F468249

General Info

Members Datasets Scaffolds Average Seq Length
603 266 603 102

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101220837|Ga0070711_1012208371
Length 112
Sequence VPRAELAPVWPAIGHSAVPADAIGSIETFITVFVSVYVLLIFAFILSSWVKLPYSPWLNRIQRFLYDVCEPYLRLFRRLLPTFGPLDLSPIIAILVLYVVQRVIITVLERLH

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
87 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
181 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
182 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
183 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
190 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 16.58
Rhizosphere 80.93
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11769592 3300004799 Bacteria 847
2 Ga0058861_11765624 3300004800 Bacteria 714
3 Ga0070658_10111170 3300005327 Unclassified 2270
4 Ga0070658_10178148 3300005327 Bacteria 1788
5 Ga0070658_10350818 3300005327 Bacteria 1263
6 Ga0070683_100005463 3300005329 Bacteria 10618
7 Ga0070683_100007546 3300005329 Bacteria 9191
8 Ga0070683_100052937 3300005329 Bacteria 3761
9 Ga0070683_100227585 3300005329 Bacteria 1772
10 Ga0070683_100233741 3300005329 Bacteria 1748
11 Ga0070683_100540625 3300005329 Bacteria 1114
12 Ga0070690_100344418 3300005330 Bacteria 1080
13 Ga0068869_101583370 3300005334 Bacteria 583
14 Ga0070680_100008678 3300005336 Bacteria 7791
15 Ga0070680_100058288 3300005336 Bacteria 3158
16 Ga0070680_100074712 3300005336 Bacteria 2789
17 Ga0070680_101981305 3300005336 Bacteria 505
18 Ga0070682_100010000 3300005337 Bacteria 5373
19 Ga0070682_100609203 3300005337 Bacteria 863
20 Ga0068868_100030281 3300005338 Bacteria 4150
21 Ga0068868_101568786 3300005338 Bacteria 618
22 Ga0070660_100033989 3300005339 Bacteria 3848
23 Ga0070660_100058319 3300005339 Bacteria 2993
24 Ga0070660_100068686 3300005339 Bacteria 2763
25 Ga0070660_100715462 3300005339 Bacteria 840
26 Ga0070687_100462901 3300005343 Bacteria 846
27 Ga0070661_100095886 3300005344 Bacteria 2201
28 Ga0070692_10151776 3300005345 Bacteria 1320
29 Ga0070668_100581156 3300005347 Bacteria 978
30 Ga0070675_101404713 3300005354 Bacteria 644
31 Ga0070671_100452341 3300005355 Unclassified 1102
32 Ga0070659_100050426 3300005366 Bacteria 3272
33 Ga0070659_100051045 3300005366 Bacteria 3251
34 Ga0070659_101137690 3300005366 Bacteria 689
35 Ga0070703_10040055 3300005406 Bacteria 1455
36 Ga0070709_10004518 3300005434 Bacteria 7506
37 Ga0070709_10239470 3300005434 Unclassified 1302
38 Ga0070709_10768712 3300005434 Bacteria 754
39 Ga0070714_100007151 3300005435 Bacteria 8659
40 Ga0070714_100135410 3300005435 Unclassified 2205
41 Ga0070714_100853970 3300005435 Bacteria 883
42 Ga0070713_100015415 3300005436 Bacteria 5713
43 Ga0070713_100051791 3300005436 Bacteria 3397
44 Ga0070713_100662047 3300005436 Bacteria 995
45 Ga0070710_10000589 3300005437 Bacteria 17269
46 Ga0070710_10060757 3300005437 Bacteria 2150
47 Ga0070710_11152706 3300005437 Unclassified 571
48 Ga0070701_10244375 3300005438 Bacteria 1081
49 Ga0070701_10930879 3300005438 Unclassified 602
50 Ga0070711_100028555 3300005439 Bacteria 3672
51 Ga0070711_100059978 3300005439 Bacteria 2643
52 Ga0070711_101220837 3300005439 Bacteria 651
53 Ga0070705_101248109 3300005440 Bacteria 614
54 Ga0070694_100270560 3300005444 Bacteria 1292
55 Ga0070694_100396904 3300005444 Bacteria 1079
56 Ga0070708_100013462 3300005445 Bacteria 6700
57 Ga0070708_101295738 3300005445 Bacteria 681
58 Ga0070708_101315748 3300005445 Bacteria 675
59 Ga0070708_101438205 3300005445 Bacteria 643
60 Ga0070708_101625479 3300005445 Bacteria 601
61 Ga0070708_101781307 3300005445 Unclassified 572
62 Ga0070708_101849518 3300005445 Bacteria 560
63 Ga0070678_100003222 3300005456 Bacteria 9060
64 Ga0070678_100568595 3300005456 Bacteria 1008
65 Ga0070662_100509875 3300005457 Bacteria 1004
66 Ga0070662_100839828 3300005457 Bacteria 782
67 Ga0070681_10005979 3300005458 Bacteria 11789
68 Ga0070681_10119501 3300005458 Bacteria 2571
69 Ga0070681_10129514 3300005458 Bacteria 2455
70 Ga0070681_10187444 3300005458 Bacteria 1989
71 Ga0070681_10423841 3300005458 Bacteria 1243
72 Ga0068867_102318508 3300005459 Unclassified 510
73 Ga0070707_100110992 3300005468 Unclassified 2659
74 Ga0070707_100545290 3300005468 Bacteria 1122
75 Ga0070707_100832738 3300005468 Bacteria 887
76 Ga0070707_101336484 3300005468 Bacteria 683
77 Ga0070698_100053629 3300005471 Bacteria 4097
78 Ga0070698_100090673 3300005471 Bacteria 3040
79 Ga0070698_100874622 3300005471 Bacteria 844
80 Ga0070698_100874689 3300005471 Bacteria 844
81 Ga0070699_100061914 3300005518 Bacteria 3242
82 Ga0070679_100019233 3300005530 Bacteria 6637
83 Ga0070679_100129725 3300005530 Unclassified 2502
84 Ga0070679_100155438 3300005530 Bacteria 2262
85 Ga0070679_100199135 3300005530 Bacteria 1969
86 Ga0070679_100350122 3300005530 Bacteria 1425
87 Ga0070679_101654708 3300005530 Unclassified 588
88 Ga0070679_101864244 3300005530 Unclassified 550
89 Ga0070684_100017138 3300005535 Bacteria 5937
90 Ga0070684_100060928 3300005535 Bacteria 3302
91 Ga0070684_100196926 3300005535 Bacteria 1835
92 Ga0070684_100272553 3300005535 Bacteria 1549
93 Ga0070684_101483218 3300005535 Bacteria 639
94 Ga0070684_102327906 3300005535 Unclassified 505
95 Ga0070697_100055952 3300005536 Bacteria 3208
96 Ga0070697_100180694 3300005536 Unclassified 1788
97 Ga0070697_100756691 3300005536 Bacteria 859
98 Ga0068853_100082856 3300005539 Bacteria 2810
99 Ga0070695_100005103 3300005545 Bacteria 7737
100 Ga0070695_100469237 3300005545 Bacteria 968
101 Ga0070695_100547191 3300005545 Bacteria 902
102 Ga0070695_100884073 3300005545 Bacteria 721
103 Ga0070696_101157581 3300005546 Bacteria 652
104 Ga0070665_101034891 3300005548 Unclassified 833
105 Ga0070704_100171840 3300005549 Bacteria 1725
106 Ga0070704_101265409 3300005549 Bacteria 674
107 Ga0070704_101844844 3300005549 Bacteria 560
108 Ga0068855_100853581 3300005563 Bacteria 965
109 Ga0068855_101054284 3300005563 Bacteria 852
110 Ga0070664_100046670 3300005564 Bacteria 3659
111 Ga0070664_100914430 3300005564 Bacteria 823
112 Ga0068857_100453705 3300005577 Bacteria 1199
113 Ga0068854_100087354 3300005578 Bacteria 2313
114 Ga0068854_100818477 3300005578 Bacteria 813
115 Ga0068856_100035013 3300005614 Bacteria 4920
116 Ga0068856_100100048 3300005614 Bacteria 2891
117 Ga0068856_100226049 3300005614 Unclassified 1887
118 Ga0070702_100043548 3300005615 Bacteria 2530
119 Ga0070702_100643351 3300005615 Bacteria 801
120 Ga0068852_100139785 3300005616 Bacteria 2240
121 Ga0068852_101594212 3300005616 Bacteria 675
122 Ga0068852_101804820 3300005616 Bacteria 634
123 Ga0068859_101320526 3300005617 Bacteria 795
124 Ga0068866_10288864 3300005718 Bacteria 1019
125 Ga0068862_100164107 3300005844 Bacteria 1985
126 Ga0068862_100663743 3300005844 Bacteria 1007
127 Ga0081455_10021153 3300005937 Bacteria 6109
128 Ga0070717_10007774 3300006028 Bacteria 7980
129 Ga0070717_10078603 3300006028 Bacteria 2765
130 Ga0075365_10234004 3300006038 Bacteria 1290
131 Ga0075365_10327086 3300006038 Bacteria 1080
132 Ga0075364_11240125 3300006051 Unclassified 505
133 Ga0070715_10001156 3300006163 Bacteria 7557
134 Ga0070715_10314346 3300006163 Bacteria 843
135 Ga0070716_100001585 3300006173 Bacteria 10228
136 Ga0070716_100012415 3300006173 Bacteria 4318
137 Ga0070716_100064626 3300006173 Bacteria 2128
138 Ga0070716_100264823 3300006173 Bacteria 1178
139 Ga0070712_100217663 3300006175 Bacteria 1510
140 Ga0070712_100291581 3300006175 Bacteria 1317
141 Ga0097621_101624698 3300006237 Bacteria 615
142 Ga0068871_102284093 3300006358 Bacteria 516
143 Ga0075428_100304727 3300006844 Bacteria 1713
144 Ga0075428_100706486 3300006844 Bacteria 1074
145 Ga0075428_100795252 3300006844 Bacteria 1005
146 Ga0075430_101294065 3300006846 Bacteria 600
147 Ga0075431_100056395 3300006847 Bacteria 4052
148 Ga0075433_10385164 3300006852 Bacteria 1238
149 Ga0075429_100214881 3300006880 Bacteria 1685
150 Ga0097620_101320681 3300006931 Bacteria 795
151 Ga0075435_100451135 3300007076 Bacteria 1109
152 Ga0075435_101109574 3300007076 Bacteria 692
153 Ga0105244_10379942 3300009036 Bacteria 650
154 Ga0105240_10005428 3300009093 Bacteria 19003
155 Ga0105240_10202280 3300009093 Bacteria 2327
156 Ga0105240_10353266 3300009093 Bacteria 1667
157 Ga0105240_10489928 3300009093 Unclassified 1369
158 Ga0111539_10315307 3300009094 Bacteria 1820
159 Ga0105245_10002363 3300009098 Bacteria 17055
160 Ga0105245_10108887 3300009098 Bacteria 2574
161 Ga0105245_10322174 3300009098 Bacteria 1523
162 Ga0105245_10452199 3300009098 Bacteria 1293
163 Ga0105245_11755974 3300009098 Bacteria 673
164 Ga0105247_10066675 3300009101 Bacteria 2242
165 Ga0105247_10609179 3300009101 Bacteria 811
166 Ga0105247_10845313 3300009101 Bacteria 702
167 Ga0114129_11610047 3300009147 Bacteria 795
168 Ga0105243_10125864 3300009148 Bacteria 2168
169 Ga0105243_10380862 3300009148 Bacteria 1305
170 Ga0105243_11245589 3300009148 Bacteria 759
171 Ga0105241_10127395 3300009174 Bacteria 2057
172 Ga0105241_10194385 3300009174 Bacteria 1690
173 Ga0105241_10406015 3300009174 Bacteria 1196
174 Ga0105241_10829731 3300009174 Bacteria 853
175 Ga0105242_10068348 3300009176 Bacteria 2939
176 Ga0105242_11755462 3300009176 Bacteria 658
177 Ga0105248_10573398 3300009177 Bacteria 1273
178 Ga0105248_12243991 3300009177 Bacteria 621
179 Ga0105237_10199936 3300009545 Unclassified 1998
180 Ga0105237_11270385 3300009545 Bacteria 743
181 Ga0105237_11420040 3300009545 Bacteria 700
182 Ga0105237_11565920 3300009545 Bacteria 666
183 Ga0105238_10569333 3300009551 Bacteria 1138
184 Ga0105238_10694426 3300009551 Bacteria 1029
185 Ga0105238_10926295 3300009551 Bacteria 890
186 Ga0105238_11639883 3300009551 Unclassified 674
187 Ga0105249_10364461 3300009553 Bacteria 1467
188 Ga0105249_10372811 3300009553 Bacteria 1451
189 Ga0105249_10692959 3300009553 Unclassified 1078
190 Ga0105249_10739350 3300009553 Bacteria 1045
191 Ga0105239_10230714 3300010375 Bacteria 2077
192 Ga0105239_10239215 3300010375 Bacteria 2038
193 Ga0105239_10722649 3300010375 Bacteria 1139
194 Ga0105239_11194805 3300010375 Bacteria 876
195 Ga0105239_11506930 3300010375 Unclassified 777
196 Ga0105239_11686493 3300010375 Bacteria 733
197 Ga0105246_10078552 3300011119 Bacteria 2344
198 Ga0105246_11237062 3300011119 Bacteria 689
199 Ga0157336_1030578 3300012477 Bacteria 537
200 Ga0157347_1018474 3300012502 Bacteria 799
201 Ga0157342_1004103 3300012507 Bacteria 1279
202 Ga0157315_1033304 3300012508 Unclassified 617
203 Ga0157373_10125746 3300013100 Bacteria 1803
204 Ga0157373_11087048 3300013100 Bacteria 600
205 Ga0157371_10800473 3300013102 Bacteria 710
206 Ga0157370_10106645 3300013104 Bacteria 2622
207 Ga0157370_11223927 3300013104 Bacteria 677
208 Ga0157370_11440772 3300013104 Bacteria 620
209 Ga0157369_10004504 3300013105 Bacteria 16412
210 Ga0157369_10045245 3300013105 Bacteria 4788
211 Ga0157369_10795413 3300013105 Bacteria 972
212 Ga0157369_10929054 3300013105 Bacteria 892
213 Ga0157374_10028824 3300013296 Bacteria 5019
214 Ga0157374_10084293 3300013296 Bacteria 3021
215 Ga0157374_10443211 3300013296 Bacteria 1299
216 Ga0157374_10593161 3300013296 Bacteria 1117
217 Ga0157374_12533269 3300013296 Unclassified 540
218 Ga0157374_12752988 3300013296 Bacteria 519
219 Ga0157378_10196376 3300013297 Unclassified 1906
220 Ga0157378_10242882 3300013297 Bacteria 1721
221 Ga0163162_11136078 3300013306 Bacteria 886
222 Ga0157372_10005876 3300013307 Bacteria 13060
223 Ga0157372_10231243 3300013307 Bacteria 2144
224 Ga0157372_10449293 3300013307 Unclassified 1502
225 Ga0157372_11210536 3300013307 Bacteria 873
226 Ga0157372_11284598 3300013307 Bacteria 845
227 Ga0157372_12666174 3300013307 Unclassified 573
228 Ga0157375_10295890 3300013308 Bacteria 1782
229 Ga0157375_12103536 3300013308 Bacteria 672
230 Ga0157375_13652185 3300013308 Unclassified 512
231 Ga0163163_10370328 3300014325 Bacteria 1489
232 Ga0157377_10016803 3300014745 Bacteria 3771
233 Ga0157379_10857926 3300014968 Bacteria 860
234 Ga0157379_11760659 3300014968 Bacteria 608
235 Ga0157376_10306219 3300014969 Bacteria 1506
236 Ga0157376_11419378 3300014969 Unclassified 726
237 Ga0157376_12811505 3300014969 Bacteria 526
238 Ga0182007_10234934 3300015262 Bacteria 652
239 Ga0182005_1159325 3300015265 Unclassified 661
240 Ga0206356_10104702 3300020070 Bacteria 2178
241 Ga0206356_11143110 3300020070 Bacteria 1206
242 Ga0206355_1489610 3300020076 Unclassified 530
243 Ga0206350_11195411 3300020080 Bacteria 672
244 Ga0206353_12031984 3300020082 Bacteria 2897
245 Ga0224712_10088868 3300022467 Bacteria 1290
246 Ga0207653_10023404 3300025885 Bacteria 1967
247 Ga0207692_10001763 3300025898 Bacteria 8214
248 Ga0207710_10064183 3300025900 Bacteria 1672
249 Ga0207647_10439742 3300025904 Bacteria 732
250 Ga0207685_10043445 3300025905 Bacteria 1694
251 Ga0207699_10001650 3300025906 Bacteria 10571
252 Ga0207699_10404936 3300025906 Bacteria 972
253 Ga0207699_10715289 3300025906 Bacteria 734
254 Ga0207705_10072044 3300025909 Unclassified 2506
255 Ga0207705_10132721 3300025909 Bacteria 1854
256 Ga0207705_10230751 3300025909 Bacteria 1408
257 Ga0207654_10152567 3300025911 Bacteria 1484
258 Ga0207654_10635180 3300025911 Bacteria 764
259 Ga0207654_11054477 3300025911 Unclassified 592
260 Ga0207707_10028393 3300025912 Bacteria 4890
261 Ga0207707_10101056 3300025912 Bacteria 2520
262 Ga0207707_10164856 3300025912 Bacteria 1937
263 Ga0207707_10202488 3300025912 Bacteria 1730
264 Ga0207695_10027243 3300025913 Bacteria 6366
265 Ga0207695_10216720 3300025913 Bacteria 1823
266 Ga0207695_10285504 3300025913 Bacteria 1543
267 Ga0207671_10208212 3300025914 Bacteria 1529
268 Ga0207671_10529940 3300025914 Bacteria 939
269 Ga0207693_10000662 3300025915 Bacteria 30935
270 Ga0207693_10003428 3300025915 Bacteria 13527
271 Ga0207693_10160525 3300025915 Bacteria 1768
272 Ga0207693_10303774 3300025915 Bacteria 1250
273 Ga0207663_10000565 3300025916 Bacteria 16340
274 Ga0207663_10089591 3300025916 Bacteria 2037
275 Ga0207660_10007442 3300025917 Bacteria 7086
276 Ga0207660_10047570 3300025917 Bacteria 3033
277 Ga0207660_10329720 3300025917 Bacteria 1220
278 Ga0207660_10376828 3300025917 Bacteria 1140
279 Ga0207657_10000739 3300025919 Bacteria 34678
280 Ga0207657_10008781 3300025919 Bacteria 10227
281 Ga0207657_10030613 3300025919 Bacteria 4883
282 Ga0207649_10061616 3300025920 Bacteria 2362
283 Ga0207649_10309022 3300025920 Bacteria 1158
284 Ga0207649_10745300 3300025920 Bacteria 762
285 Ga0207652_10026188 3300025921 Bacteria 4854
286 Ga0207652_10033577 3300025921 Bacteria 4321
287 Ga0207652_10245352 3300025921 Bacteria 1615
288 Ga0207652_10527448 3300025921 Bacteria 1062
289 Ga0207652_10616296 3300025921 Bacteria 972
290 Ga0207652_10981926 3300025921 Unclassified 743
291 Ga0207646_10237298 3300025922 Bacteria 1647
292 Ga0207646_10447086 3300025922 Bacteria 1166
293 Ga0207681_10237627 3300025923 Bacteria 1417
294 Ga0207694_10405147 3300025924 Bacteria 1134
295 Ga0207694_11212971 3300025924 Bacteria 638
296 Ga0207659_10979185 3300025926 Bacteria 728
297 Ga0207687_10099357 3300025927 Bacteria 2138
298 Ga0207687_10199875 3300025927 Bacteria 1561
299 Ga0207700_10003047 3300025928 Bacteria 9669
300 Ga0207700_10858931 3300025928 Bacteria 812
301 Ga0207664_10005373 3300025929 Bacteria 8754
302 Ga0207664_10932838 3300025929 Bacteria 779
303 Ga0207664_11978587 3300025929 Unclassified 506
304 Ga0207644_10439671 3300025931 Bacteria 1070
305 Ga0207690_10126004 3300025932 Bacteria 1867
306 Ga0207690_10378339 3300025932 Bacteria 1125
307 Ga0207690_10839535 3300025932 Bacteria 760
308 Ga0207709_10078685 3300025935 Bacteria 2117
309 Ga0207665_10004251 3300025939 Bacteria 9518
310 Ga0207665_10021600 3300025939 Bacteria 4234
311 Ga0207665_10037509 3300025939 Bacteria 3226
312 Ga0207665_10103473 3300025939 Bacteria 1992
313 Ga0207691_11009918 3300025940 Unclassified 694
314 Ga0207711_11231276 3300025941 Bacteria 690
315 Ga0207689_10090728 3300025942 Bacteria 2511
316 Ga0207661_10011037 3300025944 Bacteria 6529
317 Ga0207661_10136284 3300025944 Bacteria 2108
318 Ga0207661_10182124 3300025944 Bacteria 1836
319 Ga0207661_10239910 3300025944 Bacteria 1608
320 Ga0207679_10204539 3300025945 Bacteria 1651
321 Ga0207667_10247904 3300025949 Bacteria 1822
322 Ga0207667_10748535 3300025949 Bacteria 977
323 Ga0207667_10837176 3300025949 Bacteria 915
324 Ga0207712_10570757 3300025961 Bacteria 975
325 Ga0207712_11137325 3300025961 Bacteria 696
326 Ga0207712_11334489 3300025961 Bacteria 641
327 Ga0207668_10506129 3300025972 Bacteria 1040
328 Ga0207640_10165868 3300025981 Bacteria 1640
329 Ga0207640_10268344 3300025981 Bacteria 1334
330 Ga0207640_10462097 3300025981 Bacteria 1048
331 Ga0207677_10019958 3300026023 Bacteria 4059
332 Ga0207639_10074732 3300026041 Bacteria 2662
333 Ga0207678_10282327 3300026067 Bacteria 1425
334 Ga0207708_11193053 3300026075 Bacteria 665
335 Ga0207702_10052319 3300026078 Bacteria 3455
336 Ga0207702_11410068 3300026078 Bacteria 690
337 Ga0207702_12455128 3300026078 Bacteria 508
338 Ga0207674_10355621 3300026116 Bacteria 1416
339 Ga0207674_11337600 3300026116 Bacteria 686
340 Ga0207683_10004028 3300026121 Bacteria 12708
341 Ga0207698_10275566 3300026142 Bacteria 1553
342 Ga0207698_11134476 3300026142 Bacteria 795
343 Ga0207428_10453888 3300027907 Unclassified 934
344 Ga0268265_10737994 3300028380 Unclassified 955
345 Ga0268264_11669741 3300028381 Bacteria 647
346 Ga0307410_11896756 3300031852 Unclassified 530
347 Ga0307412_11468317 3300031911 Unclassified 619
348 Ga0307409_100210954 3300031995 Unclassified 1745
349 Ga0307416_100058943 3300032002 Bacteria 3117
350 Ga0307416_100823691 3300032002 Unclassified 1025
351 Ga0307414_10191602 3300032004 Bacteria 1655
352 Ga0307415_100126724 3300032126 Bacteria 1925
353 Ga0373932_0289320 3300035112 Unclassified 608
354 Ga0373956_0047863 3300035119 Bacteria 1914
355 Ga0373955_0064179 3300035172 Bacteria 2035
356 Ga0373931_0236119 3300035691 Bacteria 1106
357 Ga0373933_0180915 3300035724 Bacteria 1345
358 Ga0373937_0027346 3300036401 Bacteria 5157
359 Ga0395899_0145263 3300037312 Bacteria 1685
360 Ga0395899_0226207 3300037312 Bacteria 1294
361 Ga0395899_0252968 3300037312 Bacteria 1208
362 Ga0395900_0017487 3300037418 Bacteria 7318
363 Ga0395900_0604005 3300037418 Bacteria 1037
364 Ga0395900_0767413 3300037418 Bacteria 894
365 Ga0395900_1106369 3300037418 Bacteria 709
366 Ga0395900_1623351 3300037418 Unclassified 558
367 Ga0395898_0036622 3300037466 Bacteria 4872
368 Ga0395898_0114420 3300037466 Bacteria 2585
369 Ga0395898_0236358 3300037466 Bacteria 1743
370 Ga0395898_0380652 3300037466 Bacteria 1346
371 Ga0395898_0790495 3300037466 Bacteria 889
372 Ga0395898_1120078 3300037466 Bacteria 720
373 Ga0395898_1453204 3300037466 Bacteria 612
374 Ga0395905_0197544 3300037471 Bacteria 1886
375 Ga0395905_0265128 3300037471 Bacteria 1603
376 Ga0395905_0280331 3300037471 Bacteria 1553
377 Ga0395905_0759092 3300037471 Bacteria 872
378 Ga0395901_0019608 3300038443 Bacteria 6913
379 Ga0395901_0050390 3300038443 Bacteria 4326
380 Ga0395901_0052105 3300038443 Bacteria 4254
381 Ga0395901_0080644 3300038443 Bacteria 3398
382 Ga0395901_0081441 3300038443 Bacteria 3381
383 Ga0395901_0179442 3300038443 Bacteria 2221
384 Ga0395901_0318956 3300038443 Bacteria 1608
385 Ga0395901_0445038 3300038443 Bacteria 1326
386 Ga0395901_1117854 3300038443 Bacteria 758
387 Ga0395901_1248963 3300038443 Bacteria 707
388 Ga0395901_1487518 3300038443 Bacteria 633
389 Ga0395901_1629349 3300038443 Unclassified 598
390 Ga0436360_0702089 3300039438 Bacteria 1757
391 Ga0451789_1030471 3300041443 Bacteria 1027
392 Ga0451793_0054843 3300041452 Bacteria 1060
393 Ga0451798_0163159 3300041458 Bacteria 931
394 Ga0451800_0727387 3300041459 Bacteria 2279
395 Ga0451802_0324980 3300041460 Bacteria 1420
396 Ga0451807_0005119 3300041486 Bacteria 2215
397 Ga0451807_0802826 3300041486 Bacteria 607
398 Ga0451833_1295374 3300041491 Bacteria 972
399 Ga0451835_0127843 3300041492 Bacteria 734
400 Ga0451845_0472794 3300041501 Bacteria 3690
401 Ga0451847_0504058 3300041503 Bacteria 1474
402 Ga0451851_1149583 3300041507 Unclassified 519
403 Ga0451843_0079376 3300041509 Bacteria 939
404 Ga0451855_1792993 3300041511 Bacteria 980
405 Ga0451853_2291318 3300041512 Bacteria 2788
406 Ga0450920_012612 3300042122 Bacteria 1587
407 Ga0450905_022705 3300042142 Bacteria 933
408 Ga0450916_062945 3300042530 Bacteria 606
409 Ga0466965_0497582 3300044683 Bacteria 683
410 Ga0466963_0002476 3300044694 Bacteria 10328
411 Ga0466963_0017814 3300044694 Bacteria 4432
412 Ga0466963_0018348 3300044694 Bacteria 4373
413 Ga0466963_0045020 3300044694 Bacteria 2905
414 Ga0466963_0308437 3300044694 Bacteria 1113
415 Ga0466964_0000569 3300044706 Bacteria 11600
416 Ga0466964_0009904 3300044706 Bacteria 3592
417 Ga0466964_0017873 3300044706 Unclassified 2716
418 Ga0466964_0165428 3300044706 Bacteria 1037
419 Ga0466964_0632341 3300044706 Unclassified 590
420 Ga0466971_0251810 3300044719 Bacteria 841
421 Ga0466968_0050510 3300044735 Bacteria 1775
422 Ga0466968_0080712 3300044735 Unclassified 1429
423 Ga0466968_0124320 3300044735 Bacteria 1169
424 Ga0466957_0027825 3300044842 Unclassified 3361
425 Ga0466957_0056601 3300044842 Bacteria 2398
426 Ga0466957_0282539 3300044842 Bacteria 1111
427 Ga0466957_0661254 3300044842 Bacteria 735
428 Ga0466960_0015647 3300044901 Bacteria 3275
429 Ga0466960_0089970 3300044901 Bacteria 1563
430 Ga0466960_0097690 3300044901 Bacteria 1507
431 Ga0466960_0123750 3300044901 Bacteria 1357
432 Ga0466960_0323204 3300044901 Bacteria 874
433 Ga0466959_0272994 3300045049 Viruses 1162
434 Ga0451576_2129098 3300045051 Bacteria 577
435 Ga0466958_0122597 3300045836 Bacteria 1628
436 Ga0466967_0032639 3300045976 Bacteria 4398
437 Ga0466967_0036019 3300045976 Bacteria 4220
438 Ga0466967_0057653 3300045976 Bacteria 3429
439 Ga0466967_0077440 3300045976 Bacteria 2993
440 Ga0466967_0194818 3300045976 Bacteria 1917
441 Ga0466967_0208355 3300045976 Bacteria 1853
442 Ga0466967_0275540 3300045976 Bacteria 1613
443 Ga0466967_0308196 3300045976 Unclassified 1524
444 Ga0466967_0320278 3300045976 Bacteria 1495
445 Ga0466967_1613333 3300045976 Unclassified 646
446 Ga0495592_0000100 3300046454 Bacteria 76535
447 Ga0495592_0024391 3300046454 Bacteria 4598
448 Ga0495603_0467758 3300046455 Bacteria 722
449 Ga0495629_0682523 3300046459 Bacteria 683
450 Ga0495641_0039338 3300046461 Bacteria 2206
451 Ga0495651_0000008 3300046462 Bacteria 156989
452 Ga0495653_0000519 3300046463 Bacteria 29635
453 Ga0495653_0250241 3300046463 Bacteria 1176
454 Ga0495639_0475811 3300046475 Unclassified 636
455 Ga0495664_0207275 3300046477 Bacteria 1187
456 Ga0495608_0002853 3300046511 Bacteria 12379
457 Ga0495608_0118129 3300046511 Archaea 1701
458 Ga0495618_0002283 3300046514 Bacteria 12422
459 Ga0495628_0001255 3300046516 Bacteria 23210
460 Ga0495628_0084698 3300046516 Bacteria 2459
461 Ga0495666_0402406 3300046526 Unclassified 615
462 Ga0495652_0000888 3300046529 Bacteria 34393
463 Ga0495652_0027787 3300046529 Bacteria 4983
464 Ga0495587_0000048 3300046536 Bacteria 105358
465 Ga0495645_0000029 3300046543 Bacteria 113119
466 Ga0495667_0040139 3300046559 Bacteria 3109
467 Ga0495656_0239461 3300046615 Unclassified 913
468 Ga0495634_0183632 3300046642 Unclassified 1308
469 Ga0495635_0530057 3300046663 Bacteria 773
470 Ga0495657_0028894 3300046675 Bacteria 3893
471 Ga0495599_0012836 3300046678 Bacteria 5170
472 Ga0495623_0000093 3300046679 Bacteria 53441
473 Ga0495646_0019787 3300046680 Bacteria 4257
474 Ga0495658_0021178 3300046683 Bacteria 3425
475 Ga0495658_0532841 3300046683 Bacteria 752
476 Ga0495604_0000111 3300047317 Bacteria 68576
477 Ga0495674_0044849 3300047319 Bacteria 3929
478 Ga0495676_0169451 3300047321 Bacteria 1538
479 Ga0495680_0022218 3300047322 Bacteria 5293
480 Ga0495680_0337532 3300047322 Bacteria 1052
481 Ga0495675_0000376 3300047444 Bacteria 30923
482 Ga0495675_0439832 3300047444 Unclassified 756
483 Ga0495593_0066709 3300047673 Bacteria 1875
484 Ga0495602_0000141 3300048088 Bacteria 67940
485 Ga0495602_0006548 3300048088 Bacteria 12215
486 Ga0496100_0006457 3300048903 Bacteria 6393
487 Ga0496100_0142904 3300048903 Bacteria 1698
488 Ga0496100_0283283 3300048903 Bacteria 1236
489 Ga0496100_1261350 3300048903 Unclassified 583
490 Ga0496101_0013813 3300048904 Bacteria 5420
491 Ga0496101_0125801 3300048904 Bacteria 1942
492 Ga0496101_0395330 3300048904 Bacteria 1088
493 Ga0496102_0016855 3300048905 Bacteria 6391
494 Ga0496102_0025083 3300048905 Bacteria 5304
495 Ga0496102_0025463 3300048905 Bacteria 5267
496 Ga0496102_0143185 3300048905 Bacteria 2242
497 Ga0496102_1305846 3300048905 Unclassified 645
498 Ga0496103_0274083 3300048906 Unclassified 1085
499 Ga0496103_0312793 3300048906 Bacteria 1010
500 Ga0496104_0001048 3300048907 Bacteria 23633
501 Ga0496104_0047160 3300048907 Bacteria 4060
502 Ga0496104_0331245 3300048907 Bacteria 1435
503 Ga0496104_0542053 3300048907 Bacteria 1074
504 Ga0496105_0000594 3300048908 Bacteria 24087
505 Ga0496105_0096561 3300048908 Bacteria 2441
506 Ga0496105_0103454 3300048908 Bacteria 2352
507 Ga0496105_0162972 3300048908 Bacteria 1830
508 Ga0496105_0334597 3300048908 Bacteria 1211
509 Ga0496105_1163646 3300048908 Unclassified 569
510 Ga0496106_0008985 3300048909 Bacteria 7382
511 Ga0496106_0038127 3300048909 Bacteria 3596
512 Ga0496107_0003633 3300048910 Bacteria 10359
513 Ga0496107_0073243 3300048910 Bacteria 2491
514 Ga0496107_0270588 3300048910 Bacteria 1264
515 Ga0496108_0010409 3300048911 Bacteria 7553
516 Ga0496108_0072278 3300048911 Bacteria 2911
517 Ga0496108_0107672 3300048911 Bacteria 2380
518 Ga0496108_0214817 3300048911 Bacteria 1670
519 Ga0496108_0280338 3300048911 Bacteria 1451
520 Ga0496108_0471573 3300048911 Bacteria 1097
521 Ga0496108_0583121 3300048911 Bacteria 975
522 Ga0496109_0000463 3300048912 Bacteria 34599
523 Ga0496109_0029226 3300048912 Bacteria 4936
524 Ga0496109_0043356 3300048912 Bacteria 4078
525 Ga0496109_0136237 3300048912 Bacteria 2294
526 Ga0496109_0145236 3300048912 Bacteria 2219
527 Ga0496109_0147833 3300048912 Bacteria 2199
528 Ga0496109_0312694 3300048912 Bacteria 1482
529 Ga0496109_0387732 3300048912 Bacteria 1320
530 Ga0496109_0691165 3300048912 Unclassified 957
531 Ga0496109_1023625 3300048912 Unclassified 763
532 Ga0496110_0000563 3300048913 Bacteria 25359
533 Ga0496110_0019029 3300048913 Bacteria 5771
534 Ga0496110_0020550 3300048913 Bacteria 5576
535 Ga0496110_0081594 3300048913 Bacteria 2883
536 Ga0496110_0104217 3300048913 Bacteria 2545
537 Ga0496110_0217112 3300048913 Bacteria 1739
538 Ga0496110_0236360 3300048913 Bacteria 1663
539 Ga0496110_0432449 3300048913 Bacteria 1199
540 Ga0496110_0685637 3300048913 Unclassified 925
541 Ga0496110_1582680 3300048913 Bacteria 565
542 Ga0496111_0006472 3300048914 Bacteria 7609
543 Ga0496111_0010323 3300048914 Bacteria 6261
544 Ga0496111_0037754 3300048914 Bacteria 3458
545 Ga0496111_0044912 3300048914 Bacteria 3177
546 Ga0496111_0183365 3300048914 Unclassified 1556
547 Ga0496111_0186871 3300048914 Bacteria 1540
548 Ga0496111_0234879 3300048914 Bacteria 1362
549 Ga0496111_0257755 3300048914 Bacteria 1294
550 Ga0496111_0539508 3300048914 Bacteria 857
551 Ga0496112_0016172 3300048915 Bacteria 6980
552 Ga0496112_0020985 3300048915 Bacteria 6203
553 Ga0496112_0135570 3300048915 Bacteria 2432
554 Ga0496112_0269566 3300048915 Bacteria 1651
555 Ga0496112_0482811 3300048915 Bacteria 1175
556 Ga0496112_0600292 3300048915 Unclassified 1033
557 Ga0496112_0881047 3300048915 Bacteria 818
558 Ga0496113_0056786 3300048916 Bacteria 2940
559 Ga0496113_0126259 3300048916 Bacteria 2004
560 Ga0496113_0131667 3300048916 Bacteria 1963
561 Ga0496113_0195362 3300048916 Bacteria 1607
562 Ga0496113_0244608 3300048916 Bacteria 1431
563 Ga0496113_0277480 3300048916 Bacteria 1340
564 Ga0496113_0323450 3300048916 Bacteria 1236
565 Ga0496113_0477973 3300048916 Bacteria 1001
566 Ga0496113_0928609 3300048916 Unclassified 687
567 Ga0496114_0000690 3300048917 Bacteria 25130
568 Ga0496114_0001144 3300048917 Bacteria 20053
569 Ga0496114_0025920 3300048917 Bacteria 4796
570 Ga0496114_0118681 3300048917 Bacteria 2273
571 Ga0496114_0218669 3300048917 Bacteria 1672
572 Ga0496114_0382879 3300048917 Bacteria 1245
573 Ga0496114_0628841 3300048917 Bacteria 945
574 Ga0496114_1733999 3300048917 Unclassified 513
575 Ga0496115_0014466 3300048918 Bacteria 5973
576 Ga0496115_0188501 3300048918 Bacteria 1704
577 Ga0496115_0660943 3300048918 Bacteria 825
578 Ga0496115_0696675 3300048918 Bacteria 799
579 Ga0501069_0488754 3300049585 Bacteria 734
580 Ga0501074_0331090 3300049590 Bacteria 1081
581 Ga0501075_1324423 3300049591 Bacteria 546
582 Ga0501076_1763484 3300049592 Unclassified 508
583 nmdc:mga03683_140091_c1 3300050489 Bacteria 1087
584 nmdc:mga00v17_312968_c1 3300050491 Bacteria 1020
585 nmdc:mga0yw44_35012_c1 3300050492 Bacteria 2947
586 nmdc:mga0yw44_794125_c1 3300050492 Bacteria 643
587 nmdc:mga09592_174129_c1 3300050508 Unclassified 1861
588 nmdc:mga08y16_204637_c1 3300050511 Bacteria 2045
589 nmdc:mga0n895_607240_c1 3300050512 Bacteria 1096
590 nmdc:mga0n895_92201_c1 3300050512 Bacteria 3032
591 nmdc:mga0rr50_1023321_c1 3300050513 Bacteria 703
592 nmdc:mga0rr50_1632811_c1 3300050513 Bacteria 544
593 nmdc:mga0rr50_514800_c1 3300050513 Bacteria 1018
594 nmdc:mga08x19_220463_c1 3300050514 Bacteria 1303
595 nmdc:mga08x19_507757_c1 3300050514 Bacteria 851
596 nmdc:mga0a205_215669_c1 3300050515 Unclassified 1806
597 nmdc:mga0a205_216636_c1 3300050515 Bacteria 1801
598 Ga0495601_0000206 3300053077 Bacteria 31438
599 Ga0495595_0397696 3300053084 Unclassified 698
600 Ga0495619_0000291 3300053085 Bacteria 35704
601 Ga0495619_1115876 3300053085 Unclassified 524
602 Ga0501084_0205119 3300054114 Bacteria 1664
603 Ga0501082_0100046 3300060353 Bacteria 2507

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_11245589 Ga0105243_112455892 77
2 3300013297 Ga0157378_10196376 Ga0157378_101963764 77
3 3300013308 Ga0157375_12103536 Ga0157375_121035361 77
4 3300009176 Ga0105242_11755462 Ga0105242_117554622 78
5 3300005445 Ga0070708_101849518 Ga0070708_1018495181 80
6 3300037312 Ga0395899_0145263 Ga0395899_0145263_393_716 80
7 3300037418 Ga0395900_0017487 Ga0395900_0017487_6661_6984 80
8 3300037466 Ga0395898_0036622 Ga0395898_0036622_3933_4256 80
9 3300037471 Ga0395905_0197544 Ga0395905_0197544_1534_1857 80
10 3300038443 Ga0395901_0318956 Ga0395901_0318956_35_358 80
11 3300009147 Ga0114129_11610047 Ga0114129_116100472 81
12 3300048917 Ga0496114_0118681 Ga0496114_0118681_584_892 81
13 3300005445 Ga0070708_101438205 Ga0070708_1014382052 82
14 3300005471 Ga0070698_100874622 Ga0070698_1008746221 82
15 3300006038 Ga0075365_10327086 Ga0075365_103270862 82
16 3300038443 Ga0395901_0445038 Ga0395901_0445038_159_473 82
17 3300042530 Ga0450916_062945 Ga0450916_062945_241_564 82
18 3300049585 Ga0501069_0488754 Ga0501069_0488754_214_528 82
19 3300050491 nmdc:mga00v17_312968_c1 nmdc:mga00v17_312968_c1_328_651 82
20 3300050492 nmdc:mga0yw44_35012_c1 nmdc:mga0yw44_35012_c1_1324_1647 82
21 3300025940 Ga0207691_11009918 Ga0207691_110099182 83
22 3300045976 Ga0466967_1613333 Ga0466967_1613333_260_571 85
23 3300005937 Ga0081455_10021153 Ga0081455_100211538 86
24 3300006844 Ga0075428_100706486 Ga0075428_1007064862 86
25 3300009094 Ga0111539_10315307 Ga0111539_103153072 86
26 3300027907 Ga0207428_10453888 Ga0207428_104538881 86
27 3300049592 Ga0501076_1763484 Ga0501076_1763484_17_340 86
28 3300050489 nmdc:mga03683_140091_c1 nmdc:mga03683_140091_c1_460_783 86
29 3300050492 nmdc:mga0yw44_794125_c1 nmdc:mga0yw44_794125_c1_223_546 86
30 3300050511 nmdc:mga08y16_204637_c1 nmdc:mga08y16_204637_c1_899_1204 86
31 3300005549 Ga0070704_101844844 Ga0070704_1018448441 87
32 3300037471 Ga0395905_0280331 Ga0395905_0280331_477_779 87
33 3300038443 Ga0395901_0179442 Ga0395901_0179442_1871_2173 87
34 3300044694 Ga0466963_0002476 Ga0466963_0002476_3174_3488 87
35 3300044842 Ga0466957_0282539 Ga0466957_0282539_681_995 87
36 3300045976 Ga0466967_0208355 Ga0466967_0208355_1292_1606 87
37 3300009098 Ga0105245_10322174 Ga0105245_103221744 88
38 3300005456 Ga0070678_100568595 Ga0070678_1005685952 89
39 3300009177 Ga0105248_12243991 Ga0105248_122439911 89
40 3300014969 Ga0157376_10306219 Ga0157376_103062193 89
41 3300025941 Ga0207711_11231276 Ga0207711_112312762 89
42 3300037418 Ga0395900_0604005 Ga0395900_0604005_710_1012 89
43 3300037466 Ga0395898_0114420 Ga0395898_0114420_1816_2118 89
44 3300037471 Ga0395905_0265128 Ga0395905_0265128_685_987 89
45 3300038443 Ga0395901_0019608 Ga0395901_0019608_3423_3725 89
46 3300048903 Ga0496100_0142904 Ga0496100_0142904_651_986 89
47 3300048907 Ga0496104_0001048 Ga0496104_0001048_5077_5412 89
48 3300048908 Ga0496105_0000594 Ga0496105_0000594_4704_5039 89
49 3300048910 Ga0496107_0073243 Ga0496107_0073243_1291_1626 89
50 3300048911 Ga0496108_0010409 Ga0496108_0010409_5544_5879 89
51 3300048912 Ga0496109_0000463 Ga0496109_0000463_14108_14443 89
52 3300048913 Ga0496110_0000563 Ga0496110_0000563_15040_15375 89
53 3300048914 Ga0496111_0010323 Ga0496111_0010323_1193_1528 89
54 3300048916 Ga0496113_0323450 Ga0496113_0323450_274_609 89
55 3300048917 Ga0496114_0000690 Ga0496114_0000690_22495_22830 89
56 3300005445 Ga0070708_101315748 Ga0070708_1013157481 90
57 3300005536 Ga0070697_100055952 Ga0070697_1000559525 90
58 3300045051 Ga0451576_2129098 Ga0451576_2129098_40_369 92
59 3300005329 Ga0070683_100005463 Ga0070683_1000054636 93
60 3300005329 Ga0070683_100540625 Ga0070683_1005406252 93
61 3300005330 Ga0070690_100344418 Ga0070690_1003444181 93
62 3300005336 Ga0070680_100008678 Ga0070680_10000867811 93
63 3300005337 Ga0070682_100010000 Ga0070682_1000100006 93
64 3300005338 Ga0068868_100030281 Ga0068868_1000302814 93
65 3300005354 Ga0070675_101404713 Ga0070675_1014047131 93
66 3300005436 Ga0070713_100662047 Ga0070713_1006620472 93
67 3300005437 Ga0070710_11152706 Ga0070710_111527062 93
68 3300005440 Ga0070705_101248109 Ga0070705_1012481092 93
69 3300005445 Ga0070708_101625479 Ga0070708_1016254792 93
70 3300005445 Ga0070708_101781307 Ga0070708_1017813072 93
71 3300005456 Ga0070678_100003222 Ga0070678_1000032227 93
72 3300005457 Ga0070662_100509875 Ga0070662_1005098752 93
73 3300005458 Ga0070681_10005979 Ga0070681_1000597912 93
74 3300005459 Ga0068867_102318508 Ga0068867_1023185081 93
75 3300005468 Ga0070707_101336484 Ga0070707_1013364842 93
76 3300005530 Ga0070679_100019233 Ga0070679_1000192337 93
77 3300005535 Ga0070684_100017138 Ga0070684_1000171385 93
78 3300005535 Ga0070684_100196926 Ga0070684_1001969263 93
79 3300005535 Ga0070684_101483218 Ga0070684_1014832182 93
80 3300005549 Ga0070704_101265409 Ga0070704_1012654092 93
81 3300005564 Ga0070664_100046670 Ga0070664_1000466706 93
82 3300005564 Ga0070664_100914430 Ga0070664_1009144302 93
83 3300005614 Ga0068856_100035013 Ga0068856_1000350133 93
84 3300005615 Ga0070702_100043548 Ga0070702_1000435483 93
85 3300005616 Ga0068852_101594212 Ga0068852_1015942122 93
86 3300005616 Ga0068852_101804820 Ga0068852_1018048202 93
87 3300005617 Ga0068859_101320526 Ga0068859_1013205262 93
88 3300005844 Ga0068862_100663743 Ga0068862_1006637432 93
89 3300006237 Ga0097621_101624698 Ga0097621_1016246982 93
90 3300006852 Ga0075433_10385164 Ga0075433_103851642 93
91 3300006931 Ga0097620_101320681 Ga0097620_1013206812 93
92 3300009098 Ga0105245_10002363 Ga0105245_1000236315 93
93 3300009098 Ga0105245_11755974 Ga0105245_117559741 93
94 3300009101 Ga0105247_10609179 Ga0105247_106091792 93
95 3300009148 Ga0105243_10125864 Ga0105243_101258642 93
96 3300009174 Ga0105241_10127395 Ga0105241_101273953 93
97 3300009177 Ga0105248_10573398 Ga0105248_105733983 93
98 3300009545 Ga0105237_11270385 Ga0105237_112703851 93
99 3300009545 Ga0105237_11420040 Ga0105237_114200402 93
100 3300009553 Ga0105249_10372811 Ga0105249_103728112 93
101 3300009553 Ga0105249_10739350 Ga0105249_107393502 93
102 3300010375 Ga0105239_10230714 Ga0105239_102307143 93
103 3300010375 Ga0105239_10239215 Ga0105239_102392152 93
104 3300010375 Ga0105239_11686493 Ga0105239_116864931 93
105 3300011119 Ga0105246_10078552 Ga0105246_100785522 93
106 3300011119 Ga0105246_11237062 Ga0105246_112370622 93
107 3300013296 Ga0157374_10084293 Ga0157374_100842933 93
108 3300013296 Ga0157374_10593161 Ga0157374_105931612 93
109 3300013307 Ga0157372_11210536 Ga0157372_112105362 93
110 3300013308 Ga0157375_10295890 Ga0157375_102958904 93
111 3300014325 Ga0163163_10370328 Ga0163163_103703281 93
112 3300014968 Ga0157379_10857926 Ga0157379_108579262 93
113 3300014968 Ga0157379_11760659 Ga0157379_117606592 93
114 3300014969 Ga0157376_11419378 Ga0157376_114193782 93
115 3300025911 Ga0207654_10152567 Ga0207654_101525673 93
116 3300025912 Ga0207707_10101056 Ga0207707_101010562 93
117 3300025917 Ga0207660_10047570 Ga0207660_100475702 93
118 3300025920 Ga0207649_10745300 Ga0207649_107453002 93
119 3300025921 Ga0207652_10033577 Ga0207652_100335775 93
120 3300025926 Ga0207659_10979185 Ga0207659_109791852 93
121 3300025927 Ga0207687_10099357 Ga0207687_100993572 93
122 3300025928 Ga0207700_10858931 Ga0207700_108589312 93
123 3300025935 Ga0207709_10078685 Ga0207709_100786853 93
124 3300025944 Ga0207661_10011037 Ga0207661_100110376 93
125 3300025945 Ga0207679_10204539 Ga0207679_102045392 93
126 3300025961 Ga0207712_10570757 Ga0207712_105707572 93
127 3300025961 Ga0207712_11334489 Ga0207712_113344892 93
128 3300025981 Ga0207640_10268344 Ga0207640_102683442 93
129 3300026023 Ga0207677_10019958 Ga0207677_100199585 93
130 3300026067 Ga0207678_10282327 Ga0207678_102823271 93
131 3300026075 Ga0207708_11193053 Ga0207708_111930532 93
132 3300026078 Ga0207702_10052319 Ga0207702_100523196 93
133 3300026116 Ga0207674_11337600 Ga0207674_113376002 93
134 3300026121 Ga0207683_10004028 Ga0207683_1000402812 93
135 3300026142 Ga0207698_11134476 Ga0207698_111344762 93
136 3300028381 Ga0268264_11669741 Ga0268264_116697412 93
137 3300037466 Ga0395898_0236358 Ga0395898_0236358_1236_1544 93
138 3300037466 Ga0395898_1120078 Ga0395898_1120078_145_453 93
139 3300038443 Ga0395901_1117854 Ga0395901_1117854_330_638 93
140 3300042142 Ga0450905_022705 Ga0450905_022705_17_325 93
141 3300045976 Ga0466967_0194818 Ga0466967_0194818_761_1084 93
142 3300046459 Ga0495629_0682523 Ga0495629_0682523_296_604 93
143 3300046642 Ga0495634_0183632 Ga0495634_0183632_41_349 93
144 3300048903 Ga0496100_0283283 Ga0496100_0283283_776_1084 93
145 3300048904 Ga0496101_0013813 Ga0496101_0013813_1976_2281 93
146 3300048904 Ga0496101_0395330 Ga0496101_0395330_77_385 93
147 3300048905 Ga0496102_0025083 Ga0496102_0025083_2154_2459 93
148 3300048905 Ga0496102_0143185 Ga0496102_0143185_1860_2168 93
149 3300048906 Ga0496103_0312793 Ga0496103_0312793_545_853 93
150 3300048907 Ga0496104_0047160 Ga0496104_0047160_1538_1843 93
151 3300048907 Ga0496104_0542053 Ga0496104_0542053_580_888 93
152 3300048908 Ga0496105_0162972 Ga0496105_0162972_189_497 93
153 3300048908 Ga0496105_1163646 Ga0496105_1163646_10_318 93
154 3300048909 Ga0496106_0038127 Ga0496106_0038127_945_1253 93
155 3300048911 Ga0496108_0214817 Ga0496108_0214817_1191_1499 93
156 3300048911 Ga0496108_0583121 Ga0496108_0583121_315_623 93
157 3300048912 Ga0496109_0043356 Ga0496109_0043356_3073_3381 93
158 3300048912 Ga0496109_0312694 Ga0496109_0312694_794_1102 93
159 3300048912 Ga0496109_0387732 Ga0496109_0387732_46_357 93
160 3300048913 Ga0496110_0685637 Ga0496110_0685637_393_701 93
161 3300048913 Ga0496110_1582680 Ga0496110_1582680_226_537 93
162 3300048914 Ga0496111_0037754 Ga0496111_0037754_1705_2013 93
163 3300048914 Ga0496111_0186871 Ga0496111_0186871_1166_1477 93
164 3300048915 Ga0496112_0269566 Ga0496112_0269566_1102_1413 93
165 3300048915 Ga0496112_0881047 Ga0496112_0881047_194_517 93
166 3300048916 Ga0496113_0126259 Ga0496113_0126259_462_770 93
167 3300048917 Ga0496114_0025920 Ga0496114_0025920_2232_2537 93
168 3300048917 Ga0496114_0382879 Ga0496114_0382879_917_1225 93
169 3300048917 Ga0496114_0628841 Ga0496114_0628841_553_861 93
170 3300048918 Ga0496115_0188501 Ga0496115_0188501_1098_1403 93
171 3300048918 Ga0496115_0660943 Ga0496115_0660943_149_457 93
172 3300050512 nmdc:mga0n895_607240_c1 nmdc:mga0n895_607240_c1_123_431 93
173 3300050512 nmdc:mga0n895_92201_c1 nmdc:mga0n895_92201_c1_1452_1760 93
174 3300050515 nmdc:mga0a205_215669_c1 nmdc:mga0a205_215669_c1_1262_1570 93
175 3300050515 nmdc:mga0a205_216636_c1 nmdc:mga0a205_216636_c1_597_905 93
176 3300005334 Ga0068869_101583370 Ga0068869_1015833701 94
177 3300005336 Ga0070680_101981305 Ga0070680_1019813051 94
178 3300005343 Ga0070687_100462901 Ga0070687_1004629011 94
179 3300005355 Ga0070671_100452341 Ga0070671_1004523411 94
180 3300005434 Ga0070709_10239470 Ga0070709_102394701 94
181 3300005435 Ga0070714_100135410 Ga0070714_1001354102 94
182 3300005436 Ga0070713_100051791 Ga0070713_1000517916 94
183 3300005437 Ga0070710_10060757 Ga0070710_100607574 94
184 3300005438 Ga0070701_10244375 Ga0070701_102443752 94
185 3300005439 Ga0070711_100059978 Ga0070711_1000599783 94
186 3300005444 Ga0070694_100396904 Ga0070694_1003969042 94
187 3300005445 Ga0070708_100013462 Ga0070708_1000134625 94
188 3300005445 Ga0070708_101295738 Ga0070708_1012957382 94
189 3300005468 Ga0070707_100110992 Ga0070707_1001109922 94
190 3300005468 Ga0070707_100832738 Ga0070707_1008327381 94
191 3300005471 Ga0070698_100053629 Ga0070698_1000536293 94
192 3300005471 Ga0070698_100874689 Ga0070698_1008746891 94
193 3300005518 Ga0070699_100061914 Ga0070699_1000619146 94
194 3300005530 Ga0070679_100350122 Ga0070679_1003501221 94
195 3300005536 Ga0070697_100180694 Ga0070697_1001806945 94
196 3300005536 Ga0070697_100756691 Ga0070697_1007566911 94
197 3300005549 Ga0070704_100171840 Ga0070704_1001718403 94
198 3300005578 Ga0068854_100087354 Ga0068854_1000873544 94
199 3300005718 Ga0068866_10288864 Ga0068866_102888642 94
200 3300005844 Ga0068862_100164107 Ga0068862_1001641072 94
201 3300006051 Ga0075364_11240125 Ga0075364_112401252 94
202 3300006163 Ga0070715_10314346 Ga0070715_103143462 94
203 3300006173 Ga0070716_100012415 Ga0070716_1000124152 94
204 3300006173 Ga0070716_100064626 Ga0070716_1000646262 94
205 3300006844 Ga0075428_100795252 Ga0075428_1007952522 94
206 3300007076 Ga0075435_101109574 Ga0075435_1011095741 94
207 3300009036 Ga0105244_10379942 Ga0105244_103799422 94
208 3300009093 Ga0105240_10489928 Ga0105240_104899282 94
209 3300009101 Ga0105247_10845313 Ga0105247_108453131 94
210 3300009148 Ga0105243_10380862 Ga0105243_103808622 94
211 3300009176 Ga0105242_10068348 Ga0105242_100683485 94
212 3300009553 Ga0105249_10692959 Ga0105249_106929593 94
213 3300013306 Ga0163162_11136078 Ga0163162_111360782 94
214 3300014745 Ga0157377_10016803 Ga0157377_100168035 94
215 3300014969 Ga0157376_12811505 Ga0157376_128115051 94
216 3300025906 Ga0207699_10404936 Ga0207699_104049361 94
217 3300025915 Ga0207693_10003428 Ga0207693_1000342816 94
218 3300025916 Ga0207663_10089591 Ga0207663_100895913 94
219 3300025921 Ga0207652_10616296 Ga0207652_106162962 94
220 3300025922 Ga0207646_10237298 Ga0207646_102372984 94
221 3300025939 Ga0207665_10021600 Ga0207665_100216004 94
222 3300025939 Ga0207665_10037509 Ga0207665_100375092 94
223 3300025942 Ga0207689_10090728 Ga0207689_100907282 94
224 3300028380 Ga0268265_10737994 Ga0268265_107379941 94
225 3300031852 Ga0307410_11896756 Ga0307410_118967561 94
226 3300031911 Ga0307412_11468317 Ga0307412_114683171 94
227 3300031995 Ga0307409_100210954 Ga0307409_1002109543 94
228 3300032002 Ga0307416_100823691 Ga0307416_1008236912 94
229 3300038443 Ga0395901_0050390 Ga0395901_0050390_1809_2117 94
230 3300038443 Ga0395901_0081441 Ga0395901_0081441_1050_1358 94
231 3300038443 Ga0395901_1248963 Ga0395901_1248963_10_318 94
232 3300041443 Ga0451789_1030471 Ga0451789_1030471_95_403 94
233 3300041452 Ga0451793_0054843 Ga0451793_0054843_665_973 94
234 3300041458 Ga0451798_0163159 Ga0451798_0163159_98_406 94
235 3300041459 Ga0451800_0727387 Ga0451800_0727387_1477_1785 94
236 3300041460 Ga0451802_0324980 Ga0451802_0324980_565_873 94
237 3300041486 Ga0451807_0005119 Ga0451807_0005119_322_630 94
238 3300041491 Ga0451833_1295374 Ga0451833_1295374_123_431 94
239 3300041492 Ga0451835_0127843 Ga0451835_0127843_257_565 94
240 3300041501 Ga0451845_0472794 Ga0451845_0472794_2858_3166 94
241 3300041503 Ga0451847_0504058 Ga0451847_0504058_1134_1442 94
242 3300041507 Ga0451851_1149583 Ga0451851_1149583_110_418 94
243 3300041509 Ga0451843_0079376 Ga0451843_0079376_271_579 94
244 3300041511 Ga0451855_1792993 Ga0451855_1792993_568_876 94
245 3300041512 Ga0451853_2291318 Ga0451853_2291318_704_1012 94
246 3300044683 Ga0466965_0497582 Ga0466965_0497582_353_661 94
247 3300044706 Ga0466964_0000569 Ga0466964_0000569_4938_5246 94
248 3300044735 Ga0466968_0050510 Ga0466968_0050510_211_519 94
249 3300044735 Ga0466968_0080712 Ga0466968_0080712_951_1247 94
250 3300044901 Ga0466960_0015647 Ga0466960_0015647_1226_1534 94
251 3300044901 Ga0466960_0123750 Ga0466960_0123750_372_668 94
252 3300044901 Ga0466960_0323204 Ga0466960_0323204_200_508 94
253 3300045976 Ga0466967_0057653 Ga0466967_0057653_2105_2413 94
254 3300048912 Ga0496109_0029226 Ga0496109_0029226_289_597 94
255 3300048913 Ga0496110_0081594 Ga0496110_0081594_1745_2053 94
256 3300048913 Ga0496110_0104217 Ga0496110_0104217_239_547 94
257 3300048914 Ga0496111_0539508 Ga0496111_0539508_277_585 94
258 3300048915 Ga0496112_0600292 Ga0496112_0600292_183_494 94
259 3300048916 Ga0496113_0131667 Ga0496113_0131667_597_905 94
260 3300050513 nmdc:mga0rr50_1023321_c1 nmdc:mga0rr50_1023321_c1_348_659 94
261 3300005327 Ga0070658_10178148 Ga0070658_101781484 95
262 3300005327 Ga0070658_10350818 Ga0070658_103508183 95
263 3300005329 Ga0070683_100052937 Ga0070683_1000529375 95
264 3300005329 Ga0070683_100227585 Ga0070683_1002275852 95
265 3300005329 Ga0070683_100233741 Ga0070683_1002337412 95
266 3300005336 Ga0070680_100074712 Ga0070680_1000747123 95
267 3300005337 Ga0070682_100609203 Ga0070682_1006092032 95
268 3300005339 Ga0070660_100058319 Ga0070660_1000583194 95
269 3300005339 Ga0070660_100068686 Ga0070660_1000686861 95
270 3300005339 Ga0070660_100715462 Ga0070660_1007154622 95
271 3300005344 Ga0070661_100095886 Ga0070661_1000958863 95
272 3300005347 Ga0070668_100581156 Ga0070668_1005811561 95
273 3300005366 Ga0070659_100050426 Ga0070659_1000504262 95
274 3300005366 Ga0070659_101137690 Ga0070659_1011376902 95
275 3300005406 Ga0070703_10040055 Ga0070703_100400553 95
276 3300005434 Ga0070709_10004518 Ga0070709_100045184 95
277 3300005434 Ga0070709_10768712 Ga0070709_107687122 95
278 3300005435 Ga0070714_100007151 Ga0070714_1000071516 95
279 3300005435 Ga0070714_100853970 Ga0070714_1008539702 95
280 3300005436 Ga0070713_100015415 Ga0070713_1000154158 95
281 3300005437 Ga0070710_10000589 Ga0070710_1000058911 95
282 3300005438 Ga0070701_10930879 Ga0070701_109308792 95
283 3300005439 Ga0070711_100028555 Ga0070711_1000285552 95
284 3300005439 Ga0070711_101220837 Ga0070711_1012208371 95
285 3300005444 Ga0070694_100270560 Ga0070694_1002705603 95
286 3300005457 Ga0070662_100839828 Ga0070662_1008398282 95
287 3300005458 Ga0070681_10129514 Ga0070681_101295143 95
288 3300005458 Ga0070681_10187444 Ga0070681_101874444 95
289 3300005458 Ga0070681_10423841 Ga0070681_104238412 95
290 3300005468 Ga0070707_100545290 Ga0070707_1005452902 95
291 3300005471 Ga0070698_100090673 Ga0070698_1000906735 95
292 3300005530 Ga0070679_100129725 Ga0070679_1001297252 95
293 3300005530 Ga0070679_100155438 Ga0070679_1001554384 95
294 3300005530 Ga0070679_101654708 Ga0070679_1016547081 95
295 3300005530 Ga0070679_101864244 Ga0070679_1018642442 95
296 3300005535 Ga0070684_100060928 Ga0070684_1000609281 95
297 3300005535 Ga0070684_102327906 Ga0070684_1023279061 95
298 3300005539 Ga0068853_100082856 Ga0068853_1000828564 95
299 3300005545 Ga0070695_100005103 Ga0070695_1000051032 95
300 3300005545 Ga0070695_100469237 Ga0070695_1004692372 95
301 3300005545 Ga0070695_100547191 Ga0070695_1005471912 95
302 3300005545 Ga0070695_100884073 Ga0070695_1008840732 95
303 3300005546 Ga0070696_101157581 Ga0070696_1011575811 95
304 3300005548 Ga0070665_101034891 Ga0070665_1010348912 95
305 3300005563 Ga0068855_100853581 Ga0068855_1008535812 95
306 3300005563 Ga0068855_101054284 Ga0068855_1010542842 95
307 3300005577 Ga0068857_100453705 Ga0068857_1004537052 95
308 3300005578 Ga0068854_100818477 Ga0068854_1008184772 95
309 3300005614 Ga0068856_100226049 Ga0068856_1002260495 95
310 3300005615 Ga0070702_100643351 Ga0070702_1006433512 95
311 3300006028 Ga0070717_10007774 Ga0070717_100077745 95
312 3300006038 Ga0075365_10234004 Ga0075365_102340043 95
313 3300006163 Ga0070715_10001156 Ga0070715_100011566 95
314 3300006173 Ga0070716_100001585 Ga0070716_1000015857 95
315 3300006173 Ga0070716_100264823 Ga0070716_1002648233 95
316 3300006175 Ga0070712_100217663 Ga0070712_1002176633 95
317 3300006175 Ga0070712_100291581 Ga0070712_1002915813 95
318 3300006844 Ga0075428_100304727 Ga0075428_1003047272 95
319 3300006846 Ga0075430_101294065 Ga0075430_1012940652 95
320 3300006847 Ga0075431_100056395 Ga0075431_1000563956 95
321 3300006880 Ga0075429_100214881 Ga0075429_1002148814 95
322 3300007076 Ga0075435_100451135 Ga0075435_1004511352 95
323 3300009093 Ga0105240_10005428 Ga0105240_1000542820 95
324 3300009093 Ga0105240_10353266 Ga0105240_103532663 95
325 3300009098 Ga0105245_10452199 Ga0105245_104521992 95
326 3300009101 Ga0105247_10066675 Ga0105247_100666752 95
327 3300009174 Ga0105241_10406015 Ga0105241_104060152 95
328 3300009174 Ga0105241_10829731 Ga0105241_108297312 95
329 3300009545 Ga0105237_10199936 Ga0105237_101999362 95
330 3300009545 Ga0105237_11565920 Ga0105237_115659202 95
331 3300009551 Ga0105238_10694426 Ga0105238_106944262 95
332 3300009551 Ga0105238_10926295 Ga0105238_109262951 95
333 3300009551 Ga0105238_11639883 Ga0105238_116398832 95
334 3300009553 Ga0105249_10364461 Ga0105249_103644612 95
335 3300010375 Ga0105239_11194805 Ga0105239_111948052 95
336 3300012477 Ga0157336_1030578 Ga0157336_10305782 95
337 3300012502 Ga0157347_1018474 Ga0157347_10184742 95
338 3300012507 Ga0157342_1004103 Ga0157342_10041033 95
339 3300012508 Ga0157315_1033304 Ga0157315_10333042 95
340 3300013100 Ga0157373_10125746 Ga0157373_101257462 95
341 3300013100 Ga0157373_11087048 Ga0157373_110870482 95
342 3300013102 Ga0157371_10800473 Ga0157371_108004731 95
343 3300013104 Ga0157370_10106645 Ga0157370_101066453 95
344 3300013104 Ga0157370_11440772 Ga0157370_114407721 95
345 3300013105 Ga0157369_10004504 Ga0157369_100045049 95
346 3300013105 Ga0157369_10795413 Ga0157369_107954132 95
347 3300013105 Ga0157369_10929054 Ga0157369_109290542 95
348 3300013296 Ga0157374_10028824 Ga0157374_100288244 95
349 3300013296 Ga0157374_12752988 Ga0157374_127529882 95
350 3300013297 Ga0157378_10242882 Ga0157378_102428824 95
351 3300013307 Ga0157372_10005876 Ga0157372_100058762 95
352 3300013307 Ga0157372_10231243 Ga0157372_102312434 95
353 3300013307 Ga0157372_10449293 Ga0157372_104492934 95
354 3300013308 Ga0157375_13652185 Ga0157375_136521852 95
355 3300020070 Ga0206356_10104702 Ga0206356_101047022 95
356 3300020070 Ga0206356_11143110 Ga0206356_111431102 95
357 3300020080 Ga0206350_11195411 Ga0206350_111954112 95
358 3300020082 Ga0206353_12031984 Ga0206353_120319842 95
359 3300025885 Ga0207653_10023404 Ga0207653_100234042 95
360 3300025898 Ga0207692_10001763 Ga0207692_1000176312 95
361 3300025900 Ga0207710_10064183 Ga0207710_100641832 95
362 3300025904 Ga0207647_10439742 Ga0207647_104397422 95
363 3300025905 Ga0207685_10043445 Ga0207685_100434452 95
364 3300025906 Ga0207699_10001650 Ga0207699_100016504 95
365 3300025906 Ga0207699_10715289 Ga0207699_107152892 95
366 3300025909 Ga0207705_10132721 Ga0207705_101327213 95
367 3300025909 Ga0207705_10230751 Ga0207705_102307512 95
368 3300025911 Ga0207654_10635180 Ga0207654_106351802 95
369 3300025912 Ga0207707_10028393 Ga0207707_100283934 95
370 3300025912 Ga0207707_10164856 Ga0207707_101648561 95
371 3300025912 Ga0207707_10202488 Ga0207707_102024884 95
372 3300025913 Ga0207695_10027243 Ga0207695_100272438 95
373 3300025913 Ga0207695_10285504 Ga0207695_102855043 95
374 3300025914 Ga0207671_10208212 Ga0207671_102082123 95
375 3300025914 Ga0207671_10529940 Ga0207671_105299402 95
376 3300025915 Ga0207693_10000662 Ga0207693_1000066219 95
377 3300025915 Ga0207693_10160525 Ga0207693_101605252 95
378 3300025916 Ga0207663_10000565 Ga0207663_1000056510 95
379 3300025917 Ga0207660_10007442 Ga0207660_100074426 95
380 3300025919 Ga0207657_10008781 Ga0207657_1000878113 95
381 3300025919 Ga0207657_10030613 Ga0207657_100306132 95
382 3300025920 Ga0207649_10061616 Ga0207649_100616164 95
383 3300025921 Ga0207652_10026188 Ga0207652_100261883 95
384 3300025921 Ga0207652_10245352 Ga0207652_102453522 95
385 3300025921 Ga0207652_10527448 Ga0207652_105274482 95
386 3300025921 Ga0207652_10981926 Ga0207652_109819262 95
387 3300025922 Ga0207646_10447086 Ga0207646_104470862 95
388 3300025923 Ga0207681_10237627 Ga0207681_102376273 95
389 3300025924 Ga0207694_11212971 Ga0207694_112129712 95
390 3300025928 Ga0207700_10003047 Ga0207700_100030471 95
391 3300025929 Ga0207664_10005373 Ga0207664_100053739 95
392 3300025929 Ga0207664_10932838 Ga0207664_109328381 95
393 3300025929 Ga0207664_11978587 Ga0207664_119785872 95
394 3300025931 Ga0207644_10439671 Ga0207644_104396712 95
395 3300025932 Ga0207690_10126004 Ga0207690_101260042 95
396 3300025932 Ga0207690_10839535 Ga0207690_108395352 95
397 3300025939 Ga0207665_10004251 Ga0207665_100042519 95
398 3300025939 Ga0207665_10103473 Ga0207665_101034734 95
399 3300025944 Ga0207661_10182124 Ga0207661_101821242 95
400 3300025944 Ga0207661_10239910 Ga0207661_102399102 95
401 3300025949 Ga0207667_10748535 Ga0207667_107485352 95
402 3300025949 Ga0207667_10837176 Ga0207667_108371762 95
403 3300025961 Ga0207712_11137325 Ga0207712_111373251 95
404 3300025972 Ga0207668_10506129 Ga0207668_105061292 95
405 3300025981 Ga0207640_10165868 Ga0207640_101658683 95
406 3300025981 Ga0207640_10462097 Ga0207640_104620972 95
407 3300026041 Ga0207639_10074732 Ga0207639_100747323 95
408 3300026078 Ga0207702_11410068 Ga0207702_114100682 95
409 3300026078 Ga0207702_12455128 Ga0207702_124551282 95
410 3300026116 Ga0207674_10355621 Ga0207674_103556212 95
411 3300032002 Ga0307416_100058943 Ga0307416_1000589434 95
412 3300032004 Ga0307414_10191602 Ga0307414_101916022 95
413 3300032126 Ga0307415_100126724 Ga0307415_1001267242 95
414 3300035112 Ga0373932_0289320 Ga0373932_0289320_20_352 95
415 3300035119 Ga0373956_0047863 Ga0373956_0047863_1160_1471 95
416 3300035172 Ga0373955_0064179 Ga0373955_0064179_1011_1322 95
417 3300035691 Ga0373931_0236119 Ga0373931_0236119_484_816 95
418 3300035724 Ga0373933_0180915 Ga0373933_0180915_184_495 95
419 3300036401 Ga0373937_0027346 Ga0373937_0027346_4419_4730 95
420 3300037312 Ga0395899_0226207 Ga0395899_0226207_966_1268 95
421 3300037312 Ga0395899_0252968 Ga0395899_0252968_603_917 95
422 3300037418 Ga0395900_0767413 Ga0395900_0767413_324_635 95
423 3300037418 Ga0395900_1106369 Ga0395900_1106369_13_300 95
424 3300037418 Ga0395900_1623351 Ga0395900_1623351_236_538 95
425 3300037466 Ga0395898_0790495 Ga0395898_0790495_11_325 95
426 3300037466 Ga0395898_1453204 Ga0395898_1453204_16_318 95
427 3300037471 Ga0395905_0759092 Ga0395905_0759092_177_491 95
428 3300038443 Ga0395901_0052105 Ga0395901_0052105_3497_3799 95
429 3300038443 Ga0395901_0080644 Ga0395901_0080644_1346_1660 95
430 3300038443 Ga0395901_1487518 Ga0395901_1487518_287_601 95
431 3300038443 Ga0395901_1629349 Ga0395901_1629349_49_360 95
432 3300039438 Ga0436360_0702089 Ga0436360_0702089_253_564 95
433 3300041486 Ga0451807_0802826 Ga0451807_0802826_208_510 95
434 3300042122 Ga0450920_012612 Ga0450920_012612_606_920 95
435 3300044694 Ga0466963_0017814 Ga0466963_0017814_3116_3427 95
436 3300044694 Ga0466963_0018348 Ga0466963_0018348_401_712 95
437 3300044694 Ga0466963_0308437 Ga0466963_0308437_642_974 95
438 3300044706 Ga0466964_0009904 Ga0466964_0009904_244_555 95
439 3300044706 Ga0466964_0017873 Ga0466964_0017873_1809_2120 95
440 3300044706 Ga0466964_0165428 Ga0466964_0165428_228_539 95
441 3300044706 Ga0466964_0632341 Ga0466964_0632341_130_441 95
442 3300044719 Ga0466971_0251810 Ga0466971_0251810_291_623 95
443 3300044735 Ga0466968_0124320 Ga0466968_0124320_616_927 95
444 3300044842 Ga0466957_0027825 Ga0466957_0027825_1768_2079 95
445 3300044842 Ga0466957_0056601 Ga0466957_0056601_341_652 95
446 3300044842 Ga0466957_0661254 Ga0466957_0661254_127_459 95
447 3300044901 Ga0466960_0089970 Ga0466960_0089970_1034_1336 95
448 3300044901 Ga0466960_0097690 Ga0466960_0097690_648_959 95
449 3300045049 Ga0466959_0272994 Ga0466959_0272994_761_1093 95
450 3300045836 Ga0466958_0122597 Ga0466958_0122597_699_1031 95
451 3300045976 Ga0466967_0032639 Ga0466967_0032639_1127_1438 95
452 3300045976 Ga0466967_0036019 Ga0466967_0036019_469_780 95
453 3300045976 Ga0466967_0077440 Ga0466967_0077440_1766_2077 95
454 3300045976 Ga0466967_0275540 Ga0466967_0275540_618_929 95
455 3300045976 Ga0466967_0308196 Ga0466967_0308196_278_589 95
456 3300045976 Ga0466967_0320278 Ga0466967_0320278_731_1042 95
457 3300046454 Ga0495592_0000100 Ga0495592_0000100_53637_53948 95
458 3300046455 Ga0495603_0467758 Ga0495603_0467758_27_317 95
459 3300046461 Ga0495641_0039338 Ga0495641_0039338_619_921 95
460 3300046462 Ga0495651_0000008 Ga0495651_0000008_77701_78012 95
461 3300046463 Ga0495653_0000519 Ga0495653_0000519_12456_12767 95
462 3300046475 Ga0495639_0475811 Ga0495639_0475811_290_592 95
463 3300046477 Ga0495664_0207275 Ga0495664_0207275_622_933 95
464 3300046511 Ga0495608_0002853 Ga0495608_0002853_3938_4249 95
465 3300046514 Ga0495618_0002283 Ga0495618_0002283_2531_2842 95
466 3300046516 Ga0495628_0001255 Ga0495628_0001255_11300_11611 95
467 3300046526 Ga0495666_0402406 Ga0495666_0402406_153_455 95
468 3300046529 Ga0495652_0000888 Ga0495652_0000888_11300_11611 95
469 3300046536 Ga0495587_0000048 Ga0495587_0000048_82332_82643 95
470 3300046543 Ga0495645_0000029 Ga0495645_0000029_30477_30788 95
471 3300046559 Ga0495667_0040139 Ga0495667_0040139_1533_1844 95
472 3300046615 Ga0495656_0239461 Ga0495656_0239461_37_339 95
473 3300046675 Ga0495657_0028894 Ga0495657_0028894_3346_3657 95
474 3300046678 Ga0495599_0012836 Ga0495599_0012836_2777_3088 95
475 3300046679 Ga0495623_0000093 Ga0495623_0000093_15228_15539 95
476 3300046680 Ga0495646_0019787 Ga0495646_0019787_1735_2046 95
477 3300046683 Ga0495658_0021178 Ga0495658_0021178_1421_1723 95
478 3300046683 Ga0495658_0532841 Ga0495658_0532841_160_471 95
479 3300047317 Ga0495604_0000111 Ga0495604_0000111_4460_4771 95
480 3300047319 Ga0495674_0044849 Ga0495674_0044849_595_906 95
481 3300047321 Ga0495676_0169451 Ga0495676_0169451_729_1031 95
482 3300047322 Ga0495680_0022218 Ga0495680_0022218_978_1289 95
483 3300047444 Ga0495675_0000376 Ga0495675_0000376_15387_15698 95
484 3300047673 Ga0495593_0066709 Ga0495593_0066709_243_545 95
485 3300048088 Ga0495602_0000141 Ga0495602_0000141_27951_28262 95
486 3300048903 Ga0496100_0006457 Ga0496100_0006457_5526_5858 95
487 3300048903 Ga0496100_1261350 Ga0496100_1261350_117_428 95
488 3300048905 Ga0496102_0016855 Ga0496102_0016855_5816_6127 95
489 3300048905 Ga0496102_0025463 Ga0496102_0025463_4401_4733 95
490 3300048906 Ga0496103_0274083 Ga0496103_0274083_737_1069 95
491 3300048907 Ga0496104_0331245 Ga0496104_0331245_227_559 95
492 3300048908 Ga0496105_0096561 Ga0496105_0096561_1553_1864 95
493 3300048908 Ga0496105_0334597 Ga0496105_0334597_65_397 95
494 3300048909 Ga0496106_0008985 Ga0496106_0008985_5816_6148 95
495 3300048910 Ga0496107_0003633 Ga0496107_0003633_2314_2646 95
496 3300048911 Ga0496108_0072278 Ga0496108_0072278_2090_2422 95
497 3300048911 Ga0496108_0280338 Ga0496108_0280338_446_757 95
498 3300048912 Ga0496109_0145236 Ga0496109_0145236_333_644 95
499 3300048912 Ga0496109_0147833 Ga0496109_0147833_556_858 95
500 3300048912 Ga0496109_0691165 Ga0496109_0691165_90_422 95
501 3300048912 Ga0496109_1023625 Ga0496109_1023625_200_511 95
502 3300048913 Ga0496110_0019029 Ga0496110_0019029_5234_5545 95
503 3300048913 Ga0496110_0020550 Ga0496110_0020550_11_343 95
504 3300048913 Ga0496110_0236360 Ga0496110_0236360_874_1176 95
505 3300048914 Ga0496111_0006472 Ga0496111_0006472_6269_6601 95
506 3300048914 Ga0496111_0044912 Ga0496111_0044912_1885_2187 95
507 3300048914 Ga0496111_0234879 Ga0496111_0234879_480_791 95
508 3300048915 Ga0496112_0016172 Ga0496112_0016172_2657_2968 95
509 3300048915 Ga0496112_0020985 Ga0496112_0020985_1919_2230 95
510 3300048915 Ga0496112_0135570 Ga0496112_0135570_885_1196 95
511 3300048915 Ga0496112_0482811 Ga0496112_0482811_536_868 95
512 3300048916 Ga0496113_0195362 Ga0496113_0195362_1216_1527 95
513 3300048916 Ga0496113_0244608 Ga0496113_0244608_436_768 95
514 3300048916 Ga0496113_0277480 Ga0496113_0277480_681_992 95
515 3300048916 Ga0496113_0477973 Ga0496113_0477973_410_724 95
516 3300048916 Ga0496113_0928609 Ga0496113_0928609_335_646 95
517 3300048917 Ga0496114_0001144 Ga0496114_0001144_14131_14463 95
518 3300048917 Ga0496114_0218669 Ga0496114_0218669_159_470 95
519 3300048917 Ga0496114_1733999 Ga0496114_1733999_91_402 95
520 3300048918 Ga0496115_0014466 Ga0496115_0014466_4402_4734 95
521 3300049590 Ga0501074_0331090 Ga0501074_0331090_694_1005 95
522 3300049591 Ga0501075_1324423 Ga0501075_1324423_168_479 95
523 3300050508 nmdc:mga09592_174129_c1 nmdc:mga09592_174129_c1_718_1020 95
524 3300050513 nmdc:mga0rr50_1632811_c1 nmdc:mga0rr50_1632811_c1_206_508 95
525 3300050513 nmdc:mga0rr50_514800_c1 nmdc:mga0rr50_514800_c1_465_776 95
526 3300050514 nmdc:mga08x19_220463_c1 nmdc:mga08x19_220463_c1_554_865 95
527 3300050514 nmdc:mga08x19_507757_c1 nmdc:mga08x19_507757_c1_239_553 95
528 3300053077 Ga0495601_0000206 Ga0495601_0000206_28917_29228 95
529 3300053085 Ga0495619_0000291 Ga0495619_0000291_20790_21101 95
530 3300054114 Ga0501084_0205119 Ga0501084_0205119_551_862 95
531 3300060353 Ga0501082_0100046 Ga0501082_0100046_1962_2273 95
532 3300004799 Ga0058863_11769592 Ga0058863_117695922 96
533 3300004800 Ga0058861_11765624 Ga0058861_117656242 96
534 3300005327 Ga0070658_10111170 Ga0070658_101111703 96
535 3300005329 Ga0070683_100007546 Ga0070683_1000075463 96
536 3300005336 Ga0070680_100058288 Ga0070680_1000582885 96
537 3300005338 Ga0068868_101568786 Ga0068868_1015687862 96
538 3300005339 Ga0070660_100033989 Ga0070660_1000339892 96
539 3300005345 Ga0070692_10151776 Ga0070692_101517762 96
540 3300005366 Ga0070659_100051045 Ga0070659_1000510456 96
541 3300005458 Ga0070681_10119501 Ga0070681_101195013 96
542 3300005530 Ga0070679_100199135 Ga0070679_1001991355 96
543 3300005535 Ga0070684_100272553 Ga0070684_1002725533 96
544 3300005614 Ga0068856_100100048 Ga0068856_1001000485 96
545 3300005616 Ga0068852_100139785 Ga0068852_1001397855 96
546 3300006028 Ga0070717_10078603 Ga0070717_100786031 96
547 3300006358 Ga0068871_102284093 Ga0068871_1022840932 96
548 3300009093 Ga0105240_10202280 Ga0105240_102022803 96
549 3300009098 Ga0105245_10108887 Ga0105245_101088873 96
550 3300009174 Ga0105241_10194385 Ga0105241_101943853 96
551 3300009551 Ga0105238_10569333 Ga0105238_105693332 96
552 3300010375 Ga0105239_10722649 Ga0105239_107226492 96
553 3300010375 Ga0105239_11506930 Ga0105239_115069302 96
554 3300013104 Ga0157370_11223927 Ga0157370_112239272 96
555 3300013105 Ga0157369_10045245 Ga0157369_100452453 96
556 3300013296 Ga0157374_10443211 Ga0157374_104432112 96
557 3300013296 Ga0157374_12533269 Ga0157374_125332692 96
558 3300013307 Ga0157372_11284598 Ga0157372_112845982 96
559 3300013307 Ga0157372_12666174 Ga0157372_126661741 96
560 3300015262 Ga0182007_10234934 Ga0182007_102349342 96
561 3300015265 Ga0182005_1159325 Ga0182005_11593252 96
562 3300020076 Ga0206355_1489610 Ga0206355_14896101 96
563 3300022467 Ga0224712_10088868 Ga0224712_100888682 96
564 3300025909 Ga0207705_10072044 Ga0207705_100720443 96
565 3300025911 Ga0207654_11054477 Ga0207654_110544772 96
566 3300025913 Ga0207695_10216720 Ga0207695_102167202 96
567 3300025915 Ga0207693_10303774 Ga0207693_103037743 96
568 3300025917 Ga0207660_10329720 Ga0207660_103297203 96
569 3300025917 Ga0207660_10376828 Ga0207660_103768281 96
570 3300025919 Ga0207657_10000739 Ga0207657_1000073923 96
571 3300025920 Ga0207649_10309022 Ga0207649_103090223 96
572 3300025924 Ga0207694_10405147 Ga0207694_104051472 96
573 3300025927 Ga0207687_10199875 Ga0207687_101998753 96
574 3300025932 Ga0207690_10378339 Ga0207690_103783392 96
575 3300025944 Ga0207661_10136284 Ga0207661_101362843 96
576 3300025949 Ga0207667_10247904 Ga0207667_102479042 96
577 3300026142 Ga0207698_10275566 Ga0207698_102755662 96
578 3300037466 Ga0395898_0380652 Ga0395898_0380652_637_951 96
579 3300044694 Ga0466963_0045020 Ga0466963_0045020_908_1222 96
580 3300046454 Ga0495592_0024391 Ga0495592_0024391_1440_1754 96
581 3300046463 Ga0495653_0250241 Ga0495653_0250241_138_452 96
582 3300046511 Ga0495608_0118129 Ga0495608_0118129_1282_1596 96
583 3300046516 Ga0495628_0084698 Ga0495628_0084698_1559_1873 96
584 3300046529 Ga0495652_0027787 Ga0495652_0027787_2259_2573 96
585 3300046663 Ga0495635_0530057 Ga0495635_0530057_216_530 96
586 3300047322 Ga0495680_0337532 Ga0495680_0337532_558_872 96
587 3300047444 Ga0495675_0439832 Ga0495675_0439832_315_629 96
588 3300048088 Ga0495602_0006548 Ga0495602_0006548_2699_3013 96
589 3300048904 Ga0496101_0125801 Ga0496101_0125801_777_1091 96
590 3300048905 Ga0496102_1305846 Ga0496102_1305846_165_479 96
591 3300048908 Ga0496105_0103454 Ga0496105_0103454_254_568 96
592 3300048910 Ga0496107_0270588 Ga0496107_0270588_748_1062 96
593 3300048911 Ga0496108_0107672 Ga0496108_0107672_300_614 96
594 3300048911 Ga0496108_0471573 Ga0496108_0471573_477_794 96
595 3300048912 Ga0496109_0136237 Ga0496109_0136237_602_916 96
596 3300048913 Ga0496110_0217112 Ga0496110_0217112_753_1070 96
597 3300048913 Ga0496110_0432449 Ga0496110_0432449_205_519 96
598 3300048914 Ga0496111_0183365 Ga0496111_0183365_40_354 96
599 3300048914 Ga0496111_0257755 Ga0496111_0257755_251_568 96
600 3300048916 Ga0496113_0056786 Ga0496113_0056786_1959_2273 96
601 3300048918 Ga0496115_0696675 Ga0496115_0696675_438_752 96
602 3300053084 Ga0495595_0397696 Ga0495595_0397696_340_654 96
603 3300053085 Ga0495619_1115876 Ga0495619_1115876_165_479 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

31

104

0.95

Feature Viewer

pLDDT pTM Quality
71.13 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map