F468249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 603 | 266 | 603 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_101220837|Ga0070711_1012208371 |
| Length | 112 |
| Sequence | VPRAELAPVWPAIGHSAVPADAIGSIETFITVFVSVYVLLIFAFILSSWVKLPYSPWLNRIQRFLYDVCEPYLRLFRRLLPTFGPLDLSPIIAILVLYVVQRVIITVLERLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 85 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 86 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 87 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 105 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 174 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 181 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 182 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 183 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 184 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 185 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 186 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 189 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 190 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 1.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.16 |
| Nodule | 0 |
| Rhizoplane | 16.58 |
| Rhizosphere | 80.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11769592 | 3300004799 | Bacteria | 847 |
| 2 | Ga0058861_11765624 | 3300004800 | Bacteria | 714 |
| 3 | Ga0070658_10111170 | 3300005327 | Unclassified | 2270 |
| 4 | Ga0070658_10178148 | 3300005327 | Bacteria | 1788 |
| 5 | Ga0070658_10350818 | 3300005327 | Bacteria | 1263 |
| 6 | Ga0070683_100005463 | 3300005329 | Bacteria | 10618 |
| 7 | Ga0070683_100007546 | 3300005329 | Bacteria | 9191 |
| 8 | Ga0070683_100052937 | 3300005329 | Bacteria | 3761 |
| 9 | Ga0070683_100227585 | 3300005329 | Bacteria | 1772 |
| 10 | Ga0070683_100233741 | 3300005329 | Bacteria | 1748 |
| 11 | Ga0070683_100540625 | 3300005329 | Bacteria | 1114 |
| 12 | Ga0070690_100344418 | 3300005330 | Bacteria | 1080 |
| 13 | Ga0068869_101583370 | 3300005334 | Bacteria | 583 |
| 14 | Ga0070680_100008678 | 3300005336 | Bacteria | 7791 |
| 15 | Ga0070680_100058288 | 3300005336 | Bacteria | 3158 |
| 16 | Ga0070680_100074712 | 3300005336 | Bacteria | 2789 |
| 17 | Ga0070680_101981305 | 3300005336 | Bacteria | 505 |
| 18 | Ga0070682_100010000 | 3300005337 | Bacteria | 5373 |
| 19 | Ga0070682_100609203 | 3300005337 | Bacteria | 863 |
| 20 | Ga0068868_100030281 | 3300005338 | Bacteria | 4150 |
| 21 | Ga0068868_101568786 | 3300005338 | Bacteria | 618 |
| 22 | Ga0070660_100033989 | 3300005339 | Bacteria | 3848 |
| 23 | Ga0070660_100058319 | 3300005339 | Bacteria | 2993 |
| 24 | Ga0070660_100068686 | 3300005339 | Bacteria | 2763 |
| 25 | Ga0070660_100715462 | 3300005339 | Bacteria | 840 |
| 26 | Ga0070687_100462901 | 3300005343 | Bacteria | 846 |
| 27 | Ga0070661_100095886 | 3300005344 | Bacteria | 2201 |
| 28 | Ga0070692_10151776 | 3300005345 | Bacteria | 1320 |
| 29 | Ga0070668_100581156 | 3300005347 | Bacteria | 978 |
| 30 | Ga0070675_101404713 | 3300005354 | Bacteria | 644 |
| 31 | Ga0070671_100452341 | 3300005355 | Unclassified | 1102 |
| 32 | Ga0070659_100050426 | 3300005366 | Bacteria | 3272 |
| 33 | Ga0070659_100051045 | 3300005366 | Bacteria | 3251 |
| 34 | Ga0070659_101137690 | 3300005366 | Bacteria | 689 |
| 35 | Ga0070703_10040055 | 3300005406 | Bacteria | 1455 |
| 36 | Ga0070709_10004518 | 3300005434 | Bacteria | 7506 |
| 37 | Ga0070709_10239470 | 3300005434 | Unclassified | 1302 |
| 38 | Ga0070709_10768712 | 3300005434 | Bacteria | 754 |
| 39 | Ga0070714_100007151 | 3300005435 | Bacteria | 8659 |
| 40 | Ga0070714_100135410 | 3300005435 | Unclassified | 2205 |
| 41 | Ga0070714_100853970 | 3300005435 | Bacteria | 883 |
| 42 | Ga0070713_100015415 | 3300005436 | Bacteria | 5713 |
| 43 | Ga0070713_100051791 | 3300005436 | Bacteria | 3397 |
| 44 | Ga0070713_100662047 | 3300005436 | Bacteria | 995 |
| 45 | Ga0070710_10000589 | 3300005437 | Bacteria | 17269 |
| 46 | Ga0070710_10060757 | 3300005437 | Bacteria | 2150 |
| 47 | Ga0070710_11152706 | 3300005437 | Unclassified | 571 |
| 48 | Ga0070701_10244375 | 3300005438 | Bacteria | 1081 |
| 49 | Ga0070701_10930879 | 3300005438 | Unclassified | 602 |
| 50 | Ga0070711_100028555 | 3300005439 | Bacteria | 3672 |
| 51 | Ga0070711_100059978 | 3300005439 | Bacteria | 2643 |
| 52 | Ga0070711_101220837 | 3300005439 | Bacteria | 651 |
| 53 | Ga0070705_101248109 | 3300005440 | Bacteria | 614 |
| 54 | Ga0070694_100270560 | 3300005444 | Bacteria | 1292 |
| 55 | Ga0070694_100396904 | 3300005444 | Bacteria | 1079 |
| 56 | Ga0070708_100013462 | 3300005445 | Bacteria | 6700 |
| 57 | Ga0070708_101295738 | 3300005445 | Bacteria | 681 |
| 58 | Ga0070708_101315748 | 3300005445 | Bacteria | 675 |
| 59 | Ga0070708_101438205 | 3300005445 | Bacteria | 643 |
| 60 | Ga0070708_101625479 | 3300005445 | Bacteria | 601 |
| 61 | Ga0070708_101781307 | 3300005445 | Unclassified | 572 |
| 62 | Ga0070708_101849518 | 3300005445 | Bacteria | 560 |
| 63 | Ga0070678_100003222 | 3300005456 | Bacteria | 9060 |
| 64 | Ga0070678_100568595 | 3300005456 | Bacteria | 1008 |
| 65 | Ga0070662_100509875 | 3300005457 | Bacteria | 1004 |
| 66 | Ga0070662_100839828 | 3300005457 | Bacteria | 782 |
| 67 | Ga0070681_10005979 | 3300005458 | Bacteria | 11789 |
| 68 | Ga0070681_10119501 | 3300005458 | Bacteria | 2571 |
| 69 | Ga0070681_10129514 | 3300005458 | Bacteria | 2455 |
| 70 | Ga0070681_10187444 | 3300005458 | Bacteria | 1989 |
| 71 | Ga0070681_10423841 | 3300005458 | Bacteria | 1243 |
| 72 | Ga0068867_102318508 | 3300005459 | Unclassified | 510 |
| 73 | Ga0070707_100110992 | 3300005468 | Unclassified | 2659 |
| 74 | Ga0070707_100545290 | 3300005468 | Bacteria | 1122 |
| 75 | Ga0070707_100832738 | 3300005468 | Bacteria | 887 |
| 76 | Ga0070707_101336484 | 3300005468 | Bacteria | 683 |
| 77 | Ga0070698_100053629 | 3300005471 | Bacteria | 4097 |
| 78 | Ga0070698_100090673 | 3300005471 | Bacteria | 3040 |
| 79 | Ga0070698_100874622 | 3300005471 | Bacteria | 844 |
| 80 | Ga0070698_100874689 | 3300005471 | Bacteria | 844 |
| 81 | Ga0070699_100061914 | 3300005518 | Bacteria | 3242 |
| 82 | Ga0070679_100019233 | 3300005530 | Bacteria | 6637 |
| 83 | Ga0070679_100129725 | 3300005530 | Unclassified | 2502 |
| 84 | Ga0070679_100155438 | 3300005530 | Bacteria | 2262 |
| 85 | Ga0070679_100199135 | 3300005530 | Bacteria | 1969 |
| 86 | Ga0070679_100350122 | 3300005530 | Bacteria | 1425 |
| 87 | Ga0070679_101654708 | 3300005530 | Unclassified | 588 |
| 88 | Ga0070679_101864244 | 3300005530 | Unclassified | 550 |
| 89 | Ga0070684_100017138 | 3300005535 | Bacteria | 5937 |
| 90 | Ga0070684_100060928 | 3300005535 | Bacteria | 3302 |
| 91 | Ga0070684_100196926 | 3300005535 | Bacteria | 1835 |
| 92 | Ga0070684_100272553 | 3300005535 | Bacteria | 1549 |
| 93 | Ga0070684_101483218 | 3300005535 | Bacteria | 639 |
| 94 | Ga0070684_102327906 | 3300005535 | Unclassified | 505 |
| 95 | Ga0070697_100055952 | 3300005536 | Bacteria | 3208 |
| 96 | Ga0070697_100180694 | 3300005536 | Unclassified | 1788 |
| 97 | Ga0070697_100756691 | 3300005536 | Bacteria | 859 |
| 98 | Ga0068853_100082856 | 3300005539 | Bacteria | 2810 |
| 99 | Ga0070695_100005103 | 3300005545 | Bacteria | 7737 |
| 100 | Ga0070695_100469237 | 3300005545 | Bacteria | 968 |
| 101 | Ga0070695_100547191 | 3300005545 | Bacteria | 902 |
| 102 | Ga0070695_100884073 | 3300005545 | Bacteria | 721 |
| 103 | Ga0070696_101157581 | 3300005546 | Bacteria | 652 |
| 104 | Ga0070665_101034891 | 3300005548 | Unclassified | 833 |
| 105 | Ga0070704_100171840 | 3300005549 | Bacteria | 1725 |
| 106 | Ga0070704_101265409 | 3300005549 | Bacteria | 674 |
| 107 | Ga0070704_101844844 | 3300005549 | Bacteria | 560 |
| 108 | Ga0068855_100853581 | 3300005563 | Bacteria | 965 |
| 109 | Ga0068855_101054284 | 3300005563 | Bacteria | 852 |
| 110 | Ga0070664_100046670 | 3300005564 | Bacteria | 3659 |
| 111 | Ga0070664_100914430 | 3300005564 | Bacteria | 823 |
| 112 | Ga0068857_100453705 | 3300005577 | Bacteria | 1199 |
| 113 | Ga0068854_100087354 | 3300005578 | Bacteria | 2313 |
| 114 | Ga0068854_100818477 | 3300005578 | Bacteria | 813 |
| 115 | Ga0068856_100035013 | 3300005614 | Bacteria | 4920 |
| 116 | Ga0068856_100100048 | 3300005614 | Bacteria | 2891 |
| 117 | Ga0068856_100226049 | 3300005614 | Unclassified | 1887 |
| 118 | Ga0070702_100043548 | 3300005615 | Bacteria | 2530 |
| 119 | Ga0070702_100643351 | 3300005615 | Bacteria | 801 |
| 120 | Ga0068852_100139785 | 3300005616 | Bacteria | 2240 |
| 121 | Ga0068852_101594212 | 3300005616 | Bacteria | 675 |
| 122 | Ga0068852_101804820 | 3300005616 | Bacteria | 634 |
| 123 | Ga0068859_101320526 | 3300005617 | Bacteria | 795 |
| 124 | Ga0068866_10288864 | 3300005718 | Bacteria | 1019 |
| 125 | Ga0068862_100164107 | 3300005844 | Bacteria | 1985 |
| 126 | Ga0068862_100663743 | 3300005844 | Bacteria | 1007 |
| 127 | Ga0081455_10021153 | 3300005937 | Bacteria | 6109 |
| 128 | Ga0070717_10007774 | 3300006028 | Bacteria | 7980 |
| 129 | Ga0070717_10078603 | 3300006028 | Bacteria | 2765 |
| 130 | Ga0075365_10234004 | 3300006038 | Bacteria | 1290 |
| 131 | Ga0075365_10327086 | 3300006038 | Bacteria | 1080 |
| 132 | Ga0075364_11240125 | 3300006051 | Unclassified | 505 |
| 133 | Ga0070715_10001156 | 3300006163 | Bacteria | 7557 |
| 134 | Ga0070715_10314346 | 3300006163 | Bacteria | 843 |
| 135 | Ga0070716_100001585 | 3300006173 | Bacteria | 10228 |
| 136 | Ga0070716_100012415 | 3300006173 | Bacteria | 4318 |
| 137 | Ga0070716_100064626 | 3300006173 | Bacteria | 2128 |
| 138 | Ga0070716_100264823 | 3300006173 | Bacteria | 1178 |
| 139 | Ga0070712_100217663 | 3300006175 | Bacteria | 1510 |
| 140 | Ga0070712_100291581 | 3300006175 | Bacteria | 1317 |
| 141 | Ga0097621_101624698 | 3300006237 | Bacteria | 615 |
| 142 | Ga0068871_102284093 | 3300006358 | Bacteria | 516 |
| 143 | Ga0075428_100304727 | 3300006844 | Bacteria | 1713 |
| 144 | Ga0075428_100706486 | 3300006844 | Bacteria | 1074 |
| 145 | Ga0075428_100795252 | 3300006844 | Bacteria | 1005 |
| 146 | Ga0075430_101294065 | 3300006846 | Bacteria | 600 |
| 147 | Ga0075431_100056395 | 3300006847 | Bacteria | 4052 |
| 148 | Ga0075433_10385164 | 3300006852 | Bacteria | 1238 |
| 149 | Ga0075429_100214881 | 3300006880 | Bacteria | 1685 |
| 150 | Ga0097620_101320681 | 3300006931 | Bacteria | 795 |
| 151 | Ga0075435_100451135 | 3300007076 | Bacteria | 1109 |
| 152 | Ga0075435_101109574 | 3300007076 | Bacteria | 692 |
| 153 | Ga0105244_10379942 | 3300009036 | Bacteria | 650 |
| 154 | Ga0105240_10005428 | 3300009093 | Bacteria | 19003 |
| 155 | Ga0105240_10202280 | 3300009093 | Bacteria | 2327 |
| 156 | Ga0105240_10353266 | 3300009093 | Bacteria | 1667 |
| 157 | Ga0105240_10489928 | 3300009093 | Unclassified | 1369 |
| 158 | Ga0111539_10315307 | 3300009094 | Bacteria | 1820 |
| 159 | Ga0105245_10002363 | 3300009098 | Bacteria | 17055 |
| 160 | Ga0105245_10108887 | 3300009098 | Bacteria | 2574 |
| 161 | Ga0105245_10322174 | 3300009098 | Bacteria | 1523 |
| 162 | Ga0105245_10452199 | 3300009098 | Bacteria | 1293 |
| 163 | Ga0105245_11755974 | 3300009098 | Bacteria | 673 |
| 164 | Ga0105247_10066675 | 3300009101 | Bacteria | 2242 |
| 165 | Ga0105247_10609179 | 3300009101 | Bacteria | 811 |
| 166 | Ga0105247_10845313 | 3300009101 | Bacteria | 702 |
| 167 | Ga0114129_11610047 | 3300009147 | Bacteria | 795 |
| 168 | Ga0105243_10125864 | 3300009148 | Bacteria | 2168 |
| 169 | Ga0105243_10380862 | 3300009148 | Bacteria | 1305 |
| 170 | Ga0105243_11245589 | 3300009148 | Bacteria | 759 |
| 171 | Ga0105241_10127395 | 3300009174 | Bacteria | 2057 |
| 172 | Ga0105241_10194385 | 3300009174 | Bacteria | 1690 |
| 173 | Ga0105241_10406015 | 3300009174 | Bacteria | 1196 |
| 174 | Ga0105241_10829731 | 3300009174 | Bacteria | 853 |
| 175 | Ga0105242_10068348 | 3300009176 | Bacteria | 2939 |
| 176 | Ga0105242_11755462 | 3300009176 | Bacteria | 658 |
| 177 | Ga0105248_10573398 | 3300009177 | Bacteria | 1273 |
| 178 | Ga0105248_12243991 | 3300009177 | Bacteria | 621 |
| 179 | Ga0105237_10199936 | 3300009545 | Unclassified | 1998 |
| 180 | Ga0105237_11270385 | 3300009545 | Bacteria | 743 |
| 181 | Ga0105237_11420040 | 3300009545 | Bacteria | 700 |
| 182 | Ga0105237_11565920 | 3300009545 | Bacteria | 666 |
| 183 | Ga0105238_10569333 | 3300009551 | Bacteria | 1138 |
| 184 | Ga0105238_10694426 | 3300009551 | Bacteria | 1029 |
| 185 | Ga0105238_10926295 | 3300009551 | Bacteria | 890 |
| 186 | Ga0105238_11639883 | 3300009551 | Unclassified | 674 |
| 187 | Ga0105249_10364461 | 3300009553 | Bacteria | 1467 |
| 188 | Ga0105249_10372811 | 3300009553 | Bacteria | 1451 |
| 189 | Ga0105249_10692959 | 3300009553 | Unclassified | 1078 |
| 190 | Ga0105249_10739350 | 3300009553 | Bacteria | 1045 |
| 191 | Ga0105239_10230714 | 3300010375 | Bacteria | 2077 |
| 192 | Ga0105239_10239215 | 3300010375 | Bacteria | 2038 |
| 193 | Ga0105239_10722649 | 3300010375 | Bacteria | 1139 |
| 194 | Ga0105239_11194805 | 3300010375 | Bacteria | 876 |
| 195 | Ga0105239_11506930 | 3300010375 | Unclassified | 777 |
| 196 | Ga0105239_11686493 | 3300010375 | Bacteria | 733 |
| 197 | Ga0105246_10078552 | 3300011119 | Bacteria | 2344 |
| 198 | Ga0105246_11237062 | 3300011119 | Bacteria | 689 |
| 199 | Ga0157336_1030578 | 3300012477 | Bacteria | 537 |
| 200 | Ga0157347_1018474 | 3300012502 | Bacteria | 799 |
| 201 | Ga0157342_1004103 | 3300012507 | Bacteria | 1279 |
| 202 | Ga0157315_1033304 | 3300012508 | Unclassified | 617 |
| 203 | Ga0157373_10125746 | 3300013100 | Bacteria | 1803 |
| 204 | Ga0157373_11087048 | 3300013100 | Bacteria | 600 |
| 205 | Ga0157371_10800473 | 3300013102 | Bacteria | 710 |
| 206 | Ga0157370_10106645 | 3300013104 | Bacteria | 2622 |
| 207 | Ga0157370_11223927 | 3300013104 | Bacteria | 677 |
| 208 | Ga0157370_11440772 | 3300013104 | Bacteria | 620 |
| 209 | Ga0157369_10004504 | 3300013105 | Bacteria | 16412 |
| 210 | Ga0157369_10045245 | 3300013105 | Bacteria | 4788 |
| 211 | Ga0157369_10795413 | 3300013105 | Bacteria | 972 |
| 212 | Ga0157369_10929054 | 3300013105 | Bacteria | 892 |
| 213 | Ga0157374_10028824 | 3300013296 | Bacteria | 5019 |
| 214 | Ga0157374_10084293 | 3300013296 | Bacteria | 3021 |
| 215 | Ga0157374_10443211 | 3300013296 | Bacteria | 1299 |
| 216 | Ga0157374_10593161 | 3300013296 | Bacteria | 1117 |
| 217 | Ga0157374_12533269 | 3300013296 | Unclassified | 540 |
| 218 | Ga0157374_12752988 | 3300013296 | Bacteria | 519 |
| 219 | Ga0157378_10196376 | 3300013297 | Unclassified | 1906 |
| 220 | Ga0157378_10242882 | 3300013297 | Bacteria | 1721 |
| 221 | Ga0163162_11136078 | 3300013306 | Bacteria | 886 |
| 222 | Ga0157372_10005876 | 3300013307 | Bacteria | 13060 |
| 223 | Ga0157372_10231243 | 3300013307 | Bacteria | 2144 |
| 224 | Ga0157372_10449293 | 3300013307 | Unclassified | 1502 |
| 225 | Ga0157372_11210536 | 3300013307 | Bacteria | 873 |
| 226 | Ga0157372_11284598 | 3300013307 | Bacteria | 845 |
| 227 | Ga0157372_12666174 | 3300013307 | Unclassified | 573 |
| 228 | Ga0157375_10295890 | 3300013308 | Bacteria | 1782 |
| 229 | Ga0157375_12103536 | 3300013308 | Bacteria | 672 |
| 230 | Ga0157375_13652185 | 3300013308 | Unclassified | 512 |
| 231 | Ga0163163_10370328 | 3300014325 | Bacteria | 1489 |
| 232 | Ga0157377_10016803 | 3300014745 | Bacteria | 3771 |
| 233 | Ga0157379_10857926 | 3300014968 | Bacteria | 860 |
| 234 | Ga0157379_11760659 | 3300014968 | Bacteria | 608 |
| 235 | Ga0157376_10306219 | 3300014969 | Bacteria | 1506 |
| 236 | Ga0157376_11419378 | 3300014969 | Unclassified | 726 |
| 237 | Ga0157376_12811505 | 3300014969 | Bacteria | 526 |
| 238 | Ga0182007_10234934 | 3300015262 | Bacteria | 652 |
| 239 | Ga0182005_1159325 | 3300015265 | Unclassified | 661 |
| 240 | Ga0206356_10104702 | 3300020070 | Bacteria | 2178 |
| 241 | Ga0206356_11143110 | 3300020070 | Bacteria | 1206 |
| 242 | Ga0206355_1489610 | 3300020076 | Unclassified | 530 |
| 243 | Ga0206350_11195411 | 3300020080 | Bacteria | 672 |
| 244 | Ga0206353_12031984 | 3300020082 | Bacteria | 2897 |
| 245 | Ga0224712_10088868 | 3300022467 | Bacteria | 1290 |
| 246 | Ga0207653_10023404 | 3300025885 | Bacteria | 1967 |
| 247 | Ga0207692_10001763 | 3300025898 | Bacteria | 8214 |
| 248 | Ga0207710_10064183 | 3300025900 | Bacteria | 1672 |
| 249 | Ga0207647_10439742 | 3300025904 | Bacteria | 732 |
| 250 | Ga0207685_10043445 | 3300025905 | Bacteria | 1694 |
| 251 | Ga0207699_10001650 | 3300025906 | Bacteria | 10571 |
| 252 | Ga0207699_10404936 | 3300025906 | Bacteria | 972 |
| 253 | Ga0207699_10715289 | 3300025906 | Bacteria | 734 |
| 254 | Ga0207705_10072044 | 3300025909 | Unclassified | 2506 |
| 255 | Ga0207705_10132721 | 3300025909 | Bacteria | 1854 |
| 256 | Ga0207705_10230751 | 3300025909 | Bacteria | 1408 |
| 257 | Ga0207654_10152567 | 3300025911 | Bacteria | 1484 |
| 258 | Ga0207654_10635180 | 3300025911 | Bacteria | 764 |
| 259 | Ga0207654_11054477 | 3300025911 | Unclassified | 592 |
| 260 | Ga0207707_10028393 | 3300025912 | Bacteria | 4890 |
| 261 | Ga0207707_10101056 | 3300025912 | Bacteria | 2520 |
| 262 | Ga0207707_10164856 | 3300025912 | Bacteria | 1937 |
| 263 | Ga0207707_10202488 | 3300025912 | Bacteria | 1730 |
| 264 | Ga0207695_10027243 | 3300025913 | Bacteria | 6366 |
| 265 | Ga0207695_10216720 | 3300025913 | Bacteria | 1823 |
| 266 | Ga0207695_10285504 | 3300025913 | Bacteria | 1543 |
| 267 | Ga0207671_10208212 | 3300025914 | Bacteria | 1529 |
| 268 | Ga0207671_10529940 | 3300025914 | Bacteria | 939 |
| 269 | Ga0207693_10000662 | 3300025915 | Bacteria | 30935 |
| 270 | Ga0207693_10003428 | 3300025915 | Bacteria | 13527 |
| 271 | Ga0207693_10160525 | 3300025915 | Bacteria | 1768 |
| 272 | Ga0207693_10303774 | 3300025915 | Bacteria | 1250 |
| 273 | Ga0207663_10000565 | 3300025916 | Bacteria | 16340 |
| 274 | Ga0207663_10089591 | 3300025916 | Bacteria | 2037 |
| 275 | Ga0207660_10007442 | 3300025917 | Bacteria | 7086 |
| 276 | Ga0207660_10047570 | 3300025917 | Bacteria | 3033 |
| 277 | Ga0207660_10329720 | 3300025917 | Bacteria | 1220 |
| 278 | Ga0207660_10376828 | 3300025917 | Bacteria | 1140 |
| 279 | Ga0207657_10000739 | 3300025919 | Bacteria | 34678 |
| 280 | Ga0207657_10008781 | 3300025919 | Bacteria | 10227 |
| 281 | Ga0207657_10030613 | 3300025919 | Bacteria | 4883 |
| 282 | Ga0207649_10061616 | 3300025920 | Bacteria | 2362 |
| 283 | Ga0207649_10309022 | 3300025920 | Bacteria | 1158 |
| 284 | Ga0207649_10745300 | 3300025920 | Bacteria | 762 |
| 285 | Ga0207652_10026188 | 3300025921 | Bacteria | 4854 |
| 286 | Ga0207652_10033577 | 3300025921 | Bacteria | 4321 |
| 287 | Ga0207652_10245352 | 3300025921 | Bacteria | 1615 |
| 288 | Ga0207652_10527448 | 3300025921 | Bacteria | 1062 |
| 289 | Ga0207652_10616296 | 3300025921 | Bacteria | 972 |
| 290 | Ga0207652_10981926 | 3300025921 | Unclassified | 743 |
| 291 | Ga0207646_10237298 | 3300025922 | Bacteria | 1647 |
| 292 | Ga0207646_10447086 | 3300025922 | Bacteria | 1166 |
| 293 | Ga0207681_10237627 | 3300025923 | Bacteria | 1417 |
| 294 | Ga0207694_10405147 | 3300025924 | Bacteria | 1134 |
| 295 | Ga0207694_11212971 | 3300025924 | Bacteria | 638 |
| 296 | Ga0207659_10979185 | 3300025926 | Bacteria | 728 |
| 297 | Ga0207687_10099357 | 3300025927 | Bacteria | 2138 |
| 298 | Ga0207687_10199875 | 3300025927 | Bacteria | 1561 |
| 299 | Ga0207700_10003047 | 3300025928 | Bacteria | 9669 |
| 300 | Ga0207700_10858931 | 3300025928 | Bacteria | 812 |
| 301 | Ga0207664_10005373 | 3300025929 | Bacteria | 8754 |
| 302 | Ga0207664_10932838 | 3300025929 | Bacteria | 779 |
| 303 | Ga0207664_11978587 | 3300025929 | Unclassified | 506 |
| 304 | Ga0207644_10439671 | 3300025931 | Bacteria | 1070 |
| 305 | Ga0207690_10126004 | 3300025932 | Bacteria | 1867 |
| 306 | Ga0207690_10378339 | 3300025932 | Bacteria | 1125 |
| 307 | Ga0207690_10839535 | 3300025932 | Bacteria | 760 |
| 308 | Ga0207709_10078685 | 3300025935 | Bacteria | 2117 |
| 309 | Ga0207665_10004251 | 3300025939 | Bacteria | 9518 |
| 310 | Ga0207665_10021600 | 3300025939 | Bacteria | 4234 |
| 311 | Ga0207665_10037509 | 3300025939 | Bacteria | 3226 |
| 312 | Ga0207665_10103473 | 3300025939 | Bacteria | 1992 |
| 313 | Ga0207691_11009918 | 3300025940 | Unclassified | 694 |
| 314 | Ga0207711_11231276 | 3300025941 | Bacteria | 690 |
| 315 | Ga0207689_10090728 | 3300025942 | Bacteria | 2511 |
| 316 | Ga0207661_10011037 | 3300025944 | Bacteria | 6529 |
| 317 | Ga0207661_10136284 | 3300025944 | Bacteria | 2108 |
| 318 | Ga0207661_10182124 | 3300025944 | Bacteria | 1836 |
| 319 | Ga0207661_10239910 | 3300025944 | Bacteria | 1608 |
| 320 | Ga0207679_10204539 | 3300025945 | Bacteria | 1651 |
| 321 | Ga0207667_10247904 | 3300025949 | Bacteria | 1822 |
| 322 | Ga0207667_10748535 | 3300025949 | Bacteria | 977 |
| 323 | Ga0207667_10837176 | 3300025949 | Bacteria | 915 |
| 324 | Ga0207712_10570757 | 3300025961 | Bacteria | 975 |
| 325 | Ga0207712_11137325 | 3300025961 | Bacteria | 696 |
| 326 | Ga0207712_11334489 | 3300025961 | Bacteria | 641 |
| 327 | Ga0207668_10506129 | 3300025972 | Bacteria | 1040 |
| 328 | Ga0207640_10165868 | 3300025981 | Bacteria | 1640 |
| 329 | Ga0207640_10268344 | 3300025981 | Bacteria | 1334 |
| 330 | Ga0207640_10462097 | 3300025981 | Bacteria | 1048 |
| 331 | Ga0207677_10019958 | 3300026023 | Bacteria | 4059 |
| 332 | Ga0207639_10074732 | 3300026041 | Bacteria | 2662 |
| 333 | Ga0207678_10282327 | 3300026067 | Bacteria | 1425 |
| 334 | Ga0207708_11193053 | 3300026075 | Bacteria | 665 |
| 335 | Ga0207702_10052319 | 3300026078 | Bacteria | 3455 |
| 336 | Ga0207702_11410068 | 3300026078 | Bacteria | 690 |
| 337 | Ga0207702_12455128 | 3300026078 | Bacteria | 508 |
| 338 | Ga0207674_10355621 | 3300026116 | Bacteria | 1416 |
| 339 | Ga0207674_11337600 | 3300026116 | Bacteria | 686 |
| 340 | Ga0207683_10004028 | 3300026121 | Bacteria | 12708 |
| 341 | Ga0207698_10275566 | 3300026142 | Bacteria | 1553 |
| 342 | Ga0207698_11134476 | 3300026142 | Bacteria | 795 |
| 343 | Ga0207428_10453888 | 3300027907 | Unclassified | 934 |
| 344 | Ga0268265_10737994 | 3300028380 | Unclassified | 955 |
| 345 | Ga0268264_11669741 | 3300028381 | Bacteria | 647 |
| 346 | Ga0307410_11896756 | 3300031852 | Unclassified | 530 |
| 347 | Ga0307412_11468317 | 3300031911 | Unclassified | 619 |
| 348 | Ga0307409_100210954 | 3300031995 | Unclassified | 1745 |
| 349 | Ga0307416_100058943 | 3300032002 | Bacteria | 3117 |
| 350 | Ga0307416_100823691 | 3300032002 | Unclassified | 1025 |
| 351 | Ga0307414_10191602 | 3300032004 | Bacteria | 1655 |
| 352 | Ga0307415_100126724 | 3300032126 | Bacteria | 1925 |
| 353 | Ga0373932_0289320 | 3300035112 | Unclassified | 608 |
| 354 | Ga0373956_0047863 | 3300035119 | Bacteria | 1914 |
| 355 | Ga0373955_0064179 | 3300035172 | Bacteria | 2035 |
| 356 | Ga0373931_0236119 | 3300035691 | Bacteria | 1106 |
| 357 | Ga0373933_0180915 | 3300035724 | Bacteria | 1345 |
| 358 | Ga0373937_0027346 | 3300036401 | Bacteria | 5157 |
| 359 | Ga0395899_0145263 | 3300037312 | Bacteria | 1685 |
| 360 | Ga0395899_0226207 | 3300037312 | Bacteria | 1294 |
| 361 | Ga0395899_0252968 | 3300037312 | Bacteria | 1208 |
| 362 | Ga0395900_0017487 | 3300037418 | Bacteria | 7318 |
| 363 | Ga0395900_0604005 | 3300037418 | Bacteria | 1037 |
| 364 | Ga0395900_0767413 | 3300037418 | Bacteria | 894 |
| 365 | Ga0395900_1106369 | 3300037418 | Bacteria | 709 |
| 366 | Ga0395900_1623351 | 3300037418 | Unclassified | 558 |
| 367 | Ga0395898_0036622 | 3300037466 | Bacteria | 4872 |
| 368 | Ga0395898_0114420 | 3300037466 | Bacteria | 2585 |
| 369 | Ga0395898_0236358 | 3300037466 | Bacteria | 1743 |
| 370 | Ga0395898_0380652 | 3300037466 | Bacteria | 1346 |
| 371 | Ga0395898_0790495 | 3300037466 | Bacteria | 889 |
| 372 | Ga0395898_1120078 | 3300037466 | Bacteria | 720 |
| 373 | Ga0395898_1453204 | 3300037466 | Bacteria | 612 |
| 374 | Ga0395905_0197544 | 3300037471 | Bacteria | 1886 |
| 375 | Ga0395905_0265128 | 3300037471 | Bacteria | 1603 |
| 376 | Ga0395905_0280331 | 3300037471 | Bacteria | 1553 |
| 377 | Ga0395905_0759092 | 3300037471 | Bacteria | 872 |
| 378 | Ga0395901_0019608 | 3300038443 | Bacteria | 6913 |
| 379 | Ga0395901_0050390 | 3300038443 | Bacteria | 4326 |
| 380 | Ga0395901_0052105 | 3300038443 | Bacteria | 4254 |
| 381 | Ga0395901_0080644 | 3300038443 | Bacteria | 3398 |
| 382 | Ga0395901_0081441 | 3300038443 | Bacteria | 3381 |
| 383 | Ga0395901_0179442 | 3300038443 | Bacteria | 2221 |
| 384 | Ga0395901_0318956 | 3300038443 | Bacteria | 1608 |
| 385 | Ga0395901_0445038 | 3300038443 | Bacteria | 1326 |
| 386 | Ga0395901_1117854 | 3300038443 | Bacteria | 758 |
| 387 | Ga0395901_1248963 | 3300038443 | Bacteria | 707 |
| 388 | Ga0395901_1487518 | 3300038443 | Bacteria | 633 |
| 389 | Ga0395901_1629349 | 3300038443 | Unclassified | 598 |
| 390 | Ga0436360_0702089 | 3300039438 | Bacteria | 1757 |
| 391 | Ga0451789_1030471 | 3300041443 | Bacteria | 1027 |
| 392 | Ga0451793_0054843 | 3300041452 | Bacteria | 1060 |
| 393 | Ga0451798_0163159 | 3300041458 | Bacteria | 931 |
| 394 | Ga0451800_0727387 | 3300041459 | Bacteria | 2279 |
| 395 | Ga0451802_0324980 | 3300041460 | Bacteria | 1420 |
| 396 | Ga0451807_0005119 | 3300041486 | Bacteria | 2215 |
| 397 | Ga0451807_0802826 | 3300041486 | Bacteria | 607 |
| 398 | Ga0451833_1295374 | 3300041491 | Bacteria | 972 |
| 399 | Ga0451835_0127843 | 3300041492 | Bacteria | 734 |
| 400 | Ga0451845_0472794 | 3300041501 | Bacteria | 3690 |
| 401 | Ga0451847_0504058 | 3300041503 | Bacteria | 1474 |
| 402 | Ga0451851_1149583 | 3300041507 | Unclassified | 519 |
| 403 | Ga0451843_0079376 | 3300041509 | Bacteria | 939 |
| 404 | Ga0451855_1792993 | 3300041511 | Bacteria | 980 |
| 405 | Ga0451853_2291318 | 3300041512 | Bacteria | 2788 |
| 406 | Ga0450920_012612 | 3300042122 | Bacteria | 1587 |
| 407 | Ga0450905_022705 | 3300042142 | Bacteria | 933 |
| 408 | Ga0450916_062945 | 3300042530 | Bacteria | 606 |
| 409 | Ga0466965_0497582 | 3300044683 | Bacteria | 683 |
| 410 | Ga0466963_0002476 | 3300044694 | Bacteria | 10328 |
| 411 | Ga0466963_0017814 | 3300044694 | Bacteria | 4432 |
| 412 | Ga0466963_0018348 | 3300044694 | Bacteria | 4373 |
| 413 | Ga0466963_0045020 | 3300044694 | Bacteria | 2905 |
| 414 | Ga0466963_0308437 | 3300044694 | Bacteria | 1113 |
| 415 | Ga0466964_0000569 | 3300044706 | Bacteria | 11600 |
| 416 | Ga0466964_0009904 | 3300044706 | Bacteria | 3592 |
| 417 | Ga0466964_0017873 | 3300044706 | Unclassified | 2716 |
| 418 | Ga0466964_0165428 | 3300044706 | Bacteria | 1037 |
| 419 | Ga0466964_0632341 | 3300044706 | Unclassified | 590 |
| 420 | Ga0466971_0251810 | 3300044719 | Bacteria | 841 |
| 421 | Ga0466968_0050510 | 3300044735 | Bacteria | 1775 |
| 422 | Ga0466968_0080712 | 3300044735 | Unclassified | 1429 |
| 423 | Ga0466968_0124320 | 3300044735 | Bacteria | 1169 |
| 424 | Ga0466957_0027825 | 3300044842 | Unclassified | 3361 |
| 425 | Ga0466957_0056601 | 3300044842 | Bacteria | 2398 |
| 426 | Ga0466957_0282539 | 3300044842 | Bacteria | 1111 |
| 427 | Ga0466957_0661254 | 3300044842 | Bacteria | 735 |
| 428 | Ga0466960_0015647 | 3300044901 | Bacteria | 3275 |
| 429 | Ga0466960_0089970 | 3300044901 | Bacteria | 1563 |
| 430 | Ga0466960_0097690 | 3300044901 | Bacteria | 1507 |
| 431 | Ga0466960_0123750 | 3300044901 | Bacteria | 1357 |
| 432 | Ga0466960_0323204 | 3300044901 | Bacteria | 874 |
| 433 | Ga0466959_0272994 | 3300045049 | Viruses | 1162 |
| 434 | Ga0451576_2129098 | 3300045051 | Bacteria | 577 |
| 435 | Ga0466958_0122597 | 3300045836 | Bacteria | 1628 |
| 436 | Ga0466967_0032639 | 3300045976 | Bacteria | 4398 |
| 437 | Ga0466967_0036019 | 3300045976 | Bacteria | 4220 |
| 438 | Ga0466967_0057653 | 3300045976 | Bacteria | 3429 |
| 439 | Ga0466967_0077440 | 3300045976 | Bacteria | 2993 |
| 440 | Ga0466967_0194818 | 3300045976 | Bacteria | 1917 |
| 441 | Ga0466967_0208355 | 3300045976 | Bacteria | 1853 |
| 442 | Ga0466967_0275540 | 3300045976 | Bacteria | 1613 |
| 443 | Ga0466967_0308196 | 3300045976 | Unclassified | 1524 |
| 444 | Ga0466967_0320278 | 3300045976 | Bacteria | 1495 |
| 445 | Ga0466967_1613333 | 3300045976 | Unclassified | 646 |
| 446 | Ga0495592_0000100 | 3300046454 | Bacteria | 76535 |
| 447 | Ga0495592_0024391 | 3300046454 | Bacteria | 4598 |
| 448 | Ga0495603_0467758 | 3300046455 | Bacteria | 722 |
| 449 | Ga0495629_0682523 | 3300046459 | Bacteria | 683 |
| 450 | Ga0495641_0039338 | 3300046461 | Bacteria | 2206 |
| 451 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 452 | Ga0495653_0000519 | 3300046463 | Bacteria | 29635 |
| 453 | Ga0495653_0250241 | 3300046463 | Bacteria | 1176 |
| 454 | Ga0495639_0475811 | 3300046475 | Unclassified | 636 |
| 455 | Ga0495664_0207275 | 3300046477 | Bacteria | 1187 |
| 456 | Ga0495608_0002853 | 3300046511 | Bacteria | 12379 |
| 457 | Ga0495608_0118129 | 3300046511 | Archaea | 1701 |
| 458 | Ga0495618_0002283 | 3300046514 | Bacteria | 12422 |
| 459 | Ga0495628_0001255 | 3300046516 | Bacteria | 23210 |
| 460 | Ga0495628_0084698 | 3300046516 | Bacteria | 2459 |
| 461 | Ga0495666_0402406 | 3300046526 | Unclassified | 615 |
| 462 | Ga0495652_0000888 | 3300046529 | Bacteria | 34393 |
| 463 | Ga0495652_0027787 | 3300046529 | Bacteria | 4983 |
| 464 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 465 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 466 | Ga0495667_0040139 | 3300046559 | Bacteria | 3109 |
| 467 | Ga0495656_0239461 | 3300046615 | Unclassified | 913 |
| 468 | Ga0495634_0183632 | 3300046642 | Unclassified | 1308 |
| 469 | Ga0495635_0530057 | 3300046663 | Bacteria | 773 |
| 470 | Ga0495657_0028894 | 3300046675 | Bacteria | 3893 |
| 471 | Ga0495599_0012836 | 3300046678 | Bacteria | 5170 |
| 472 | Ga0495623_0000093 | 3300046679 | Bacteria | 53441 |
| 473 | Ga0495646_0019787 | 3300046680 | Bacteria | 4257 |
| 474 | Ga0495658_0021178 | 3300046683 | Bacteria | 3425 |
| 475 | Ga0495658_0532841 | 3300046683 | Bacteria | 752 |
| 476 | Ga0495604_0000111 | 3300047317 | Bacteria | 68576 |
| 477 | Ga0495674_0044849 | 3300047319 | Bacteria | 3929 |
| 478 | Ga0495676_0169451 | 3300047321 | Bacteria | 1538 |
| 479 | Ga0495680_0022218 | 3300047322 | Bacteria | 5293 |
| 480 | Ga0495680_0337532 | 3300047322 | Bacteria | 1052 |
| 481 | Ga0495675_0000376 | 3300047444 | Bacteria | 30923 |
| 482 | Ga0495675_0439832 | 3300047444 | Unclassified | 756 |
| 483 | Ga0495593_0066709 | 3300047673 | Bacteria | 1875 |
| 484 | Ga0495602_0000141 | 3300048088 | Bacteria | 67940 |
| 485 | Ga0495602_0006548 | 3300048088 | Bacteria | 12215 |
| 486 | Ga0496100_0006457 | 3300048903 | Bacteria | 6393 |
| 487 | Ga0496100_0142904 | 3300048903 | Bacteria | 1698 |
| 488 | Ga0496100_0283283 | 3300048903 | Bacteria | 1236 |
| 489 | Ga0496100_1261350 | 3300048903 | Unclassified | 583 |
| 490 | Ga0496101_0013813 | 3300048904 | Bacteria | 5420 |
| 491 | Ga0496101_0125801 | 3300048904 | Bacteria | 1942 |
| 492 | Ga0496101_0395330 | 3300048904 | Bacteria | 1088 |
| 493 | Ga0496102_0016855 | 3300048905 | Bacteria | 6391 |
| 494 | Ga0496102_0025083 | 3300048905 | Bacteria | 5304 |
| 495 | Ga0496102_0025463 | 3300048905 | Bacteria | 5267 |
| 496 | Ga0496102_0143185 | 3300048905 | Bacteria | 2242 |
| 497 | Ga0496102_1305846 | 3300048905 | Unclassified | 645 |
| 498 | Ga0496103_0274083 | 3300048906 | Unclassified | 1085 |
| 499 | Ga0496103_0312793 | 3300048906 | Bacteria | 1010 |
| 500 | Ga0496104_0001048 | 3300048907 | Bacteria | 23633 |
| 501 | Ga0496104_0047160 | 3300048907 | Bacteria | 4060 |
| 502 | Ga0496104_0331245 | 3300048907 | Bacteria | 1435 |
| 503 | Ga0496104_0542053 | 3300048907 | Bacteria | 1074 |
| 504 | Ga0496105_0000594 | 3300048908 | Bacteria | 24087 |
| 505 | Ga0496105_0096561 | 3300048908 | Bacteria | 2441 |
| 506 | Ga0496105_0103454 | 3300048908 | Bacteria | 2352 |
| 507 | Ga0496105_0162972 | 3300048908 | Bacteria | 1830 |
| 508 | Ga0496105_0334597 | 3300048908 | Bacteria | 1211 |
| 509 | Ga0496105_1163646 | 3300048908 | Unclassified | 569 |
| 510 | Ga0496106_0008985 | 3300048909 | Bacteria | 7382 |
| 511 | Ga0496106_0038127 | 3300048909 | Bacteria | 3596 |
| 512 | Ga0496107_0003633 | 3300048910 | Bacteria | 10359 |
| 513 | Ga0496107_0073243 | 3300048910 | Bacteria | 2491 |
| 514 | Ga0496107_0270588 | 3300048910 | Bacteria | 1264 |
| 515 | Ga0496108_0010409 | 3300048911 | Bacteria | 7553 |
| 516 | Ga0496108_0072278 | 3300048911 | Bacteria | 2911 |
| 517 | Ga0496108_0107672 | 3300048911 | Bacteria | 2380 |
| 518 | Ga0496108_0214817 | 3300048911 | Bacteria | 1670 |
| 519 | Ga0496108_0280338 | 3300048911 | Bacteria | 1451 |
| 520 | Ga0496108_0471573 | 3300048911 | Bacteria | 1097 |
| 521 | Ga0496108_0583121 | 3300048911 | Bacteria | 975 |
| 522 | Ga0496109_0000463 | 3300048912 | Bacteria | 34599 |
| 523 | Ga0496109_0029226 | 3300048912 | Bacteria | 4936 |
| 524 | Ga0496109_0043356 | 3300048912 | Bacteria | 4078 |
| 525 | Ga0496109_0136237 | 3300048912 | Bacteria | 2294 |
| 526 | Ga0496109_0145236 | 3300048912 | Bacteria | 2219 |
| 527 | Ga0496109_0147833 | 3300048912 | Bacteria | 2199 |
| 528 | Ga0496109_0312694 | 3300048912 | Bacteria | 1482 |
| 529 | Ga0496109_0387732 | 3300048912 | Bacteria | 1320 |
| 530 | Ga0496109_0691165 | 3300048912 | Unclassified | 957 |
| 531 | Ga0496109_1023625 | 3300048912 | Unclassified | 763 |
| 532 | Ga0496110_0000563 | 3300048913 | Bacteria | 25359 |
| 533 | Ga0496110_0019029 | 3300048913 | Bacteria | 5771 |
| 534 | Ga0496110_0020550 | 3300048913 | Bacteria | 5576 |
| 535 | Ga0496110_0081594 | 3300048913 | Bacteria | 2883 |
| 536 | Ga0496110_0104217 | 3300048913 | Bacteria | 2545 |
| 537 | Ga0496110_0217112 | 3300048913 | Bacteria | 1739 |
| 538 | Ga0496110_0236360 | 3300048913 | Bacteria | 1663 |
| 539 | Ga0496110_0432449 | 3300048913 | Bacteria | 1199 |
| 540 | Ga0496110_0685637 | 3300048913 | Unclassified | 925 |
| 541 | Ga0496110_1582680 | 3300048913 | Bacteria | 565 |
| 542 | Ga0496111_0006472 | 3300048914 | Bacteria | 7609 |
| 543 | Ga0496111_0010323 | 3300048914 | Bacteria | 6261 |
| 544 | Ga0496111_0037754 | 3300048914 | Bacteria | 3458 |
| 545 | Ga0496111_0044912 | 3300048914 | Bacteria | 3177 |
| 546 | Ga0496111_0183365 | 3300048914 | Unclassified | 1556 |
| 547 | Ga0496111_0186871 | 3300048914 | Bacteria | 1540 |
| 548 | Ga0496111_0234879 | 3300048914 | Bacteria | 1362 |
| 549 | Ga0496111_0257755 | 3300048914 | Bacteria | 1294 |
| 550 | Ga0496111_0539508 | 3300048914 | Bacteria | 857 |
| 551 | Ga0496112_0016172 | 3300048915 | Bacteria | 6980 |
| 552 | Ga0496112_0020985 | 3300048915 | Bacteria | 6203 |
| 553 | Ga0496112_0135570 | 3300048915 | Bacteria | 2432 |
| 554 | Ga0496112_0269566 | 3300048915 | Bacteria | 1651 |
| 555 | Ga0496112_0482811 | 3300048915 | Bacteria | 1175 |
| 556 | Ga0496112_0600292 | 3300048915 | Unclassified | 1033 |
| 557 | Ga0496112_0881047 | 3300048915 | Bacteria | 818 |
| 558 | Ga0496113_0056786 | 3300048916 | Bacteria | 2940 |
| 559 | Ga0496113_0126259 | 3300048916 | Bacteria | 2004 |
| 560 | Ga0496113_0131667 | 3300048916 | Bacteria | 1963 |
| 561 | Ga0496113_0195362 | 3300048916 | Bacteria | 1607 |
| 562 | Ga0496113_0244608 | 3300048916 | Bacteria | 1431 |
| 563 | Ga0496113_0277480 | 3300048916 | Bacteria | 1340 |
| 564 | Ga0496113_0323450 | 3300048916 | Bacteria | 1236 |
| 565 | Ga0496113_0477973 | 3300048916 | Bacteria | 1001 |
| 566 | Ga0496113_0928609 | 3300048916 | Unclassified | 687 |
| 567 | Ga0496114_0000690 | 3300048917 | Bacteria | 25130 |
| 568 | Ga0496114_0001144 | 3300048917 | Bacteria | 20053 |
| 569 | Ga0496114_0025920 | 3300048917 | Bacteria | 4796 |
| 570 | Ga0496114_0118681 | 3300048917 | Bacteria | 2273 |
| 571 | Ga0496114_0218669 | 3300048917 | Bacteria | 1672 |
| 572 | Ga0496114_0382879 | 3300048917 | Bacteria | 1245 |
| 573 | Ga0496114_0628841 | 3300048917 | Bacteria | 945 |
| 574 | Ga0496114_1733999 | 3300048917 | Unclassified | 513 |
| 575 | Ga0496115_0014466 | 3300048918 | Bacteria | 5973 |
| 576 | Ga0496115_0188501 | 3300048918 | Bacteria | 1704 |
| 577 | Ga0496115_0660943 | 3300048918 | Bacteria | 825 |
| 578 | Ga0496115_0696675 | 3300048918 | Bacteria | 799 |
| 579 | Ga0501069_0488754 | 3300049585 | Bacteria | 734 |
| 580 | Ga0501074_0331090 | 3300049590 | Bacteria | 1081 |
| 581 | Ga0501075_1324423 | 3300049591 | Bacteria | 546 |
| 582 | Ga0501076_1763484 | 3300049592 | Unclassified | 508 |
| 583 | nmdc:mga03683_140091_c1 | 3300050489 | Bacteria | 1087 |
| 584 | nmdc:mga00v17_312968_c1 | 3300050491 | Bacteria | 1020 |
| 585 | nmdc:mga0yw44_35012_c1 | 3300050492 | Bacteria | 2947 |
| 586 | nmdc:mga0yw44_794125_c1 | 3300050492 | Bacteria | 643 |
| 587 | nmdc:mga09592_174129_c1 | 3300050508 | Unclassified | 1861 |
| 588 | nmdc:mga08y16_204637_c1 | 3300050511 | Bacteria | 2045 |
| 589 | nmdc:mga0n895_607240_c1 | 3300050512 | Bacteria | 1096 |
| 590 | nmdc:mga0n895_92201_c1 | 3300050512 | Bacteria | 3032 |
| 591 | nmdc:mga0rr50_1023321_c1 | 3300050513 | Bacteria | 703 |
| 592 | nmdc:mga0rr50_1632811_c1 | 3300050513 | Bacteria | 544 |
| 593 | nmdc:mga0rr50_514800_c1 | 3300050513 | Bacteria | 1018 |
| 594 | nmdc:mga08x19_220463_c1 | 3300050514 | Bacteria | 1303 |
| 595 | nmdc:mga08x19_507757_c1 | 3300050514 | Bacteria | 851 |
| 596 | nmdc:mga0a205_215669_c1 | 3300050515 | Unclassified | 1806 |
| 597 | nmdc:mga0a205_216636_c1 | 3300050515 | Bacteria | 1801 |
| 598 | Ga0495601_0000206 | 3300053077 | Bacteria | 31438 |
| 599 | Ga0495595_0397696 | 3300053084 | Unclassified | 698 |
| 600 | Ga0495619_0000291 | 3300053085 | Bacteria | 35704 |
| 601 | Ga0495619_1115876 | 3300053085 | Unclassified | 524 |
| 602 | Ga0501084_0205119 | 3300054114 | Bacteria | 1664 |
| 603 | Ga0501082_0100046 | 3300060353 | Bacteria | 2507 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_11245589 | Ga0105243_112455892 | 77 |
| 2 | 3300013297 | Ga0157378_10196376 | Ga0157378_101963764 | 77 |
| 3 | 3300013308 | Ga0157375_12103536 | Ga0157375_121035361 | 77 |
| 4 | 3300009176 | Ga0105242_11755462 | Ga0105242_117554622 | 78 |
| 5 | 3300005445 | Ga0070708_101849518 | Ga0070708_1018495181 | 80 |
| 6 | 3300037312 | Ga0395899_0145263 | Ga0395899_0145263_393_716 | 80 |
| 7 | 3300037418 | Ga0395900_0017487 | Ga0395900_0017487_6661_6984 | 80 |
| 8 | 3300037466 | Ga0395898_0036622 | Ga0395898_0036622_3933_4256 | 80 |
| 9 | 3300037471 | Ga0395905_0197544 | Ga0395905_0197544_1534_1857 | 80 |
| 10 | 3300038443 | Ga0395901_0318956 | Ga0395901_0318956_35_358 | 80 |
| 11 | 3300009147 | Ga0114129_11610047 | Ga0114129_116100472 | 81 |
| 12 | 3300048917 | Ga0496114_0118681 | Ga0496114_0118681_584_892 | 81 |
| 13 | 3300005445 | Ga0070708_101438205 | Ga0070708_1014382052 | 82 |
| 14 | 3300005471 | Ga0070698_100874622 | Ga0070698_1008746221 | 82 |
| 15 | 3300006038 | Ga0075365_10327086 | Ga0075365_103270862 | 82 |
| 16 | 3300038443 | Ga0395901_0445038 | Ga0395901_0445038_159_473 | 82 |
| 17 | 3300042530 | Ga0450916_062945 | Ga0450916_062945_241_564 | 82 |
| 18 | 3300049585 | Ga0501069_0488754 | Ga0501069_0488754_214_528 | 82 |
| 19 | 3300050491 | nmdc:mga00v17_312968_c1 | nmdc:mga00v17_312968_c1_328_651 | 82 |
| 20 | 3300050492 | nmdc:mga0yw44_35012_c1 | nmdc:mga0yw44_35012_c1_1324_1647 | 82 |
| 21 | 3300025940 | Ga0207691_11009918 | Ga0207691_110099182 | 83 |
| 22 | 3300045976 | Ga0466967_1613333 | Ga0466967_1613333_260_571 | 85 |
| 23 | 3300005937 | Ga0081455_10021153 | Ga0081455_100211538 | 86 |
| 24 | 3300006844 | Ga0075428_100706486 | Ga0075428_1007064862 | 86 |
| 25 | 3300009094 | Ga0111539_10315307 | Ga0111539_103153072 | 86 |
| 26 | 3300027907 | Ga0207428_10453888 | Ga0207428_104538881 | 86 |
| 27 | 3300049592 | Ga0501076_1763484 | Ga0501076_1763484_17_340 | 86 |
| 28 | 3300050489 | nmdc:mga03683_140091_c1 | nmdc:mga03683_140091_c1_460_783 | 86 |
| 29 | 3300050492 | nmdc:mga0yw44_794125_c1 | nmdc:mga0yw44_794125_c1_223_546 | 86 |
| 30 | 3300050511 | nmdc:mga08y16_204637_c1 | nmdc:mga08y16_204637_c1_899_1204 | 86 |
| 31 | 3300005549 | Ga0070704_101844844 | Ga0070704_1018448441 | 87 |
| 32 | 3300037471 | Ga0395905_0280331 | Ga0395905_0280331_477_779 | 87 |
| 33 | 3300038443 | Ga0395901_0179442 | Ga0395901_0179442_1871_2173 | 87 |
| 34 | 3300044694 | Ga0466963_0002476 | Ga0466963_0002476_3174_3488 | 87 |
| 35 | 3300044842 | Ga0466957_0282539 | Ga0466957_0282539_681_995 | 87 |
| 36 | 3300045976 | Ga0466967_0208355 | Ga0466967_0208355_1292_1606 | 87 |
| 37 | 3300009098 | Ga0105245_10322174 | Ga0105245_103221744 | 88 |
| 38 | 3300005456 | Ga0070678_100568595 | Ga0070678_1005685952 | 89 |
| 39 | 3300009177 | Ga0105248_12243991 | Ga0105248_122439911 | 89 |
| 40 | 3300014969 | Ga0157376_10306219 | Ga0157376_103062193 | 89 |
| 41 | 3300025941 | Ga0207711_11231276 | Ga0207711_112312762 | 89 |
| 42 | 3300037418 | Ga0395900_0604005 | Ga0395900_0604005_710_1012 | 89 |
| 43 | 3300037466 | Ga0395898_0114420 | Ga0395898_0114420_1816_2118 | 89 |
| 44 | 3300037471 | Ga0395905_0265128 | Ga0395905_0265128_685_987 | 89 |
| 45 | 3300038443 | Ga0395901_0019608 | Ga0395901_0019608_3423_3725 | 89 |
| 46 | 3300048903 | Ga0496100_0142904 | Ga0496100_0142904_651_986 | 89 |
| 47 | 3300048907 | Ga0496104_0001048 | Ga0496104_0001048_5077_5412 | 89 |
| 48 | 3300048908 | Ga0496105_0000594 | Ga0496105_0000594_4704_5039 | 89 |
| 49 | 3300048910 | Ga0496107_0073243 | Ga0496107_0073243_1291_1626 | 89 |
| 50 | 3300048911 | Ga0496108_0010409 | Ga0496108_0010409_5544_5879 | 89 |
| 51 | 3300048912 | Ga0496109_0000463 | Ga0496109_0000463_14108_14443 | 89 |
| 52 | 3300048913 | Ga0496110_0000563 | Ga0496110_0000563_15040_15375 | 89 |
| 53 | 3300048914 | Ga0496111_0010323 | Ga0496111_0010323_1193_1528 | 89 |
| 54 | 3300048916 | Ga0496113_0323450 | Ga0496113_0323450_274_609 | 89 |
| 55 | 3300048917 | Ga0496114_0000690 | Ga0496114_0000690_22495_22830 | 89 |
| 56 | 3300005445 | Ga0070708_101315748 | Ga0070708_1013157481 | 90 |
| 57 | 3300005536 | Ga0070697_100055952 | Ga0070697_1000559525 | 90 |
| 58 | 3300045051 | Ga0451576_2129098 | Ga0451576_2129098_40_369 | 92 |
| 59 | 3300005329 | Ga0070683_100005463 | Ga0070683_1000054636 | 93 |
| 60 | 3300005329 | Ga0070683_100540625 | Ga0070683_1005406252 | 93 |
| 61 | 3300005330 | Ga0070690_100344418 | Ga0070690_1003444181 | 93 |
| 62 | 3300005336 | Ga0070680_100008678 | Ga0070680_10000867811 | 93 |
| 63 | 3300005337 | Ga0070682_100010000 | Ga0070682_1000100006 | 93 |
| 64 | 3300005338 | Ga0068868_100030281 | Ga0068868_1000302814 | 93 |
| 65 | 3300005354 | Ga0070675_101404713 | Ga0070675_1014047131 | 93 |
| 66 | 3300005436 | Ga0070713_100662047 | Ga0070713_1006620472 | 93 |
| 67 | 3300005437 | Ga0070710_11152706 | Ga0070710_111527062 | 93 |
| 68 | 3300005440 | Ga0070705_101248109 | Ga0070705_1012481092 | 93 |
| 69 | 3300005445 | Ga0070708_101625479 | Ga0070708_1016254792 | 93 |
| 70 | 3300005445 | Ga0070708_101781307 | Ga0070708_1017813072 | 93 |
| 71 | 3300005456 | Ga0070678_100003222 | Ga0070678_1000032227 | 93 |
| 72 | 3300005457 | Ga0070662_100509875 | Ga0070662_1005098752 | 93 |
| 73 | 3300005458 | Ga0070681_10005979 | Ga0070681_1000597912 | 93 |
| 74 | 3300005459 | Ga0068867_102318508 | Ga0068867_1023185081 | 93 |
| 75 | 3300005468 | Ga0070707_101336484 | Ga0070707_1013364842 | 93 |
| 76 | 3300005530 | Ga0070679_100019233 | Ga0070679_1000192337 | 93 |
| 77 | 3300005535 | Ga0070684_100017138 | Ga0070684_1000171385 | 93 |
| 78 | 3300005535 | Ga0070684_100196926 | Ga0070684_1001969263 | 93 |
| 79 | 3300005535 | Ga0070684_101483218 | Ga0070684_1014832182 | 93 |
| 80 | 3300005549 | Ga0070704_101265409 | Ga0070704_1012654092 | 93 |
| 81 | 3300005564 | Ga0070664_100046670 | Ga0070664_1000466706 | 93 |
| 82 | 3300005564 | Ga0070664_100914430 | Ga0070664_1009144302 | 93 |
| 83 | 3300005614 | Ga0068856_100035013 | Ga0068856_1000350133 | 93 |
| 84 | 3300005615 | Ga0070702_100043548 | Ga0070702_1000435483 | 93 |
| 85 | 3300005616 | Ga0068852_101594212 | Ga0068852_1015942122 | 93 |
| 86 | 3300005616 | Ga0068852_101804820 | Ga0068852_1018048202 | 93 |
| 87 | 3300005617 | Ga0068859_101320526 | Ga0068859_1013205262 | 93 |
| 88 | 3300005844 | Ga0068862_100663743 | Ga0068862_1006637432 | 93 |
| 89 | 3300006237 | Ga0097621_101624698 | Ga0097621_1016246982 | 93 |
| 90 | 3300006852 | Ga0075433_10385164 | Ga0075433_103851642 | 93 |
| 91 | 3300006931 | Ga0097620_101320681 | Ga0097620_1013206812 | 93 |
| 92 | 3300009098 | Ga0105245_10002363 | Ga0105245_1000236315 | 93 |
| 93 | 3300009098 | Ga0105245_11755974 | Ga0105245_117559741 | 93 |
| 94 | 3300009101 | Ga0105247_10609179 | Ga0105247_106091792 | 93 |
| 95 | 3300009148 | Ga0105243_10125864 | Ga0105243_101258642 | 93 |
| 96 | 3300009174 | Ga0105241_10127395 | Ga0105241_101273953 | 93 |
| 97 | 3300009177 | Ga0105248_10573398 | Ga0105248_105733983 | 93 |
| 98 | 3300009545 | Ga0105237_11270385 | Ga0105237_112703851 | 93 |
| 99 | 3300009545 | Ga0105237_11420040 | Ga0105237_114200402 | 93 |
| 100 | 3300009553 | Ga0105249_10372811 | Ga0105249_103728112 | 93 |
| 101 | 3300009553 | Ga0105249_10739350 | Ga0105249_107393502 | 93 |
| 102 | 3300010375 | Ga0105239_10230714 | Ga0105239_102307143 | 93 |
| 103 | 3300010375 | Ga0105239_10239215 | Ga0105239_102392152 | 93 |
| 104 | 3300010375 | Ga0105239_11686493 | Ga0105239_116864931 | 93 |
| 105 | 3300011119 | Ga0105246_10078552 | Ga0105246_100785522 | 93 |
| 106 | 3300011119 | Ga0105246_11237062 | Ga0105246_112370622 | 93 |
| 107 | 3300013296 | Ga0157374_10084293 | Ga0157374_100842933 | 93 |
| 108 | 3300013296 | Ga0157374_10593161 | Ga0157374_105931612 | 93 |
| 109 | 3300013307 | Ga0157372_11210536 | Ga0157372_112105362 | 93 |
| 110 | 3300013308 | Ga0157375_10295890 | Ga0157375_102958904 | 93 |
| 111 | 3300014325 | Ga0163163_10370328 | Ga0163163_103703281 | 93 |
| 112 | 3300014968 | Ga0157379_10857926 | Ga0157379_108579262 | 93 |
| 113 | 3300014968 | Ga0157379_11760659 | Ga0157379_117606592 | 93 |
| 114 | 3300014969 | Ga0157376_11419378 | Ga0157376_114193782 | 93 |
| 115 | 3300025911 | Ga0207654_10152567 | Ga0207654_101525673 | 93 |
| 116 | 3300025912 | Ga0207707_10101056 | Ga0207707_101010562 | 93 |
| 117 | 3300025917 | Ga0207660_10047570 | Ga0207660_100475702 | 93 |
| 118 | 3300025920 | Ga0207649_10745300 | Ga0207649_107453002 | 93 |
| 119 | 3300025921 | Ga0207652_10033577 | Ga0207652_100335775 | 93 |
| 120 | 3300025926 | Ga0207659_10979185 | Ga0207659_109791852 | 93 |
| 121 | 3300025927 | Ga0207687_10099357 | Ga0207687_100993572 | 93 |
| 122 | 3300025928 | Ga0207700_10858931 | Ga0207700_108589312 | 93 |
| 123 | 3300025935 | Ga0207709_10078685 | Ga0207709_100786853 | 93 |
| 124 | 3300025944 | Ga0207661_10011037 | Ga0207661_100110376 | 93 |
| 125 | 3300025945 | Ga0207679_10204539 | Ga0207679_102045392 | 93 |
| 126 | 3300025961 | Ga0207712_10570757 | Ga0207712_105707572 | 93 |
| 127 | 3300025961 | Ga0207712_11334489 | Ga0207712_113344892 | 93 |
| 128 | 3300025981 | Ga0207640_10268344 | Ga0207640_102683442 | 93 |
| 129 | 3300026023 | Ga0207677_10019958 | Ga0207677_100199585 | 93 |
| 130 | 3300026067 | Ga0207678_10282327 | Ga0207678_102823271 | 93 |
| 131 | 3300026075 | Ga0207708_11193053 | Ga0207708_111930532 | 93 |
| 132 | 3300026078 | Ga0207702_10052319 | Ga0207702_100523196 | 93 |
| 133 | 3300026116 | Ga0207674_11337600 | Ga0207674_113376002 | 93 |
| 134 | 3300026121 | Ga0207683_10004028 | Ga0207683_1000402812 | 93 |
| 135 | 3300026142 | Ga0207698_11134476 | Ga0207698_111344762 | 93 |
| 136 | 3300028381 | Ga0268264_11669741 | Ga0268264_116697412 | 93 |
| 137 | 3300037466 | Ga0395898_0236358 | Ga0395898_0236358_1236_1544 | 93 |
| 138 | 3300037466 | Ga0395898_1120078 | Ga0395898_1120078_145_453 | 93 |
| 139 | 3300038443 | Ga0395901_1117854 | Ga0395901_1117854_330_638 | 93 |
| 140 | 3300042142 | Ga0450905_022705 | Ga0450905_022705_17_325 | 93 |
| 141 | 3300045976 | Ga0466967_0194818 | Ga0466967_0194818_761_1084 | 93 |
| 142 | 3300046459 | Ga0495629_0682523 | Ga0495629_0682523_296_604 | 93 |
| 143 | 3300046642 | Ga0495634_0183632 | Ga0495634_0183632_41_349 | 93 |
| 144 | 3300048903 | Ga0496100_0283283 | Ga0496100_0283283_776_1084 | 93 |
| 145 | 3300048904 | Ga0496101_0013813 | Ga0496101_0013813_1976_2281 | 93 |
| 146 | 3300048904 | Ga0496101_0395330 | Ga0496101_0395330_77_385 | 93 |
| 147 | 3300048905 | Ga0496102_0025083 | Ga0496102_0025083_2154_2459 | 93 |
| 148 | 3300048905 | Ga0496102_0143185 | Ga0496102_0143185_1860_2168 | 93 |
| 149 | 3300048906 | Ga0496103_0312793 | Ga0496103_0312793_545_853 | 93 |
| 150 | 3300048907 | Ga0496104_0047160 | Ga0496104_0047160_1538_1843 | 93 |
| 151 | 3300048907 | Ga0496104_0542053 | Ga0496104_0542053_580_888 | 93 |
| 152 | 3300048908 | Ga0496105_0162972 | Ga0496105_0162972_189_497 | 93 |
| 153 | 3300048908 | Ga0496105_1163646 | Ga0496105_1163646_10_318 | 93 |
| 154 | 3300048909 | Ga0496106_0038127 | Ga0496106_0038127_945_1253 | 93 |
| 155 | 3300048911 | Ga0496108_0214817 | Ga0496108_0214817_1191_1499 | 93 |
| 156 | 3300048911 | Ga0496108_0583121 | Ga0496108_0583121_315_623 | 93 |
| 157 | 3300048912 | Ga0496109_0043356 | Ga0496109_0043356_3073_3381 | 93 |
| 158 | 3300048912 | Ga0496109_0312694 | Ga0496109_0312694_794_1102 | 93 |
| 159 | 3300048912 | Ga0496109_0387732 | Ga0496109_0387732_46_357 | 93 |
| 160 | 3300048913 | Ga0496110_0685637 | Ga0496110_0685637_393_701 | 93 |
| 161 | 3300048913 | Ga0496110_1582680 | Ga0496110_1582680_226_537 | 93 |
| 162 | 3300048914 | Ga0496111_0037754 | Ga0496111_0037754_1705_2013 | 93 |
| 163 | 3300048914 | Ga0496111_0186871 | Ga0496111_0186871_1166_1477 | 93 |
| 164 | 3300048915 | Ga0496112_0269566 | Ga0496112_0269566_1102_1413 | 93 |
| 165 | 3300048915 | Ga0496112_0881047 | Ga0496112_0881047_194_517 | 93 |
| 166 | 3300048916 | Ga0496113_0126259 | Ga0496113_0126259_462_770 | 93 |
| 167 | 3300048917 | Ga0496114_0025920 | Ga0496114_0025920_2232_2537 | 93 |
| 168 | 3300048917 | Ga0496114_0382879 | Ga0496114_0382879_917_1225 | 93 |
| 169 | 3300048917 | Ga0496114_0628841 | Ga0496114_0628841_553_861 | 93 |
| 170 | 3300048918 | Ga0496115_0188501 | Ga0496115_0188501_1098_1403 | 93 |
| 171 | 3300048918 | Ga0496115_0660943 | Ga0496115_0660943_149_457 | 93 |
| 172 | 3300050512 | nmdc:mga0n895_607240_c1 | nmdc:mga0n895_607240_c1_123_431 | 93 |
| 173 | 3300050512 | nmdc:mga0n895_92201_c1 | nmdc:mga0n895_92201_c1_1452_1760 | 93 |
| 174 | 3300050515 | nmdc:mga0a205_215669_c1 | nmdc:mga0a205_215669_c1_1262_1570 | 93 |
| 175 | 3300050515 | nmdc:mga0a205_216636_c1 | nmdc:mga0a205_216636_c1_597_905 | 93 |
| 176 | 3300005334 | Ga0068869_101583370 | Ga0068869_1015833701 | 94 |
| 177 | 3300005336 | Ga0070680_101981305 | Ga0070680_1019813051 | 94 |
| 178 | 3300005343 | Ga0070687_100462901 | Ga0070687_1004629011 | 94 |
| 179 | 3300005355 | Ga0070671_100452341 | Ga0070671_1004523411 | 94 |
| 180 | 3300005434 | Ga0070709_10239470 | Ga0070709_102394701 | 94 |
| 181 | 3300005435 | Ga0070714_100135410 | Ga0070714_1001354102 | 94 |
| 182 | 3300005436 | Ga0070713_100051791 | Ga0070713_1000517916 | 94 |
| 183 | 3300005437 | Ga0070710_10060757 | Ga0070710_100607574 | 94 |
| 184 | 3300005438 | Ga0070701_10244375 | Ga0070701_102443752 | 94 |
| 185 | 3300005439 | Ga0070711_100059978 | Ga0070711_1000599783 | 94 |
| 186 | 3300005444 | Ga0070694_100396904 | Ga0070694_1003969042 | 94 |
| 187 | 3300005445 | Ga0070708_100013462 | Ga0070708_1000134625 | 94 |
| 188 | 3300005445 | Ga0070708_101295738 | Ga0070708_1012957382 | 94 |
| 189 | 3300005468 | Ga0070707_100110992 | Ga0070707_1001109922 | 94 |
| 190 | 3300005468 | Ga0070707_100832738 | Ga0070707_1008327381 | 94 |
| 191 | 3300005471 | Ga0070698_100053629 | Ga0070698_1000536293 | 94 |
| 192 | 3300005471 | Ga0070698_100874689 | Ga0070698_1008746891 | 94 |
| 193 | 3300005518 | Ga0070699_100061914 | Ga0070699_1000619146 | 94 |
| 194 | 3300005530 | Ga0070679_100350122 | Ga0070679_1003501221 | 94 |
| 195 | 3300005536 | Ga0070697_100180694 | Ga0070697_1001806945 | 94 |
| 196 | 3300005536 | Ga0070697_100756691 | Ga0070697_1007566911 | 94 |
| 197 | 3300005549 | Ga0070704_100171840 | Ga0070704_1001718403 | 94 |
| 198 | 3300005578 | Ga0068854_100087354 | Ga0068854_1000873544 | 94 |
| 199 | 3300005718 | Ga0068866_10288864 | Ga0068866_102888642 | 94 |
| 200 | 3300005844 | Ga0068862_100164107 | Ga0068862_1001641072 | 94 |
| 201 | 3300006051 | Ga0075364_11240125 | Ga0075364_112401252 | 94 |
| 202 | 3300006163 | Ga0070715_10314346 | Ga0070715_103143462 | 94 |
| 203 | 3300006173 | Ga0070716_100012415 | Ga0070716_1000124152 | 94 |
| 204 | 3300006173 | Ga0070716_100064626 | Ga0070716_1000646262 | 94 |
| 205 | 3300006844 | Ga0075428_100795252 | Ga0075428_1007952522 | 94 |
| 206 | 3300007076 | Ga0075435_101109574 | Ga0075435_1011095741 | 94 |
| 207 | 3300009036 | Ga0105244_10379942 | Ga0105244_103799422 | 94 |
| 208 | 3300009093 | Ga0105240_10489928 | Ga0105240_104899282 | 94 |
| 209 | 3300009101 | Ga0105247_10845313 | Ga0105247_108453131 | 94 |
| 210 | 3300009148 | Ga0105243_10380862 | Ga0105243_103808622 | 94 |
| 211 | 3300009176 | Ga0105242_10068348 | Ga0105242_100683485 | 94 |
| 212 | 3300009553 | Ga0105249_10692959 | Ga0105249_106929593 | 94 |
| 213 | 3300013306 | Ga0163162_11136078 | Ga0163162_111360782 | 94 |
| 214 | 3300014745 | Ga0157377_10016803 | Ga0157377_100168035 | 94 |
| 215 | 3300014969 | Ga0157376_12811505 | Ga0157376_128115051 | 94 |
| 216 | 3300025906 | Ga0207699_10404936 | Ga0207699_104049361 | 94 |
| 217 | 3300025915 | Ga0207693_10003428 | Ga0207693_1000342816 | 94 |
| 218 | 3300025916 | Ga0207663_10089591 | Ga0207663_100895913 | 94 |
| 219 | 3300025921 | Ga0207652_10616296 | Ga0207652_106162962 | 94 |
| 220 | 3300025922 | Ga0207646_10237298 | Ga0207646_102372984 | 94 |
| 221 | 3300025939 | Ga0207665_10021600 | Ga0207665_100216004 | 94 |
| 222 | 3300025939 | Ga0207665_10037509 | Ga0207665_100375092 | 94 |
| 223 | 3300025942 | Ga0207689_10090728 | Ga0207689_100907282 | 94 |
| 224 | 3300028380 | Ga0268265_10737994 | Ga0268265_107379941 | 94 |
| 225 | 3300031852 | Ga0307410_11896756 | Ga0307410_118967561 | 94 |
| 226 | 3300031911 | Ga0307412_11468317 | Ga0307412_114683171 | 94 |
| 227 | 3300031995 | Ga0307409_100210954 | Ga0307409_1002109543 | 94 |
| 228 | 3300032002 | Ga0307416_100823691 | Ga0307416_1008236912 | 94 |
| 229 | 3300038443 | Ga0395901_0050390 | Ga0395901_0050390_1809_2117 | 94 |
| 230 | 3300038443 | Ga0395901_0081441 | Ga0395901_0081441_1050_1358 | 94 |
| 231 | 3300038443 | Ga0395901_1248963 | Ga0395901_1248963_10_318 | 94 |
| 232 | 3300041443 | Ga0451789_1030471 | Ga0451789_1030471_95_403 | 94 |
| 233 | 3300041452 | Ga0451793_0054843 | Ga0451793_0054843_665_973 | 94 |
| 234 | 3300041458 | Ga0451798_0163159 | Ga0451798_0163159_98_406 | 94 |
| 235 | 3300041459 | Ga0451800_0727387 | Ga0451800_0727387_1477_1785 | 94 |
| 236 | 3300041460 | Ga0451802_0324980 | Ga0451802_0324980_565_873 | 94 |
| 237 | 3300041486 | Ga0451807_0005119 | Ga0451807_0005119_322_630 | 94 |
| 238 | 3300041491 | Ga0451833_1295374 | Ga0451833_1295374_123_431 | 94 |
| 239 | 3300041492 | Ga0451835_0127843 | Ga0451835_0127843_257_565 | 94 |
| 240 | 3300041501 | Ga0451845_0472794 | Ga0451845_0472794_2858_3166 | 94 |
| 241 | 3300041503 | Ga0451847_0504058 | Ga0451847_0504058_1134_1442 | 94 |
| 242 | 3300041507 | Ga0451851_1149583 | Ga0451851_1149583_110_418 | 94 |
| 243 | 3300041509 | Ga0451843_0079376 | Ga0451843_0079376_271_579 | 94 |
| 244 | 3300041511 | Ga0451855_1792993 | Ga0451855_1792993_568_876 | 94 |
| 245 | 3300041512 | Ga0451853_2291318 | Ga0451853_2291318_704_1012 | 94 |
| 246 | 3300044683 | Ga0466965_0497582 | Ga0466965_0497582_353_661 | 94 |
| 247 | 3300044706 | Ga0466964_0000569 | Ga0466964_0000569_4938_5246 | 94 |
| 248 | 3300044735 | Ga0466968_0050510 | Ga0466968_0050510_211_519 | 94 |
| 249 | 3300044735 | Ga0466968_0080712 | Ga0466968_0080712_951_1247 | 94 |
| 250 | 3300044901 | Ga0466960_0015647 | Ga0466960_0015647_1226_1534 | 94 |
| 251 | 3300044901 | Ga0466960_0123750 | Ga0466960_0123750_372_668 | 94 |
| 252 | 3300044901 | Ga0466960_0323204 | Ga0466960_0323204_200_508 | 94 |
| 253 | 3300045976 | Ga0466967_0057653 | Ga0466967_0057653_2105_2413 | 94 |
| 254 | 3300048912 | Ga0496109_0029226 | Ga0496109_0029226_289_597 | 94 |
| 255 | 3300048913 | Ga0496110_0081594 | Ga0496110_0081594_1745_2053 | 94 |
| 256 | 3300048913 | Ga0496110_0104217 | Ga0496110_0104217_239_547 | 94 |
| 257 | 3300048914 | Ga0496111_0539508 | Ga0496111_0539508_277_585 | 94 |
| 258 | 3300048915 | Ga0496112_0600292 | Ga0496112_0600292_183_494 | 94 |
| 259 | 3300048916 | Ga0496113_0131667 | Ga0496113_0131667_597_905 | 94 |
| 260 | 3300050513 | nmdc:mga0rr50_1023321_c1 | nmdc:mga0rr50_1023321_c1_348_659 | 94 |
| 261 | 3300005327 | Ga0070658_10178148 | Ga0070658_101781484 | 95 |
| 262 | 3300005327 | Ga0070658_10350818 | Ga0070658_103508183 | 95 |
| 263 | 3300005329 | Ga0070683_100052937 | Ga0070683_1000529375 | 95 |
| 264 | 3300005329 | Ga0070683_100227585 | Ga0070683_1002275852 | 95 |
| 265 | 3300005329 | Ga0070683_100233741 | Ga0070683_1002337412 | 95 |
| 266 | 3300005336 | Ga0070680_100074712 | Ga0070680_1000747123 | 95 |
| 267 | 3300005337 | Ga0070682_100609203 | Ga0070682_1006092032 | 95 |
| 268 | 3300005339 | Ga0070660_100058319 | Ga0070660_1000583194 | 95 |
| 269 | 3300005339 | Ga0070660_100068686 | Ga0070660_1000686861 | 95 |
| 270 | 3300005339 | Ga0070660_100715462 | Ga0070660_1007154622 | 95 |
| 271 | 3300005344 | Ga0070661_100095886 | Ga0070661_1000958863 | 95 |
| 272 | 3300005347 | Ga0070668_100581156 | Ga0070668_1005811561 | 95 |
| 273 | 3300005366 | Ga0070659_100050426 | Ga0070659_1000504262 | 95 |
| 274 | 3300005366 | Ga0070659_101137690 | Ga0070659_1011376902 | 95 |
| 275 | 3300005406 | Ga0070703_10040055 | Ga0070703_100400553 | 95 |
| 276 | 3300005434 | Ga0070709_10004518 | Ga0070709_100045184 | 95 |
| 277 | 3300005434 | Ga0070709_10768712 | Ga0070709_107687122 | 95 |
| 278 | 3300005435 | Ga0070714_100007151 | Ga0070714_1000071516 | 95 |
| 279 | 3300005435 | Ga0070714_100853970 | Ga0070714_1008539702 | 95 |
| 280 | 3300005436 | Ga0070713_100015415 | Ga0070713_1000154158 | 95 |
| 281 | 3300005437 | Ga0070710_10000589 | Ga0070710_1000058911 | 95 |
| 282 | 3300005438 | Ga0070701_10930879 | Ga0070701_109308792 | 95 |
| 283 | 3300005439 | Ga0070711_100028555 | Ga0070711_1000285552 | 95 |
| 284 | 3300005439 | Ga0070711_101220837 | Ga0070711_1012208371 | 95 |
| 285 | 3300005444 | Ga0070694_100270560 | Ga0070694_1002705603 | 95 |
| 286 | 3300005457 | Ga0070662_100839828 | Ga0070662_1008398282 | 95 |
| 287 | 3300005458 | Ga0070681_10129514 | Ga0070681_101295143 | 95 |
| 288 | 3300005458 | Ga0070681_10187444 | Ga0070681_101874444 | 95 |
| 289 | 3300005458 | Ga0070681_10423841 | Ga0070681_104238412 | 95 |
| 290 | 3300005468 | Ga0070707_100545290 | Ga0070707_1005452902 | 95 |
| 291 | 3300005471 | Ga0070698_100090673 | Ga0070698_1000906735 | 95 |
| 292 | 3300005530 | Ga0070679_100129725 | Ga0070679_1001297252 | 95 |
| 293 | 3300005530 | Ga0070679_100155438 | Ga0070679_1001554384 | 95 |
| 294 | 3300005530 | Ga0070679_101654708 | Ga0070679_1016547081 | 95 |
| 295 | 3300005530 | Ga0070679_101864244 | Ga0070679_1018642442 | 95 |
| 296 | 3300005535 | Ga0070684_100060928 | Ga0070684_1000609281 | 95 |
| 297 | 3300005535 | Ga0070684_102327906 | Ga0070684_1023279061 | 95 |
| 298 | 3300005539 | Ga0068853_100082856 | Ga0068853_1000828564 | 95 |
| 299 | 3300005545 | Ga0070695_100005103 | Ga0070695_1000051032 | 95 |
| 300 | 3300005545 | Ga0070695_100469237 | Ga0070695_1004692372 | 95 |
| 301 | 3300005545 | Ga0070695_100547191 | Ga0070695_1005471912 | 95 |
| 302 | 3300005545 | Ga0070695_100884073 | Ga0070695_1008840732 | 95 |
| 303 | 3300005546 | Ga0070696_101157581 | Ga0070696_1011575811 | 95 |
| 304 | 3300005548 | Ga0070665_101034891 | Ga0070665_1010348912 | 95 |
| 305 | 3300005563 | Ga0068855_100853581 | Ga0068855_1008535812 | 95 |
| 306 | 3300005563 | Ga0068855_101054284 | Ga0068855_1010542842 | 95 |
| 307 | 3300005577 | Ga0068857_100453705 | Ga0068857_1004537052 | 95 |
| 308 | 3300005578 | Ga0068854_100818477 | Ga0068854_1008184772 | 95 |
| 309 | 3300005614 | Ga0068856_100226049 | Ga0068856_1002260495 | 95 |
| 310 | 3300005615 | Ga0070702_100643351 | Ga0070702_1006433512 | 95 |
| 311 | 3300006028 | Ga0070717_10007774 | Ga0070717_100077745 | 95 |
| 312 | 3300006038 | Ga0075365_10234004 | Ga0075365_102340043 | 95 |
| 313 | 3300006163 | Ga0070715_10001156 | Ga0070715_100011566 | 95 |
| 314 | 3300006173 | Ga0070716_100001585 | Ga0070716_1000015857 | 95 |
| 315 | 3300006173 | Ga0070716_100264823 | Ga0070716_1002648233 | 95 |
| 316 | 3300006175 | Ga0070712_100217663 | Ga0070712_1002176633 | 95 |
| 317 | 3300006175 | Ga0070712_100291581 | Ga0070712_1002915813 | 95 |
| 318 | 3300006844 | Ga0075428_100304727 | Ga0075428_1003047272 | 95 |
| 319 | 3300006846 | Ga0075430_101294065 | Ga0075430_1012940652 | 95 |
| 320 | 3300006847 | Ga0075431_100056395 | Ga0075431_1000563956 | 95 |
| 321 | 3300006880 | Ga0075429_100214881 | Ga0075429_1002148814 | 95 |
| 322 | 3300007076 | Ga0075435_100451135 | Ga0075435_1004511352 | 95 |
| 323 | 3300009093 | Ga0105240_10005428 | Ga0105240_1000542820 | 95 |
| 324 | 3300009093 | Ga0105240_10353266 | Ga0105240_103532663 | 95 |
| 325 | 3300009098 | Ga0105245_10452199 | Ga0105245_104521992 | 95 |
| 326 | 3300009101 | Ga0105247_10066675 | Ga0105247_100666752 | 95 |
| 327 | 3300009174 | Ga0105241_10406015 | Ga0105241_104060152 | 95 |
| 328 | 3300009174 | Ga0105241_10829731 | Ga0105241_108297312 | 95 |
| 329 | 3300009545 | Ga0105237_10199936 | Ga0105237_101999362 | 95 |
| 330 | 3300009545 | Ga0105237_11565920 | Ga0105237_115659202 | 95 |
| 331 | 3300009551 | Ga0105238_10694426 | Ga0105238_106944262 | 95 |
| 332 | 3300009551 | Ga0105238_10926295 | Ga0105238_109262951 | 95 |
| 333 | 3300009551 | Ga0105238_11639883 | Ga0105238_116398832 | 95 |
| 334 | 3300009553 | Ga0105249_10364461 | Ga0105249_103644612 | 95 |
| 335 | 3300010375 | Ga0105239_11194805 | Ga0105239_111948052 | 95 |
| 336 | 3300012477 | Ga0157336_1030578 | Ga0157336_10305782 | 95 |
| 337 | 3300012502 | Ga0157347_1018474 | Ga0157347_10184742 | 95 |
| 338 | 3300012507 | Ga0157342_1004103 | Ga0157342_10041033 | 95 |
| 339 | 3300012508 | Ga0157315_1033304 | Ga0157315_10333042 | 95 |
| 340 | 3300013100 | Ga0157373_10125746 | Ga0157373_101257462 | 95 |
| 341 | 3300013100 | Ga0157373_11087048 | Ga0157373_110870482 | 95 |
| 342 | 3300013102 | Ga0157371_10800473 | Ga0157371_108004731 | 95 |
| 343 | 3300013104 | Ga0157370_10106645 | Ga0157370_101066453 | 95 |
| 344 | 3300013104 | Ga0157370_11440772 | Ga0157370_114407721 | 95 |
| 345 | 3300013105 | Ga0157369_10004504 | Ga0157369_100045049 | 95 |
| 346 | 3300013105 | Ga0157369_10795413 | Ga0157369_107954132 | 95 |
| 347 | 3300013105 | Ga0157369_10929054 | Ga0157369_109290542 | 95 |
| 348 | 3300013296 | Ga0157374_10028824 | Ga0157374_100288244 | 95 |
| 349 | 3300013296 | Ga0157374_12752988 | Ga0157374_127529882 | 95 |
| 350 | 3300013297 | Ga0157378_10242882 | Ga0157378_102428824 | 95 |
| 351 | 3300013307 | Ga0157372_10005876 | Ga0157372_100058762 | 95 |
| 352 | 3300013307 | Ga0157372_10231243 | Ga0157372_102312434 | 95 |
| 353 | 3300013307 | Ga0157372_10449293 | Ga0157372_104492934 | 95 |
| 354 | 3300013308 | Ga0157375_13652185 | Ga0157375_136521852 | 95 |
| 355 | 3300020070 | Ga0206356_10104702 | Ga0206356_101047022 | 95 |
| 356 | 3300020070 | Ga0206356_11143110 | Ga0206356_111431102 | 95 |
| 357 | 3300020080 | Ga0206350_11195411 | Ga0206350_111954112 | 95 |
| 358 | 3300020082 | Ga0206353_12031984 | Ga0206353_120319842 | 95 |
| 359 | 3300025885 | Ga0207653_10023404 | Ga0207653_100234042 | 95 |
| 360 | 3300025898 | Ga0207692_10001763 | Ga0207692_1000176312 | 95 |
| 361 | 3300025900 | Ga0207710_10064183 | Ga0207710_100641832 | 95 |
| 362 | 3300025904 | Ga0207647_10439742 | Ga0207647_104397422 | 95 |
| 363 | 3300025905 | Ga0207685_10043445 | Ga0207685_100434452 | 95 |
| 364 | 3300025906 | Ga0207699_10001650 | Ga0207699_100016504 | 95 |
| 365 | 3300025906 | Ga0207699_10715289 | Ga0207699_107152892 | 95 |
| 366 | 3300025909 | Ga0207705_10132721 | Ga0207705_101327213 | 95 |
| 367 | 3300025909 | Ga0207705_10230751 | Ga0207705_102307512 | 95 |
| 368 | 3300025911 | Ga0207654_10635180 | Ga0207654_106351802 | 95 |
| 369 | 3300025912 | Ga0207707_10028393 | Ga0207707_100283934 | 95 |
| 370 | 3300025912 | Ga0207707_10164856 | Ga0207707_101648561 | 95 |
| 371 | 3300025912 | Ga0207707_10202488 | Ga0207707_102024884 | 95 |
| 372 | 3300025913 | Ga0207695_10027243 | Ga0207695_100272438 | 95 |
| 373 | 3300025913 | Ga0207695_10285504 | Ga0207695_102855043 | 95 |
| 374 | 3300025914 | Ga0207671_10208212 | Ga0207671_102082123 | 95 |
| 375 | 3300025914 | Ga0207671_10529940 | Ga0207671_105299402 | 95 |
| 376 | 3300025915 | Ga0207693_10000662 | Ga0207693_1000066219 | 95 |
| 377 | 3300025915 | Ga0207693_10160525 | Ga0207693_101605252 | 95 |
| 378 | 3300025916 | Ga0207663_10000565 | Ga0207663_1000056510 | 95 |
| 379 | 3300025917 | Ga0207660_10007442 | Ga0207660_100074426 | 95 |
| 380 | 3300025919 | Ga0207657_10008781 | Ga0207657_1000878113 | 95 |
| 381 | 3300025919 | Ga0207657_10030613 | Ga0207657_100306132 | 95 |
| 382 | 3300025920 | Ga0207649_10061616 | Ga0207649_100616164 | 95 |
| 383 | 3300025921 | Ga0207652_10026188 | Ga0207652_100261883 | 95 |
| 384 | 3300025921 | Ga0207652_10245352 | Ga0207652_102453522 | 95 |
| 385 | 3300025921 | Ga0207652_10527448 | Ga0207652_105274482 | 95 |
| 386 | 3300025921 | Ga0207652_10981926 | Ga0207652_109819262 | 95 |
| 387 | 3300025922 | Ga0207646_10447086 | Ga0207646_104470862 | 95 |
| 388 | 3300025923 | Ga0207681_10237627 | Ga0207681_102376273 | 95 |
| 389 | 3300025924 | Ga0207694_11212971 | Ga0207694_112129712 | 95 |
| 390 | 3300025928 | Ga0207700_10003047 | Ga0207700_100030471 | 95 |
| 391 | 3300025929 | Ga0207664_10005373 | Ga0207664_100053739 | 95 |
| 392 | 3300025929 | Ga0207664_10932838 | Ga0207664_109328381 | 95 |
| 393 | 3300025929 | Ga0207664_11978587 | Ga0207664_119785872 | 95 |
| 394 | 3300025931 | Ga0207644_10439671 | Ga0207644_104396712 | 95 |
| 395 | 3300025932 | Ga0207690_10126004 | Ga0207690_101260042 | 95 |
| 396 | 3300025932 | Ga0207690_10839535 | Ga0207690_108395352 | 95 |
| 397 | 3300025939 | Ga0207665_10004251 | Ga0207665_100042519 | 95 |
| 398 | 3300025939 | Ga0207665_10103473 | Ga0207665_101034734 | 95 |
| 399 | 3300025944 | Ga0207661_10182124 | Ga0207661_101821242 | 95 |
| 400 | 3300025944 | Ga0207661_10239910 | Ga0207661_102399102 | 95 |
| 401 | 3300025949 | Ga0207667_10748535 | Ga0207667_107485352 | 95 |
| 402 | 3300025949 | Ga0207667_10837176 | Ga0207667_108371762 | 95 |
| 403 | 3300025961 | Ga0207712_11137325 | Ga0207712_111373251 | 95 |
| 404 | 3300025972 | Ga0207668_10506129 | Ga0207668_105061292 | 95 |
| 405 | 3300025981 | Ga0207640_10165868 | Ga0207640_101658683 | 95 |
| 406 | 3300025981 | Ga0207640_10462097 | Ga0207640_104620972 | 95 |
| 407 | 3300026041 | Ga0207639_10074732 | Ga0207639_100747323 | 95 |
| 408 | 3300026078 | Ga0207702_11410068 | Ga0207702_114100682 | 95 |
| 409 | 3300026078 | Ga0207702_12455128 | Ga0207702_124551282 | 95 |
| 410 | 3300026116 | Ga0207674_10355621 | Ga0207674_103556212 | 95 |
| 411 | 3300032002 | Ga0307416_100058943 | Ga0307416_1000589434 | 95 |
| 412 | 3300032004 | Ga0307414_10191602 | Ga0307414_101916022 | 95 |
| 413 | 3300032126 | Ga0307415_100126724 | Ga0307415_1001267242 | 95 |
| 414 | 3300035112 | Ga0373932_0289320 | Ga0373932_0289320_20_352 | 95 |
| 415 | 3300035119 | Ga0373956_0047863 | Ga0373956_0047863_1160_1471 | 95 |
| 416 | 3300035172 | Ga0373955_0064179 | Ga0373955_0064179_1011_1322 | 95 |
| 417 | 3300035691 | Ga0373931_0236119 | Ga0373931_0236119_484_816 | 95 |
| 418 | 3300035724 | Ga0373933_0180915 | Ga0373933_0180915_184_495 | 95 |
| 419 | 3300036401 | Ga0373937_0027346 | Ga0373937_0027346_4419_4730 | 95 |
| 420 | 3300037312 | Ga0395899_0226207 | Ga0395899_0226207_966_1268 | 95 |
| 421 | 3300037312 | Ga0395899_0252968 | Ga0395899_0252968_603_917 | 95 |
| 422 | 3300037418 | Ga0395900_0767413 | Ga0395900_0767413_324_635 | 95 |
| 423 | 3300037418 | Ga0395900_1106369 | Ga0395900_1106369_13_300 | 95 |
| 424 | 3300037418 | Ga0395900_1623351 | Ga0395900_1623351_236_538 | 95 |
| 425 | 3300037466 | Ga0395898_0790495 | Ga0395898_0790495_11_325 | 95 |
| 426 | 3300037466 | Ga0395898_1453204 | Ga0395898_1453204_16_318 | 95 |
| 427 | 3300037471 | Ga0395905_0759092 | Ga0395905_0759092_177_491 | 95 |
| 428 | 3300038443 | Ga0395901_0052105 | Ga0395901_0052105_3497_3799 | 95 |
| 429 | 3300038443 | Ga0395901_0080644 | Ga0395901_0080644_1346_1660 | 95 |
| 430 | 3300038443 | Ga0395901_1487518 | Ga0395901_1487518_287_601 | 95 |
| 431 | 3300038443 | Ga0395901_1629349 | Ga0395901_1629349_49_360 | 95 |
| 432 | 3300039438 | Ga0436360_0702089 | Ga0436360_0702089_253_564 | 95 |
| 433 | 3300041486 | Ga0451807_0802826 | Ga0451807_0802826_208_510 | 95 |
| 434 | 3300042122 | Ga0450920_012612 | Ga0450920_012612_606_920 | 95 |
| 435 | 3300044694 | Ga0466963_0017814 | Ga0466963_0017814_3116_3427 | 95 |
| 436 | 3300044694 | Ga0466963_0018348 | Ga0466963_0018348_401_712 | 95 |
| 437 | 3300044694 | Ga0466963_0308437 | Ga0466963_0308437_642_974 | 95 |
| 438 | 3300044706 | Ga0466964_0009904 | Ga0466964_0009904_244_555 | 95 |
| 439 | 3300044706 | Ga0466964_0017873 | Ga0466964_0017873_1809_2120 | 95 |
| 440 | 3300044706 | Ga0466964_0165428 | Ga0466964_0165428_228_539 | 95 |
| 441 | 3300044706 | Ga0466964_0632341 | Ga0466964_0632341_130_441 | 95 |
| 442 | 3300044719 | Ga0466971_0251810 | Ga0466971_0251810_291_623 | 95 |
| 443 | 3300044735 | Ga0466968_0124320 | Ga0466968_0124320_616_927 | 95 |
| 444 | 3300044842 | Ga0466957_0027825 | Ga0466957_0027825_1768_2079 | 95 |
| 445 | 3300044842 | Ga0466957_0056601 | Ga0466957_0056601_341_652 | 95 |
| 446 | 3300044842 | Ga0466957_0661254 | Ga0466957_0661254_127_459 | 95 |
| 447 | 3300044901 | Ga0466960_0089970 | Ga0466960_0089970_1034_1336 | 95 |
| 448 | 3300044901 | Ga0466960_0097690 | Ga0466960_0097690_648_959 | 95 |
| 449 | 3300045049 | Ga0466959_0272994 | Ga0466959_0272994_761_1093 | 95 |
| 450 | 3300045836 | Ga0466958_0122597 | Ga0466958_0122597_699_1031 | 95 |
| 451 | 3300045976 | Ga0466967_0032639 | Ga0466967_0032639_1127_1438 | 95 |
| 452 | 3300045976 | Ga0466967_0036019 | Ga0466967_0036019_469_780 | 95 |
| 453 | 3300045976 | Ga0466967_0077440 | Ga0466967_0077440_1766_2077 | 95 |
| 454 | 3300045976 | Ga0466967_0275540 | Ga0466967_0275540_618_929 | 95 |
| 455 | 3300045976 | Ga0466967_0308196 | Ga0466967_0308196_278_589 | 95 |
| 456 | 3300045976 | Ga0466967_0320278 | Ga0466967_0320278_731_1042 | 95 |
| 457 | 3300046454 | Ga0495592_0000100 | Ga0495592_0000100_53637_53948 | 95 |
| 458 | 3300046455 | Ga0495603_0467758 | Ga0495603_0467758_27_317 | 95 |
| 459 | 3300046461 | Ga0495641_0039338 | Ga0495641_0039338_619_921 | 95 |
| 460 | 3300046462 | Ga0495651_0000008 | Ga0495651_0000008_77701_78012 | 95 |
| 461 | 3300046463 | Ga0495653_0000519 | Ga0495653_0000519_12456_12767 | 95 |
| 462 | 3300046475 | Ga0495639_0475811 | Ga0495639_0475811_290_592 | 95 |
| 463 | 3300046477 | Ga0495664_0207275 | Ga0495664_0207275_622_933 | 95 |
| 464 | 3300046511 | Ga0495608_0002853 | Ga0495608_0002853_3938_4249 | 95 |
| 465 | 3300046514 | Ga0495618_0002283 | Ga0495618_0002283_2531_2842 | 95 |
| 466 | 3300046516 | Ga0495628_0001255 | Ga0495628_0001255_11300_11611 | 95 |
| 467 | 3300046526 | Ga0495666_0402406 | Ga0495666_0402406_153_455 | 95 |
| 468 | 3300046529 | Ga0495652_0000888 | Ga0495652_0000888_11300_11611 | 95 |
| 469 | 3300046536 | Ga0495587_0000048 | Ga0495587_0000048_82332_82643 | 95 |
| 470 | 3300046543 | Ga0495645_0000029 | Ga0495645_0000029_30477_30788 | 95 |
| 471 | 3300046559 | Ga0495667_0040139 | Ga0495667_0040139_1533_1844 | 95 |
| 472 | 3300046615 | Ga0495656_0239461 | Ga0495656_0239461_37_339 | 95 |
| 473 | 3300046675 | Ga0495657_0028894 | Ga0495657_0028894_3346_3657 | 95 |
| 474 | 3300046678 | Ga0495599_0012836 | Ga0495599_0012836_2777_3088 | 95 |
| 475 | 3300046679 | Ga0495623_0000093 | Ga0495623_0000093_15228_15539 | 95 |
| 476 | 3300046680 | Ga0495646_0019787 | Ga0495646_0019787_1735_2046 | 95 |
| 477 | 3300046683 | Ga0495658_0021178 | Ga0495658_0021178_1421_1723 | 95 |
| 478 | 3300046683 | Ga0495658_0532841 | Ga0495658_0532841_160_471 | 95 |
| 479 | 3300047317 | Ga0495604_0000111 | Ga0495604_0000111_4460_4771 | 95 |
| 480 | 3300047319 | Ga0495674_0044849 | Ga0495674_0044849_595_906 | 95 |
| 481 | 3300047321 | Ga0495676_0169451 | Ga0495676_0169451_729_1031 | 95 |
| 482 | 3300047322 | Ga0495680_0022218 | Ga0495680_0022218_978_1289 | 95 |
| 483 | 3300047444 | Ga0495675_0000376 | Ga0495675_0000376_15387_15698 | 95 |
| 484 | 3300047673 | Ga0495593_0066709 | Ga0495593_0066709_243_545 | 95 |
| 485 | 3300048088 | Ga0495602_0000141 | Ga0495602_0000141_27951_28262 | 95 |
| 486 | 3300048903 | Ga0496100_0006457 | Ga0496100_0006457_5526_5858 | 95 |
| 487 | 3300048903 | Ga0496100_1261350 | Ga0496100_1261350_117_428 | 95 |
| 488 | 3300048905 | Ga0496102_0016855 | Ga0496102_0016855_5816_6127 | 95 |
| 489 | 3300048905 | Ga0496102_0025463 | Ga0496102_0025463_4401_4733 | 95 |
| 490 | 3300048906 | Ga0496103_0274083 | Ga0496103_0274083_737_1069 | 95 |
| 491 | 3300048907 | Ga0496104_0331245 | Ga0496104_0331245_227_559 | 95 |
| 492 | 3300048908 | Ga0496105_0096561 | Ga0496105_0096561_1553_1864 | 95 |
| 493 | 3300048908 | Ga0496105_0334597 | Ga0496105_0334597_65_397 | 95 |
| 494 | 3300048909 | Ga0496106_0008985 | Ga0496106_0008985_5816_6148 | 95 |
| 495 | 3300048910 | Ga0496107_0003633 | Ga0496107_0003633_2314_2646 | 95 |
| 496 | 3300048911 | Ga0496108_0072278 | Ga0496108_0072278_2090_2422 | 95 |
| 497 | 3300048911 | Ga0496108_0280338 | Ga0496108_0280338_446_757 | 95 |
| 498 | 3300048912 | Ga0496109_0145236 | Ga0496109_0145236_333_644 | 95 |
| 499 | 3300048912 | Ga0496109_0147833 | Ga0496109_0147833_556_858 | 95 |
| 500 | 3300048912 | Ga0496109_0691165 | Ga0496109_0691165_90_422 | 95 |
| 501 | 3300048912 | Ga0496109_1023625 | Ga0496109_1023625_200_511 | 95 |
| 502 | 3300048913 | Ga0496110_0019029 | Ga0496110_0019029_5234_5545 | 95 |
| 503 | 3300048913 | Ga0496110_0020550 | Ga0496110_0020550_11_343 | 95 |
| 504 | 3300048913 | Ga0496110_0236360 | Ga0496110_0236360_874_1176 | 95 |
| 505 | 3300048914 | Ga0496111_0006472 | Ga0496111_0006472_6269_6601 | 95 |
| 506 | 3300048914 | Ga0496111_0044912 | Ga0496111_0044912_1885_2187 | 95 |
| 507 | 3300048914 | Ga0496111_0234879 | Ga0496111_0234879_480_791 | 95 |
| 508 | 3300048915 | Ga0496112_0016172 | Ga0496112_0016172_2657_2968 | 95 |
| 509 | 3300048915 | Ga0496112_0020985 | Ga0496112_0020985_1919_2230 | 95 |
| 510 | 3300048915 | Ga0496112_0135570 | Ga0496112_0135570_885_1196 | 95 |
| 511 | 3300048915 | Ga0496112_0482811 | Ga0496112_0482811_536_868 | 95 |
| 512 | 3300048916 | Ga0496113_0195362 | Ga0496113_0195362_1216_1527 | 95 |
| 513 | 3300048916 | Ga0496113_0244608 | Ga0496113_0244608_436_768 | 95 |
| 514 | 3300048916 | Ga0496113_0277480 | Ga0496113_0277480_681_992 | 95 |
| 515 | 3300048916 | Ga0496113_0477973 | Ga0496113_0477973_410_724 | 95 |
| 516 | 3300048916 | Ga0496113_0928609 | Ga0496113_0928609_335_646 | 95 |
| 517 | 3300048917 | Ga0496114_0001144 | Ga0496114_0001144_14131_14463 | 95 |
| 518 | 3300048917 | Ga0496114_0218669 | Ga0496114_0218669_159_470 | 95 |
| 519 | 3300048917 | Ga0496114_1733999 | Ga0496114_1733999_91_402 | 95 |
| 520 | 3300048918 | Ga0496115_0014466 | Ga0496115_0014466_4402_4734 | 95 |
| 521 | 3300049590 | Ga0501074_0331090 | Ga0501074_0331090_694_1005 | 95 |
| 522 | 3300049591 | Ga0501075_1324423 | Ga0501075_1324423_168_479 | 95 |
| 523 | 3300050508 | nmdc:mga09592_174129_c1 | nmdc:mga09592_174129_c1_718_1020 | 95 |
| 524 | 3300050513 | nmdc:mga0rr50_1632811_c1 | nmdc:mga0rr50_1632811_c1_206_508 | 95 |
| 525 | 3300050513 | nmdc:mga0rr50_514800_c1 | nmdc:mga0rr50_514800_c1_465_776 | 95 |
| 526 | 3300050514 | nmdc:mga08x19_220463_c1 | nmdc:mga08x19_220463_c1_554_865 | 95 |
| 527 | 3300050514 | nmdc:mga08x19_507757_c1 | nmdc:mga08x19_507757_c1_239_553 | 95 |
| 528 | 3300053077 | Ga0495601_0000206 | Ga0495601_0000206_28917_29228 | 95 |
| 529 | 3300053085 | Ga0495619_0000291 | Ga0495619_0000291_20790_21101 | 95 |
| 530 | 3300054114 | Ga0501084_0205119 | Ga0501084_0205119_551_862 | 95 |
| 531 | 3300060353 | Ga0501082_0100046 | Ga0501082_0100046_1962_2273 | 95 |
| 532 | 3300004799 | Ga0058863_11769592 | Ga0058863_117695922 | 96 |
| 533 | 3300004800 | Ga0058861_11765624 | Ga0058861_117656242 | 96 |
| 534 | 3300005327 | Ga0070658_10111170 | Ga0070658_101111703 | 96 |
| 535 | 3300005329 | Ga0070683_100007546 | Ga0070683_1000075463 | 96 |
| 536 | 3300005336 | Ga0070680_100058288 | Ga0070680_1000582885 | 96 |
| 537 | 3300005338 | Ga0068868_101568786 | Ga0068868_1015687862 | 96 |
| 538 | 3300005339 | Ga0070660_100033989 | Ga0070660_1000339892 | 96 |
| 539 | 3300005345 | Ga0070692_10151776 | Ga0070692_101517762 | 96 |
| 540 | 3300005366 | Ga0070659_100051045 | Ga0070659_1000510456 | 96 |
| 541 | 3300005458 | Ga0070681_10119501 | Ga0070681_101195013 | 96 |
| 542 | 3300005530 | Ga0070679_100199135 | Ga0070679_1001991355 | 96 |
| 543 | 3300005535 | Ga0070684_100272553 | Ga0070684_1002725533 | 96 |
| 544 | 3300005614 | Ga0068856_100100048 | Ga0068856_1001000485 | 96 |
| 545 | 3300005616 | Ga0068852_100139785 | Ga0068852_1001397855 | 96 |
| 546 | 3300006028 | Ga0070717_10078603 | Ga0070717_100786031 | 96 |
| 547 | 3300006358 | Ga0068871_102284093 | Ga0068871_1022840932 | 96 |
| 548 | 3300009093 | Ga0105240_10202280 | Ga0105240_102022803 | 96 |
| 549 | 3300009098 | Ga0105245_10108887 | Ga0105245_101088873 | 96 |
| 550 | 3300009174 | Ga0105241_10194385 | Ga0105241_101943853 | 96 |
| 551 | 3300009551 | Ga0105238_10569333 | Ga0105238_105693332 | 96 |
| 552 | 3300010375 | Ga0105239_10722649 | Ga0105239_107226492 | 96 |
| 553 | 3300010375 | Ga0105239_11506930 | Ga0105239_115069302 | 96 |
| 554 | 3300013104 | Ga0157370_11223927 | Ga0157370_112239272 | 96 |
| 555 | 3300013105 | Ga0157369_10045245 | Ga0157369_100452453 | 96 |
| 556 | 3300013296 | Ga0157374_10443211 | Ga0157374_104432112 | 96 |
| 557 | 3300013296 | Ga0157374_12533269 | Ga0157374_125332692 | 96 |
| 558 | 3300013307 | Ga0157372_11284598 | Ga0157372_112845982 | 96 |
| 559 | 3300013307 | Ga0157372_12666174 | Ga0157372_126661741 | 96 |
| 560 | 3300015262 | Ga0182007_10234934 | Ga0182007_102349342 | 96 |
| 561 | 3300015265 | Ga0182005_1159325 | Ga0182005_11593252 | 96 |
| 562 | 3300020076 | Ga0206355_1489610 | Ga0206355_14896101 | 96 |
| 563 | 3300022467 | Ga0224712_10088868 | Ga0224712_100888682 | 96 |
| 564 | 3300025909 | Ga0207705_10072044 | Ga0207705_100720443 | 96 |
| 565 | 3300025911 | Ga0207654_11054477 | Ga0207654_110544772 | 96 |
| 566 | 3300025913 | Ga0207695_10216720 | Ga0207695_102167202 | 96 |
| 567 | 3300025915 | Ga0207693_10303774 | Ga0207693_103037743 | 96 |
| 568 | 3300025917 | Ga0207660_10329720 | Ga0207660_103297203 | 96 |
| 569 | 3300025917 | Ga0207660_10376828 | Ga0207660_103768281 | 96 |
| 570 | 3300025919 | Ga0207657_10000739 | Ga0207657_1000073923 | 96 |
| 571 | 3300025920 | Ga0207649_10309022 | Ga0207649_103090223 | 96 |
| 572 | 3300025924 | Ga0207694_10405147 | Ga0207694_104051472 | 96 |
| 573 | 3300025927 | Ga0207687_10199875 | Ga0207687_101998753 | 96 |
| 574 | 3300025932 | Ga0207690_10378339 | Ga0207690_103783392 | 96 |
| 575 | 3300025944 | Ga0207661_10136284 | Ga0207661_101362843 | 96 |
| 576 | 3300025949 | Ga0207667_10247904 | Ga0207667_102479042 | 96 |
| 577 | 3300026142 | Ga0207698_10275566 | Ga0207698_102755662 | 96 |
| 578 | 3300037466 | Ga0395898_0380652 | Ga0395898_0380652_637_951 | 96 |
| 579 | 3300044694 | Ga0466963_0045020 | Ga0466963_0045020_908_1222 | 96 |
| 580 | 3300046454 | Ga0495592_0024391 | Ga0495592_0024391_1440_1754 | 96 |
| 581 | 3300046463 | Ga0495653_0250241 | Ga0495653_0250241_138_452 | 96 |
| 582 | 3300046511 | Ga0495608_0118129 | Ga0495608_0118129_1282_1596 | 96 |
| 583 | 3300046516 | Ga0495628_0084698 | Ga0495628_0084698_1559_1873 | 96 |
| 584 | 3300046529 | Ga0495652_0027787 | Ga0495652_0027787_2259_2573 | 96 |
| 585 | 3300046663 | Ga0495635_0530057 | Ga0495635_0530057_216_530 | 96 |
| 586 | 3300047322 | Ga0495680_0337532 | Ga0495680_0337532_558_872 | 96 |
| 587 | 3300047444 | Ga0495675_0439832 | Ga0495675_0439832_315_629 | 96 |
| 588 | 3300048088 | Ga0495602_0006548 | Ga0495602_0006548_2699_3013 | 96 |
| 589 | 3300048904 | Ga0496101_0125801 | Ga0496101_0125801_777_1091 | 96 |
| 590 | 3300048905 | Ga0496102_1305846 | Ga0496102_1305846_165_479 | 96 |
| 591 | 3300048908 | Ga0496105_0103454 | Ga0496105_0103454_254_568 | 96 |
| 592 | 3300048910 | Ga0496107_0270588 | Ga0496107_0270588_748_1062 | 96 |
| 593 | 3300048911 | Ga0496108_0107672 | Ga0496108_0107672_300_614 | 96 |
| 594 | 3300048911 | Ga0496108_0471573 | Ga0496108_0471573_477_794 | 96 |
| 595 | 3300048912 | Ga0496109_0136237 | Ga0496109_0136237_602_916 | 96 |
| 596 | 3300048913 | Ga0496110_0217112 | Ga0496110_0217112_753_1070 | 96 |
| 597 | 3300048913 | Ga0496110_0432449 | Ga0496110_0432449_205_519 | 96 |
| 598 | 3300048914 | Ga0496111_0183365 | Ga0496111_0183365_40_354 | 96 |
| 599 | 3300048914 | Ga0496111_0257755 | Ga0496111_0257755_251_568 | 96 |
| 600 | 3300048916 | Ga0496113_0056786 | Ga0496113_0056786_1959_2273 | 96 |
| 601 | 3300048918 | Ga0496115_0696675 | Ga0496115_0696675_438_752 | 96 |
| 602 | 3300053084 | Ga0495595_0397696 | Ga0495595_0397696_340_654 | 96 |
| 603 | 3300053085 | Ga0495619_1115876 | Ga0495619_1115876_165_479 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar