298 |
| 360 | 3300005438 | Ga0070701_10003175 | Ga0070701_100031754 | 298 |
| 361 | 3300005441 | Ga0070700_100011926 | Ga0070700_1000119264 | 298 |
| 362 | 3300005459 | Ga0068867_100001433 | Ga0068867_1000014332 | 298 |
| 363 | 3300005466 | Ga0070685_10010101 | Ga0070685_100101012 | 298 |
| 364 | 3300005535 | Ga0070684_100036154 | Ga0070684_1000361543 | 298 |
| 365 | 3300005535 | Ga0070684_100179335 | Ga0070684_1001793351 | 298 |
| 366 | 3300005539 | Ga0068853_100106466 | Ga0068853_1001064662 | 298 |
| 367 | 3300005543 | Ga0070672_100101955 | Ga0070672_1001019552 | 298 |
| 368 | 3300005545 | Ga0070695_100176528 | Ga0070695_1001765282 | 298 |
| 369 | 3300005563 | Ga0068855_100092310 | Ga0068855_1000923103 | 298 |
| 370 | 3300005614 | Ga0068856_100216288 | Ga0068856_1002162882 | 298 |
| 371 | 3300005615 | Ga0070702_100006960 | Ga0070702_1000069602 | 298 |
| 372 | 3300005616 | Ga0068852_100034917 | Ga0068852_1000349172 | 298 |
| 373 | 3300005719 | Ga0068861_100517640 | Ga0068861_1005176401 | 298 |
| 374 | 3300005840 | Ga0068870_10002785 | Ga0068870_100027855 | 298 |
| 375 | 3300005841 | Ga0068863_100065358 | Ga0068863_1000653582 | 298 |
| 376 | 3300005983 | Ga0081540_1000101 | Ga0081540_100010145 | 298 |
| 377 | 3300006028 | Ga0070717_10196157 | Ga0070717_101961572 | 298 |
| 378 | 3300006038 | Ga0075365_10000395 | Ga0075365_100003956 | 298 |
| 379 | 3300006038 | Ga0075365_10010292 | Ga0075365_100102923 | 298 |
| 380 | 3300006163 | Ga0070715_10000355 | Ga0070715_100003558 | 298 |
| 381 | 3300006178 | Ga0075367_10027364 | Ga0075367_100273641 | 298 |
| 382 | 3300006178 | Ga0075367_10045081 | Ga0075367_100450812 | 298 |
| 383 | 3300006353 | Ga0075370_10007754 | Ga0075370_100077542 | 298 |
| 384 | 3300006844 | Ga0075428_100133536 | Ga0075428_1001335362 | 298 |
| 385 | 3300006852 | Ga0075433_10088296 | Ga0075433_100882962 | 298 |
| 386 | 3300006881 | Ga0068865_100013659 | Ga0068865_1000136594 | 298 |
| 387 | 3300006914 | Ga0075436_100044651 | Ga0075436_1000446511 | 298 |
| 388 | 3300009093 | Ga0105240_10285827 | Ga0105240_102858272 | 298 |
| 389 | 3300009094 | Ga0111539_10196303 | Ga0111539_101963032 | 298 |
| 390 | 3300009098 | Ga0105245_10024387 | Ga0105245_100243874 | 298 |
| 391 | 3300009101 | Ga0105247_10105222 | Ga0105247_101052222 | 298 |
| 392 | 3300009147 | Ga0114129_10252314 | Ga0114129_102523142 | 298 |
| 393 | 3300009148 | Ga0105243_10008568 | Ga0105243_100085684 | 298 |
| 394 | 3300009177 | Ga0105248_10016577 | Ga0105248_100165777 | 298 |
| 395 | 3300009553 | Ga0105249_10557130 | Ga0105249_105571301 | 298 |
| 396 | 3300010375 | Ga0105239_10377457 | Ga0105239_103774572 | 298 |
| 397 | 3300013100 | Ga0157373_10152051 | Ga0157373_101520512 | 298 |
| 398 | 3300013104 | Ga0157370_10307197 | Ga0157370_103071972 | 298 |
| 399 | 3300013307 | Ga0157372_10069745 | Ga0157372_100697452 | 298 |
| 400 | 3300014326 | Ga0157380_10005423 | Ga0157380_100054232 | 298 |
| 401 | 3300014745 | Ga0157377_10021132 | Ga0157377_100211322 | 298 |
| 402 | 3300025315 | Ga0207697_10072134 | Ga0207697_100721342 | 298 |
| 403 | 3300025901 | Ga0207688_10003539 | Ga0207688_100035394 | 298 |
| 404 | 3300025905 | Ga0207685_10000120 | Ga0207685_1000012010 | 298 |
| 405 | 3300025906 | Ga0207699_10005177 | Ga0207699_100051773 | 298 |
| 406 | 3300025908 | Ga0207643_10002721 | Ga0207643_100027213 | 298 |
| 407 | 3300025911 | Ga0207654_10202429 | Ga0207654_102024292 | 298 |
| 408 | 3300025915 | Ga0207693_10009710 | Ga0207693_100097103 | 298 |
| 409 | 3300025916 | Ga0207663_10026721 | Ga0207663_100267212 | 298 |
| 410 | 3300025927 | Ga0207687_10032642 | Ga0207687_100326422 | 298 |
| 411 | 3300025928 | Ga0207700_10050730 | Ga0207700_100507302 | 298 |
| 412 | 3300025929 | Ga0207664_10002506 | Ga0207664_100025068 | 298 |
| 413 | 3300025929 | Ga0207664_10081219 | Ga0207664_100812192 | 298 |
| 414 | 3300025932 | Ga0207690_10210344 | Ga0207690_102103441 | 298 |
| 415 | 3300025935 | Ga0207709_10191663 | Ga0207709_101916632 | 298 |
| 416 | 3300025936 | Ga0207670_10025135 | Ga0207670_100251353 | 298 |
| 417 | 3300025938 | Ga0207704_10031819 | Ga0207704_100318192 | 298 |
| 418 | 3300025939 | Ga0207665_10003518 | Ga0207665_100035185 | 298 |
| 419 | 3300025939 | Ga0207665_10054643 | Ga0207665_100546432 | 298 |
| 420 | 3300025940 | Ga0207691_10005262 | Ga0207691_100052629 | 298 |
| 421 | 3300025944 | Ga0207661_10022346 | Ga0207661_100223463 | 298 |
| 422 | 3300025949 | Ga0207667_10285091 | Ga0207667_102850911 | 298 |
| 423 | 3300025960 | Ga0207651_10044292 | Ga0207651_100442922 | 298 |
| 424 | 3300025986 | Ga0207658_10091510 | Ga0207658_100915102 | 298 |
| 425 | 3300026023 | Ga0207677_10023021 | Ga0207677_100230214 | 298 |
| 426 | 3300026041 | Ga0207639_10025957 | Ga0207639_100259572 | 298 |
| 427 | 3300026075 | Ga0207708_10000918 | Ga0207708_1000091820 | 298 |
| 428 | 3300026089 | Ga0207648_10003123 | Ga0207648_100031237 | 298 |
| 429 | 3300026118 | Ga0207675_100062252 | Ga0207675_1000622524 | 298 |
| 430 | 3300026142 | Ga0207698_10003844 | Ga0207698_100038446 | 298 |
| 431 | 3300031911 | Ga0307412_10014999 | Ga0307412_100149993 | 298 |
| 432 | 3300034957 | Ga0373938_0003218 | Ga0373938_0003218_922_1854 | 298 |
| 433 | 3300035084 | Ga0373928_0046399 | Ga0373928_0046399_31_963 | 298 |
| 434 | 3300035091 | Ga0373951_0004215 | Ga0373951_0004215_1869_2801 | 298 |
| 435 | 3300035112 | Ga0373932_0008942 | Ga0373932_0008942_1378_2310 | 298 |
| 436 | 3300035119 | Ga0373956_0008600 | Ga0373956_0008600_41_973 | 298 |
| 437 | 3300035172 | Ga0373955_0042049 | Ga0373955_0042049_716_1648 | 298 |
| 438 | 3300035207 | Ga0373942_0044935 | Ga0373942_0044935_230_1162 | 298 |
| 439 | 3300035410 | Ga0373924_0037253 | Ga0373924_0037253_432_1364 | 298 |
| 440 | 3300035692 | Ga0373935_0001373 | Ga0373935_0001373_6941_7915 | 298 |
| 441 | 3300035725 | Ga0373947_0000004 | Ga0373947_0000004_124307_125281 | 298 |
| 442 | 3300036401 | Ga0373937_0064399 | Ga0373937_0064399_404_1336 | 298 |
| 443 | 3300036459 | Ga0372808_004530 | Ga0372808_004530_787_1752 | 298 |
| 444 | 3300038443 | Ga0395901_0009154 | Ga0395901_0009154_2889_3794 | 298 |
| 445 | 3300046455 | Ga0495603_0230327 | Ga0495603_0230327_52_984 | 298 |
| 446 | 3300046459 | Ga0495629_0007909 | Ga0495629_0007909_453_1385 | 298 |
| 447 | 3300046516 | Ga0495628_0095225 | Ga0495628_0095225_98_1030 | 298 |
| 448 | 3300046533 | Ga0495640_0142003 | Ga0495640_0142003_543_1475 | 298 |
| 449 | 3300046536 | Ga0495587_0070670 | Ga0495587_0070670_1041_1973 | 298 |
| 450 | 3300046642 | Ga0495634_0023699 | Ga0495634_0023699_2070_3002 | 298 |
| 451 | 3300046663 | Ga0495635_0030003 | Ga0495635_0030003_819_1751 | 298 |
| 452 | 3300046678 | Ga0495599_0038901 | Ga0495599_0038901_1493_2425 | 298 |
| 453 | 3300046679 | Ga0495623_0032106 | Ga0495623_0032106_1942_2874 | 298 |
| 454 | 3300046680 | Ga0495646_0016513 | Ga0495646_0016513_87_1019 | 298 |
| 455 | 3300046683 | Ga0495658_0109318 | Ga0495658_0109318_633_1565 | 298 |
| 456 | 3300046809 | Ga0495600_0016761 | Ga0495600_0016761_2114_3046 | 298 |
| 457 | 3300047317 | Ga0495604_0057269 | Ga0495604_0057269_1451_2383 | 298 |
| 458 | 3300047319 | Ga0495674_0222776 | Ga0495674_0222776_98_1030 | 298 |
| 459 | 3300047322 | Ga0495680_0023341 | Ga0495680_0023341_764_1696 | 298 |
| 460 | 3300047471 | Ga0495684_0067556 | Ga0495684_0067556_88_1020 | 298 |
| 461 | 3300048088 | Ga0495602_0018827 | Ga0495602_0018827_3287_4219 | 298 |
| 462 | 3300048903 | Ga0496100_0070452 | Ga0496100_0070452_621_1544 | 298 |
| 463 | 3300048904 | Ga0496101_0144954 | Ga0496101_0144954_50_973 | 298 |
| 464 | 3300048907 | Ga0496104_0004890 | Ga0496104_0004890_3198_4121 | 298 |
| 465 | 3300048907 | Ga0496104_0040795 | Ga0496104_0040795_305_1237 | 298 |
| 466 | 3300048910 | Ga0496107_0249637 | Ga0496107_0249637_322_1254 | 298 |
| 467 | 3300048911 | Ga0496108_0002163 | Ga0496108_0002163_1755_2678 | 298 |
| 468 | 3300048912 | Ga0496109_0041191 | Ga0496109_0041191_2375_3298 | 298 |
| 469 | 3300048912 | Ga0496109_0172874 | Ga0496109_0172874_529_1452 | 298 |
| 470 | 3300048913 | Ga0496110_0061400 | Ga0496110_0061400_1869_2792 | 298 |
| 471 | 3300048913 | Ga0496110_0065626 | Ga0496110_0065626_95_1018 | 298 |
| 472 | 3300048915 | Ga0496112_0033774 | Ga0496112_0033774_2766_3698 | 298 |
| 473 | 3300048917 | Ga0496114_0054470 | Ga0496114_0054470_2329_3261 | 298 |
| 474 | 3300048917 | Ga0496114_0203393 | Ga0496114_0203393_672_1595 | 298 |
| 475 | 3300048918 | Ga0496115_0002820 | Ga0496115_0002820_6381_7304 | 298 |
| 476 | 3300048929 | Ga0496126_0165434 | Ga0496126_0165434_836_1789 | 298 |
| 477 | 3300049572 | Ga0501036_0151773 | Ga0501036_0151773_88_999 | 298 |
| 478 | 3300049576 | Ga0501040_0041092 | Ga0501040_0041092_1107_2018 | 298 |
| 479 | 3300049583 | Ga0501067_0029164 | Ga0501067_0029164_687_1610 | 298 |
| 480 | 3300049584 | Ga0501068_0062470 | Ga0501068_0062470_423_1331 | 298 |
| 481 | 3300049585 | Ga0501069_0023211 | Ga0501069_0023211_529_1452 | 298 |
| 482 | 3300049585 | Ga0501069_0075860 | Ga0501069_0075860_36_965 | 298 |
| 483 | 3300049586 | Ga0501070_0001128 | Ga0501070_0001128_13335_14264 | 298 |
| 484 | 3300049587 | Ga0501071_0057905 | Ga0501071_0057905_692_1603 | 298 |
| 485 | 3300049589 | Ga0501073_0136037 | Ga0501073_0136037_522_1451 | 298 |
| 486 | 3300049590 | Ga0501074_0094897 | Ga0501074_0094897_1136_2065 | 298 |
| 487 | 3300049592 | Ga0501076_0109942 | Ga0501076_0109942_822_1733 | 298 |
| 488 | 3300049593 | Ga0501077_0236228 | Ga0501077_0236228_241_1152 | 298 |
| 489 | 3300049822 | Ga0501035_0218710 | Ga0501035_0218710_350_1261 | 298 |
| 490 | 3300050491 | nmdc:mga00v17_15403_c1 | nmdc:mga00v17_15403_c1_3251_4168 | 298 |
| 491 | 3300050491 | nmdc:mga00v17_168765_c1 | nmdc:mga00v17_168765_c1_257_1168 | 298 |
| 492 | 3300050507 | nmdc:mga05p37_163999_c1 | nmdc:mga05p37_163999_c1_1511_2479 | 298 |
| 493 | 3300050511 | nmdc:mga08y16_142249_c1 | nmdc:mga08y16_142249_c1_392_1315 | 298 |
| 494 | 3300050512 | nmdc:mga0n895_101584_c1 | nmdc:mga0n895_101584_c1_1435_2367 | 298 |
| 495 | 3300053077 | Ga0495601_0044837 | Ga0495601_0044837_54_986 | 298 |
| 496 | 3300053085 | Ga0495619_0043398 | Ga0495619_0043398_516_1448 | 298 |
| 497 | 3300060353 | Ga0501082_0143039 | Ga0501082_0143039_661_1572 | 298 |
| 498 | 3300005329 | Ga0070683_100302787 | Ga0070683_1003027871 | 299 |
| 499 | 3300005535 | Ga0070684_100345145 | Ga0070684_1003451452 | 299 |
| 500 | 3300006038 | Ga0075365_10306835 | Ga0075365_103068352 | 299 |
| 501 | 3300009098 | Ga0105245_10071017 | Ga0105245_100710172 | 299 |
| 502 | 3300009148 | Ga0105243_10140887 | Ga0105243_101408872 | 299 |
| 503 | 3300010375 | Ga0105239_10540018 | Ga0105239_105400181 | 299 |
| 504 | 3300014325 | Ga0163163_10165586 | Ga0163163_101655862 | 299 |
| 505 | 3300028381 | Ga0268264_10317185 | Ga0268264_103171852 | 299 |
| 506 | 3300032005 | Ga0307411_10018246 | Ga0307411_100182462 | 299 |
| 507 | 3300032126 | Ga0307415_100301410 | Ga0307415_1003014102 | 299 |
| 508 | 3300044901 | Ga0466960_0000222 | Ga0466960_0000222_13961_14863 | 299 |
| 509 | 3300046689 | Ga0495613_0192298 | Ga0495613_0192298_260_1189 | 299 |
| 510 | 3300005327 | Ga0070658_10049392 | Ga0070658_100493922 | 300 |
| 511 | 3300005339 | Ga0070660_100174863 | Ga0070660_1001748632 | 300 |
| 512 | 3300013308 | Ga0157375_10386925 | Ga0157375_103869251 | 300 |
| 513 | 3300025919 | Ga0207657_10017225 | Ga0207657_100172253 | 300 |
| 514 | 3300044693 | Ga0466961_0047290 | Ga0466961_0047290_1349_2263 | 300 |
| 515 | 3300044901 | Ga0466960_0066981 | Ga0466960_0066981_37_951 | 300 |
| 516 | 3300048904 | Ga0496101_0177346 | Ga0496101_0177346_542_1459 | 300 |
| 517 | 3300048905 | Ga0496102_0315017 | Ga0496102_0315017_264_1181 | 300 |
| 518 | 3300049583 | Ga0501067_0097538 | Ga0501067_0097538_434_1351 | 300 |
| 519 | 3300049585 | Ga0501069_0071904 | Ga0501069_0071904_89_1006 | 300 |
| 520 | 3300053104 | Ga0500556_0006831 | Ga0500556_0006831_2299_3219 | 300 |
| 521 | 3300005618 | Ga0068864_100225139 | Ga0068864_1002251392 | 301 |
| 522 | 3300031548 | Ga0307408_100048770 | Ga0307408_1000487702 | 301 |
| 523 | 3300031824 | Ga0307413_10006671 | Ga0307413_100066715 | 301 |
| 524 | 3300031852 | Ga0307410_10013937 | Ga0307410_100139373 | 301 |
| 525 | 3300031903 | Ga0307407_10038630 | Ga0307407_100386302 | 301 |
| 526 | 3300031911 | Ga0307412_10109353 | Ga0307412_101093532 | 301 |
| 527 | 3300031995 | Ga0307409_100028243 | Ga0307409_1000282433 | 301 |
| 528 | 3300032126 | Ga0307415_100041277 | Ga0307415_1000412772 | 301 |
| 529 | 3300041512 | Ga0451853_1321677 | Ga0451853_1321677_280_1197 | 301 |
| 530 | 3300044706 | Ga0466964_0075862 | Ga0466964_0075862_378_1292 | 301 |
| 531 | 3300045976 | Ga0466967_0032331 | Ga0466967_0032331_522_1436 | 301 |
| 532 | 3300049586 | Ga0501070_0020291 | Ga0501070_0020291_929_1858 | 301 |
| 533 | 3300001990 | JGI24737J22298_10047842 | JGI24737J22298_100478422 | 302 |
| 534 | 3300005327 | Ga0070658_10015728 | Ga0070658_100157284 | 302 |
| 535 | 3300005327 | Ga0070658_10034073 | Ga0070658_100340731 | 302 |
| 536 | 3300005329 | Ga0070683_100001232 | Ga0070683_10000123219 | 302 |
| 537 | 3300005329 | Ga0070683_100017715 | Ga0070683_1000177152 | 302 |
| 538 | 3300005337 | Ga0070682_100057892 | Ga0070682_1000578922 | 302 |
| 539 | 3300005339 | Ga0070660_100015370 | Ga0070660_1000153704 | 302 |
| 540 | 3300005347 | Ga0070668_100203540 | Ga0070668_1002035402 | 302 |
| 541 | 3300005366 | Ga0070659_100013610 | Ga0070659_1000136102 | 302 |
| 542 | 3300005530 | Ga0070679_100163650 | Ga0070679_1001636501 | 302 |
| 543 | 3300005535 | Ga0070684_100037092 | Ga0070684_1000370924 | 302 |
| 544 | 3300005577 | Ga0068857_100091898 | Ga0068857_1000918982 | 302 |
| 545 | 3300005615 | Ga0070702_100027475 | Ga0070702_1000274752 | 302 |
| 546 | 3300005616 | Ga0068852_100179329 | Ga0068852_1001793292 | 302 |
| 547 | 3300005834 | Ga0068851_10233813 | Ga0068851_102338132 | 302 |
| 548 | 3300005842 | Ga0068858_100088044 | Ga0068858_1000880442 | 302 |
| 549 | 3300005843 | Ga0068860_100055713 | Ga0068860_1000557133 | 302 |
| 550 | 3300006881 | Ga0068865_100015421 | Ga0068865_1000154212 | 302 |
| 551 | 3300009098 | Ga0105245_10004191 | Ga0105245_100041917 | 302 |
| 552 | 3300009176 | Ga0105242_10096588 | Ga0105242_100965882 | 302 |
| 553 | 3300009177 | Ga0105248_10126709 | Ga0105248_101267092 | 302 |
| 554 | 3300009553 | Ga0105249_10046879 | Ga0105249_100468794 | 302 |
| 555 | 3300010375 | Ga0105239_10001401 | Ga0105239_1000140125 | 302 |
| 556 | 3300011119 | Ga0105246_10020346 | Ga0105246_100203462 | 302 |
| 557 | 3300013105 | Ga0157369_10010249 | Ga0157369_100102495 | 302 |
| 558 | 3300013307 | Ga0157372_10003488 | Ga0157372_100034884 | 302 |
| 559 | 3300013308 | Ga0157375_10116640 | Ga0157375_101166402 | 302 |
| 560 | 3300014325 | Ga0163163_10030323 | Ga0163163_100303232 | 302 |
| 561 | 3300014325 | Ga0163163_10297372 | Ga0163163_102973722 | 302 |
| 562 | 3300014497 | Ga0182008_10037883 | Ga0182008_100378832 | 302 |
| 563 | 3300014968 | Ga0157379_10150335 | Ga0157379_101503352 | 302 |
| 564 | 3300020082 | Ga0206353_11472283 | Ga0206353_114722831 | 302 |
| 565 | 3300025901 | Ga0207688_10014711 | Ga0207688_100147112 | 302 |
| 566 | 3300025904 | Ga0207647_10023348 | Ga0207647_100233485 | 302 |
| 567 | 3300025904 | Ga0207647_10044393 | Ga0207647_100443932 | 302 |
| 568 | 3300025909 | Ga0207705_10244464 | Ga0207705_102444641 | 302 |
| 569 | 3300025918 | Ga0207662_10078331 | Ga0207662_100783312 | 302 |
| 570 | 3300025919 | Ga0207657_10017156 | Ga0207657_100171564 | 302 |
| 571 | 3300025927 | Ga0207687_10011578 | Ga0207687_100115785 | 302 |
| 572 | 3300025932 | Ga0207690_10026631 | Ga0207690_100266314 | 302 |
| 573 | 3300025934 | Ga0207686_10254455 | Ga0207686_102544552 | 302 |
| 574 | 3300025938 | Ga0207704_10051806 | Ga0207704_100518062 | 302 |
| 575 | 3300025941 | Ga0207711_10070477 | Ga0207711_100704772 | 302 |
| 576 | 3300025944 | Ga0207661_10008301 | Ga0207661_100083015 | 302 |
| 577 | 3300025945 | Ga0207679_10417354 | Ga0207679_104173542 | 302 |
| 578 | 3300025961 | Ga0207712_10254773 | Ga0207712_102547731 | 302 |
| 579 | 3300026035 | Ga0207703_10074893 | Ga0207703_100748932 | 302 |
| 580 | 3300026116 | Ga0207674_10001502 | Ga0207674_1000150228 | 302 |
| 581 | 3300026142 | Ga0207698_10022798 | Ga0207698_100227984 | 302 |
| 582 | 3300028380 | Ga0268265_10177735 | Ga0268265_101777351 | 302 |
| 583 | 3300028381 | Ga0268264_10161826 | Ga0268264_101618262 | 302 |
| 584 | 3300044694 | Ga0466963_0052342 | Ga0466963_0052342_310_1227 | 302 |
| 585 | 3300044694 | Ga0466963_0325653 | Ga0466963_0325653_42_980 | 302 |
| 586 | 3300045051 | Ga0451576_0314327 | Ga0451576_0314327_679_1587 | 302 |
| 587 | 3300048911 | Ga0496108_0048410 | Ga0496108_0048410_1786_2694 | 302 |
| 588 | 3300048912 | Ga0496109_0033853 | Ga0496109_0033853_3338_4246 | 302 |
| 589 | 3300048913 | Ga0496110_0005591 | Ga0496110_0005591_8874_9782 | 302 |
| 590 | 3300048914 | Ga0496111_0003383 | Ga0496111_0003383_6759_7667 | 302 |
| 591 | 3300049569 | Ga0501032_0151509 | Ga0501032_0151509_170_1093 | 302 |
| 592 | 3300049571 | Ga0501034_0024164 | Ga0501034_0024164_779_1702 | 302 |
| 593 | 3300049574 | Ga0501038_0260281 | Ga0501038_0260281_368_1291 | 302 |
| 594 | 3300049583 | Ga0501067_0009030 | Ga0501067_0009030_257_1180 | 302 |
| 595 | 3300049585 | Ga0501069_0071438 | Ga0501069_0071438_110_1042 | 302 |
| 596 | 3300049586 | Ga0501070_0010181 | Ga0501070_0010181_5938_6861 | 302 |
| 597 | 3300049586 | Ga0501070_0026305 | Ga0501070_0026305_3228_4151 | 302 |
| 598 | 3300049586 | Ga0501070_0055795 | Ga0501070_0055795_1738_2670 | 302 |
| 599 | 3300049587 | Ga0501071_0020255 | Ga0501071_0020255_3155_4078 | 302 |
| 600 | 3300049588 | Ga0501072_0010330 | Ga0501072_0010330_5770_6693 | 302 |
| 601 | 3300049588 | Ga0501072_0013391 | Ga0501072_0013391_1911_2834 | 302 |
| 602 | 3300049589 | Ga0501073_0022755 | Ga0501073_0022755_354_1277 | 302 |
| 603 | 3300049589 | Ga0501073_0069504 | Ga0501073_0069504_852_1775 | 302 |
| 604 | 3300049590 | Ga0501074_0002190 | Ga0501074_0002190_5746_6669 | 302 |
| 605 | 3300049590 | Ga0501074_0014132 | Ga0501074_0014132_1922_2845 | 302 |
| 606 | 3300049593 | Ga0501077_0028325 | Ga0501077_0028325_2217_3140 | 302 |
| 607 | 3300049742 | Ga0501080_0032083 | Ga0501080_0032083_702_1625 | 302 |
| 608 | 3300049742 | Ga0501080_0032198 | Ga0501080_0032198_3206_4129 | 302 |
| 609 | 3300049744 | Ga0501083_0067510 | Ga0501083_0067510_983_1906 | 302 |
| 610 | 3300049822 | Ga0501035_0070828 | Ga0501035_0070828_2087_3010 | 302 |
| 611 | 3300060353 | Ga0501082_0025779 | Ga0501082_0025779_1065_1988 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxq-assembly1.cif.gz_A | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8992 | 8 | 300 |
| 3dxq-assembly2.cif.gz_B | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8841 | 9 | 300 |
| 3dxq-assembly1.cif.gz_A | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8676 | 8 | 300 |
| 3dxq-assembly2.cif.gz_B | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8501 | 9 | 300 |
| 4r77-assembly3.cif.gz_A | crystal structure of choline kinase lica from streptococcus pneumoniae | 0.8421 | 23 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dxqA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8959 | 98 | 299 | 3.90.1200.10 |
| 3dxqA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8752 | 98 | 299 | 3.90.1200.10 |
| af_Q869T9_99_346_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.833 | 71 | 285 | 3.90.1200.10 |
| af_A0A0R0JRE3_107_353_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8312 | 59 | 276 | 3.90.1200.10 |
| af_Q22820_83_335_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8246 | 65 | 283 | 3.90.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9FBP0-F1-model_v4 | LPS biosynthesis choline kinase | 0.9866 | 113 | 299 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A7G8WLK2-F1-model_v4 | Phosphotransferase | 0.9836 | 9 | 300 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A1M4SB83-F1-model_v4 | Thiamine kinase | 0.9827 | 20 | 298 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A6J6QKH1-F1-model_v4 | Unannotated protein | 0.9825 | 22 | 299 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A1E7JSB5-F1-model_v4 | Choline kinase | 0.9798 | 8 | 299 |
GO:0004305
GO:0005737 GO:0006646 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar