F468200

General Info

Members Datasets Scaffolds Average Seq Length
602 202 595 248

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0020927|Ga0466971_0020927_887_1705
Length 272
Sequence MRRAGSFYKNKETPIMKTTVFTLATPLILAALAAPLHAQEAQAPQSAQPDNTLTFNAALTSDYRYRGISQTRLQPALQGGADYTHNPTGLYAGTWLSTIKWTKDAGGGGDVEWDLYAGKRGQLSADVSYDVGVLAYVYPSNGLKDVAGSANANTVELYGQLGYGPAYVKYSTALSNLFGYTDSRHSGYLDIGANVDLGNAFTLNLHAGRQDVRHHDAACYTDYKVGVTKDFGIASVTAAFVGTNADDTAYASPADGKFLGKKALVVSVGKTF

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 4.32
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 3.82
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10117945 3300003322 Bacteria 1642
2 Ga0007410J51695_1015573 3300003574 Bacteria 1330
3 Ga0007409J51694_1006909 3300003575 Bacteria 1621
4 Ga0032354_1042402 3300003693 Bacteria 1102
5 Ga0055525_1000179 3300003759 Bacteria 78692
6 Ga0055542_1026451 3300003762 Bacteria 781
7 Ga0065165_1004993 3300005262 Bacteria 7775
8 Ga0065165_1019263 3300005262 Bacteria 2444
9 Ga0065165_1021100 3300005262 Bacteria 2271
10 Ga0070658_10026170 3300005327 Bacteria 4680
11 Ga0070658_10092903 3300005327 Bacteria 2488
12 Ga0070683_100297681 3300005329 Bacteria 1535
13 Ga0070680_100085820 3300005336 Bacteria 2601
14 Ga0070660_100088380 3300005339 Bacteria 2440
15 Ga0070660_100243144 3300005339 Bacteria 1466
16 Ga0070660_100641043 3300005339 Bacteria 889
17 Ga0070659_100025754 3300005366 Bacteria 4523
18 Ga0070659_100359214 3300005366 Bacteria 1223
19 Ga0070663_100172314 3300005455 Bacteria 1674
20 Ga0070662_100140721 3300005457 Bacteria 1869
21 Ga0068855_100053683 3300005563 Bacteria 4740
22 Ga0068855_100196905 3300005563 Bacteria 2270
23 Ga0070664_100187350 3300005564 Bacteria 1842
24 Ga0070664_100418073 3300005564 Bacteria 1228
25 Ga0068852_100017608 3300005616 Bacteria 5610
26 Ga0105244_10005736 3300009036 Bacteria 8191
27 Ga0105244_10066004 3300009036 Bacteria 1812
28 Ga0105245_10204286 3300009098 Bacteria 1899
29 Ga0105243_10013788 3300009148 Bacteria 6116
30 Ga0105241_10008850 3300009174 Bacteria 7402
31 Ga0105242_10115504 3300009176 Bacteria 2295
32 Ga0105237_10139431 3300009545 Bacteria 2419
33 Ga0105238_10590916 3300009551 Bacteria 1117
34 Ga0157371_10000153 3300013102 Bacteria 101298
35 Ga0157374_10119100 3300013296 Bacteria 2547
36 Ga0157372_10403847 3300013307 Bacteria 1592
37 Ga0182008_10026963 3300014497 Bacteria 2912
38 Ga0157376_10460761 3300014969 Bacteria 1242
39 Ga0182006_1034670 3300015261 Bacteria 2017
40 Ga0206350_10202215 3300020080 Bacteria 1310
41 Ga0213872_10000944 3300021361 Bacteria 20385
42 Ga0209563_100143 3300025230 Bacteria 78744
43 Ga0209148_1000229 3300025254 Bacteria 91956
44 Ga0207655_1117207 3300025728 Bacteria 889
45 Ga0207705_10003544 3300025909 Bacteria 11881
46 Ga0207705_10062026 3300025909 Bacteria 2700
47 Ga0207705_10092635 3300025909 Bacteria 2214
48 Ga0207695_10418103 3300025913 Bacteria 1225
49 Ga0207671_10086571 3300025914 Bacteria 2355
50 Ga0207660_10065502 3300025917 Bacteria 2626
51 Ga0207657_10004829 3300025919 Bacteria 14198
52 Ga0207657_10276980 3300025919 Bacteria 1333
53 Ga0207657_10589336 3300025919 Bacteria 868
54 Ga0207649_10076586 3300025920 Bacteria 2153
55 Ga0207687_10132493 3300025927 Bacteria 1881
56 Ga0207690_10016222 3300025932 Bacteria 4528
57 Ga0207690_10282882 3300025932 Bacteria 1292
58 Ga0207706_10075222 3300025933 Bacteria 2970
59 Ga0207686_10021694 3300025934 Bacteria 3690
60 Ga0207679_10141176 3300025945 Bacteria 1947
61 Ga0207679_10158130 3300025945 Bacteria 1853
62 Ga0207679_10755194 3300025945 Bacteria 885
63 Ga0207667_10006091 3300025949 Bacteria 14660
64 Ga0207667_10135988 3300025949 Bacteria 2531
65 Ga0207639_10388017 3300026041 Bacteria 1255
66 Ga0207678_10220689 3300026067 Bacteria 1623
67 Ga0207702_10233271 3300026078 Bacteria 1721
68 Ga0207648_10272889 3300026089 Bacteria 1511
69 Ga0207674_10091952 3300026116 Bacteria 3023
70 Ga0307518_10176242 3300031838 Bacteria 1451
71 Ga0395899_0096430 3300037312 Bacteria 2138
72 Ga0395899_0112855 3300037312 Bacteria 1952
73 Ga0395899_0235789 3300037312 Bacteria 1261
74 Ga0395899_0275430 3300037312 Bacteria 1146
75 Ga0395899_0356022 3300037312 Bacteria 978
76 Ga0395899_0444235 3300037312 Bacteria 850
77 Ga0395900_0003038 3300037418 Bacteria 18275
78 Ga0395900_0047947 3300037418 Bacteria 4400
79 Ga0395900_0050396 3300037418 Bacteria 4288
80 Ga0395900_0103459 3300037418 Bacteria 2925
81 Ga0395900_0142998 3300037418 Bacteria 2448
82 Ga0395900_0282920 3300037418 Bacteria 1650
83 Ga0395900_0282983 3300037418 Bacteria 1649
84 Ga0395900_0644369 3300037418 Bacteria 996
85 Ga0395898_0064407 3300037466 Bacteria 3555
86 Ga0395898_0179949 3300037466 Bacteria 2021
87 Ga0395898_0306248 3300037466 Bacteria 1515
88 Ga0395898_0316307 3300037466 Bacteria 1489
89 Ga0395898_0340837 3300037466 Bacteria 1429
90 Ga0395898_0350783 3300037466 Bacteria 1407
91 Ga0395898_0486983 3300037466 Bacteria 1173
92 Ga0395898_0577484 3300037466 Bacteria 1066
93 Ga0395905_0032564 3300037471 Bacteria 4902
94 Ga0395905_0118477 3300037471 Bacteria 2488
95 Ga0395905_0166509 3300037471 Bacteria 2071
96 Ga0395905_0178358 3300037471 Bacteria 1994
97 Ga0395905_0294614 3300037471 Bacteria 1509
98 Ga0395905_0383054 3300037471 Bacteria 1300
99 Ga0395905_0551867 3300037471 Bacteria 1053
100 Ga0395901_0000802 3300038443 Bacteria 34910
101 Ga0395901_0002761 3300038443 Bacteria 17695
102 Ga0395901_0063676 3300038443 Bacteria 3838
103 Ga0395901_0086147 3300038443 Bacteria 3284
104 Ga0395901_0122318 3300038443 Bacteria 2735
105 Ga0436361_0464788 3300039447 Bacteria 45703
106 Ga0436361_1116999 3300039447 Bacteria 7414
107 Ga0439448_0002623 3300042005 Bacteria 4903
108 Ga0439448_0023935 3300042005 Bacteria 1908
109 Ga0439449_0064111 3300042007 Bacteria 1355
110 Ga0439455_0016142 3300042012 Bacteria 1724
111 Ga0439458_0027775 3300042157 Bacteria 1336
112 Ga0466969_0053028 3300044656 Bacteria 1991
113 Ga0466969_0088962 3300044656 Bacteria 1465
114 Ga0466972_0000531 3300044658 Bacteria 18737
115 Ga0466972_0007567 3300044658 Bacteria 5453
116 Ga0466972_0031562 3300044658 Bacteria 2604
117 Ga0466972_0059169 3300044658 Bacteria 1839
118 Ga0466972_0081253 3300044658 Bacteria 1543
119 Ga0466972_0083607 3300044658 Bacteria 1518
120 Ga0466972_0126674 3300044658 Bacteria 1203
121 Ga0466972_0272886 3300044658 Bacteria 790
122 Ga0466982_0093989 3300044672 Bacteria 1858
123 Ga0466965_0000081 3300044683 Bacteria 27876
124 Ga0466965_0004866 3300044683 Bacteria 5996
125 Ga0466965_0015350 3300044683 Bacteria 3638
126 Ga0466965_0017319 3300044683 Bacteria 3443
127 Ga0466965_0029027 3300044683 Bacteria 2690
128 Ga0466965_0042815 3300044683 Bacteria 2234
129 Ga0466965_0092787 3300044683 Bacteria 1537
130 Ga0466966_0010056 3300044684 Bacteria 6271
131 Ga0466966_0061945 3300044684 Bacteria 2359
132 Ga0466966_0063660 3300044684 Bacteria 2323
133 Ga0466966_0071476 3300044684 Bacteria 2174
134 Ga0466963_0005854 3300044694 Bacteria 7243
135 Ga0466963_0006672 3300044694 Bacteria 6856
136 Ga0466964_0000264 3300044706 Bacteria 15122
137 Ga0466964_0001906 3300044706 Bacteria 7288
138 Ga0466964_0007997 3300044706 Bacteria 3960
139 Ga0466964_0024266 3300044706 Bacteria 2362
140 Ga0466964_0101657 3300044706 Bacteria 1268
141 Ga0466971_0020927 3300044719 Bacteria 2908
142 Ga0466968_0000169 3300044735 Bacteria 19913
143 Ga0466968_0002653 3300044735 Bacteria 6590
144 Ga0466968_0109985 3300044735 Bacteria 1238
145 Ga0466970_0019832 3300044765 Bacteria 3489
146 Ga0466970_0174354 3300044765 Bacteria 1192
147 Ga0466970_0247454 3300044765 Bacteria 998
148 Ga0466957_0006790 3300044842 Bacteria 6467
149 Ga0466957_0018184 3300044842 Bacteria 4124
150 Ga0466957_0086319 3300044842 Bacteria 1961
151 Ga0466957_0127145 3300044842 Bacteria 1629
152 Ga0466960_0028847 3300044901 Bacteria 2542
153 Ga0466960_0058429 3300044901 Bacteria 1884
154 Ga0466959_0011351 3300045049 Bacteria 6399
155 Ga0466959_0035556 3300045049 Bacteria 3683
156 Ga0466959_0042931 3300045049 Bacteria 3335
157 Ga0466959_0046829 3300045049 Bacteria 3182
158 Ga0466959_0117361 3300045049 Bacteria 1894
159 Ga0466959_0258367 3300045049 Bacteria 1199
160 Ga0466958_0016772 3300045836 Bacteria 4223
161 Ga0466967_0001340 3300045976 Bacteria 14128
162 Ga0466967_0118055 3300045976 Bacteria 2446
163 Ga0495617_000046 3300046452 Bacteria 115430
164 Ga0495627_000476 3300046453 Bacteria 33973
165 Ga0495627_006030 3300046453 Bacteria 4803
166 Ga0495603_0078479 3300046455 Bacteria 1936
167 Ga0495590_0000022 3300046457 Bacteria 205122
168 Ga0495590_0000134 3300046457 Bacteria 43957
169 Ga0495590_0000667 3300046457 Bacteria 15871
170 Ga0495590_0017693 3300046457 Bacteria 2561
171 Ga0495590_0021057 3300046457 Bacteria 2313
172 Ga0495590_0039896 3300046457 Bacteria 1638
173 Ga0495591_002206 3300046458 Bacteria 11117
174 Ga0495591_020195 3300046458 Bacteria 2206
175 Ga0495629_0197200 3300046459 Bacteria 1392
176 Ga0495638_0120085 3300046460 Bacteria 1554
177 Ga0495653_0013431 3300046463 Bacteria 6673
178 Ga0495653_0022020 3300046463 Bacteria 5158
179 Ga0495653_0122420 3300046463 Bacteria 1851
180 Ga0495650_0015423 3300046471 Bacteria 3920
181 Ga0495580_0051401 3300046472 Bacteria 2913
182 Ga0495582_0002206 3300046473 Bacteria 10901
183 Ga0495582_0059636 3300046473 Bacteria 2105
184 Ga0495605_0000284 3300046474 Bacteria 56120
185 Ga0495605_0001426 3300046474 Bacteria 15680
186 Ga0495605_0003995 3300046474 Bacteria 8714
187 Ga0495605_0026482 3300046474 Bacteria 3014
188 Ga0495605_0035703 3300046474 Bacteria 2511
189 Ga0495605_0050322 3300046474 Bacteria 2033
190 Ga0495605_0083097 3300046474 Bacteria 1495
191 Ga0495605_0085442 3300046474 Bacteria 1469
192 Ga0495605_0090299 3300046474 Bacteria 1420
193 Ga0495639_0150857 3300046475 Bacteria 1121
194 Ga0495639_0254359 3300046475 Bacteria 869
195 Ga0495664_0119106 3300046477 Bacteria 1597
196 Ga0495584_0000276 3300046491 Bacteria 36518
197 Ga0495584_0006196 3300046491 Bacteria 6275
198 Ga0495584_0013942 3300046491 Bacteria 4095
199 Ga0495584_0018200 3300046491 Bacteria 3573
200 Ga0495584_0055281 3300046491 Bacteria 1997
201 Ga0495584_0097980 3300046491 Bacteria 1481
202 Ga0495584_0105280 3300046491 Bacteria 1426
203 Ga0495584_0105996 3300046491 Bacteria 1421
204 Ga0495584_0205327 3300046491 Bacteria 1001
205 Ga0495585_0001106 3300046492 Bacteria 22204
206 Ga0495585_0004129 3300046492 Bacteria 9503
207 Ga0495585_0005355 3300046492 Bacteria 8099
208 Ga0495585_0005646 3300046492 Bacteria 7856
209 Ga0495585_0007166 3300046492 Bacteria 6846
210 Ga0495585_0008165 3300046492 Bacteria 6359
211 Ga0495585_0019057 3300046492 Bacteria 3959
212 Ga0495585_0066933 3300046492 Bacteria 1966
213 Ga0495585_0082923 3300046492 Bacteria 1735
214 Ga0495585_0116213 3300046492 Bacteria 1418
215 Ga0495594_0004047 3300046499 Bacteria 7538
216 Ga0495594_0008107 3300046499 Bacteria 5403
217 Ga0495594_0074071 3300046499 Bacteria 1896
218 Ga0495594_0151299 3300046499 Bacteria 1317
219 Ga0495594_0158138 3300046499 Bacteria 1287
220 Ga0495596_0000594 3300046500 Bacteria 22683
221 Ga0495596_0000600 3300046500 Bacteria 22620
222 Ga0495596_0004739 3300046500 Bacteria 6551
223 Ga0495596_0005389 3300046500 Bacteria 6049
224 Ga0495596_0015103 3300046500 Bacteria 3242
225 Ga0495596_0018248 3300046500 Bacteria 2894
226 Ga0495596_0058611 3300046500 Bacteria 1501
227 Ga0495596_0061201 3300046500 Bacteria 1466
228 Ga0495596_0066652 3300046500 Bacteria 1399
229 Ga0495596_0090638 3300046500 Bacteria 1186
230 Ga0495607_0001871 3300046501 Bacteria 17855
231 Ga0495607_0002451 3300046501 Bacteria 15080
232 Ga0495607_0004355 3300046501 Bacteria 10436
233 Ga0495607_0011719 3300046501 Bacteria 5819
234 Ga0495607_0019434 3300046501 Bacteria 4316
235 Ga0495607_0019735 3300046501 Bacteria 4276
236 Ga0495607_0021114 3300046501 Bacteria 4100
237 Ga0495607_0040788 3300046501 Bacteria 2761
238 Ga0495583_0002351 3300046506 Bacteria 16376
239 Ga0495583_0003232 3300046506 Bacteria 12729
240 Ga0495583_0025159 3300046506 Bacteria 2978
241 Ga0495583_0029088 3300046506 Bacteria 2707
242 Ga0495583_0030355 3300046506 Bacteria 2633
243 Ga0495583_0035814 3300046506 Bacteria 2365
244 Ga0495583_0202711 3300046506 Bacteria 805
245 Ga0495606_0003529 3300046507 Bacteria 16533
246 Ga0495606_0019736 3300046507 Bacteria 4998
247 Ga0495606_0094362 3300046507 Bacteria 1834
248 Ga0495606_0127514 3300046507 Bacteria 1516
249 Ga0495610_0048004 3300046512 Bacteria 2097
250 Ga0495610_0102200 3300046512 Bacteria 1282
251 Ga0495616_0002252 3300046513 Bacteria 12910
252 Ga0495616_0004841 3300046513 Bacteria 8433
253 Ga0495616_0005528 3300046513 Bacteria 7766
254 Ga0495616_0012956 3300046513 Bacteria 4715
255 Ga0495616_0019400 3300046513 Bacteria 3711
256 Ga0495616_0025042 3300046513 Bacteria 3192
257 Ga0495616_0026741 3300046513 Bacteria 3066
258 Ga0495616_0033059 3300046513 Bacteria 2698
259 Ga0495616_0065931 3300046513 Bacteria 1762
260 Ga0495616_0082481 3300046513 Bacteria 1535
261 Ga0495620_0005899 3300046515 Bacteria 6794
262 Ga0495630_0006276 3300046517 Bacteria 8442
263 Ga0495630_0090104 3300046517 Bacteria 2317
264 Ga0495631_0000279 3300046518 Bacteria 35571
265 Ga0495631_0000531 3300046518 Bacteria 25562
266 Ga0495631_0002375 3300046518 Bacteria 10686
267 Ga0495631_0006597 3300046518 Bacteria 5973
268 Ga0495631_0006801 3300046518 Bacteria 5869
269 Ga0495631_0015167 3300046518 Bacteria 3701
270 Ga0495631_0024140 3300046518 Bacteria 2809
271 Ga0495631_0024892 3300046518 Bacteria 2760
272 Ga0495631_0035592 3300046518 Bacteria 2226
273 Ga0495631_0046955 3300046518 Bacteria 1897
274 Ga0495631_0112034 3300046518 Bacteria 1173
275 Ga0495632_0002996 3300046519 Bacteria 12347
276 Ga0495632_0003125 3300046519 Bacteria 11983
277 Ga0495632_0003723 3300046519 Bacteria 10682
278 Ga0495632_0013892 3300046519 Bacteria 4575
279 Ga0495632_0016321 3300046519 Bacteria 4134
280 Ga0495632_0031491 3300046519 Bacteria 2740
281 Ga0495632_0087829 3300046519 Bacteria 1477
282 Ga0495637_0000349 3300046520 Bacteria 35312
283 Ga0495637_0048420 3300046520 Bacteria 1790
284 Ga0495637_0055861 3300046520 Bacteria 1636
285 Ga0495637_0092847 3300046520 Bacteria 1188
286 Ga0495643_0000931 3300046522 Bacteria 30502
287 Ga0495643_0001000 3300046522 Bacteria 28866
288 Ga0495643_0004741 3300046522 Bacteria 9408
289 Ga0495643_0017934 3300046522 Bacteria 4126
290 Ga0495643_0036859 3300046522 Bacteria 2684
291 Ga0495643_0051995 3300046522 Bacteria 2201
292 Ga0495643_0071716 3300046522 Bacteria 1817
293 Ga0495644_0000610 3300046523 Bacteria 15022
294 Ga0495644_0003512 3300046523 Bacteria 6201
295 Ga0495644_0024480 3300046523 Bacteria 2296
296 Ga0495644_0026688 3300046523 Bacteria 2190
297 Ga0495644_0030289 3300046523 Bacteria 2043
298 Ga0495644_0040171 3300046523 Bacteria 1763
299 Ga0495644_0150209 3300046523 Bacteria 891
300 Ga0495648_0005224 3300046524 Bacteria 10861
301 Ga0495648_0005352 3300046524 Bacteria 10693
302 Ga0495648_0005486 3300046524 Bacteria 10526
303 Ga0495648_0030634 3300046524 Bacteria 3553
304 Ga0495648_0035234 3300046524 Bacteria 3246
305 Ga0495648_0084338 3300046524 Bacteria 1798
306 Ga0495648_0087630 3300046524 Bacteria 1752
307 Ga0495648_0102848 3300046524 Bacteria 1572
308 Ga0495666_0000466 3300046526 Bacteria 18005
309 Ga0495666_0030120 3300046526 Bacteria 2665
310 Ga0495666_0041447 3300046526 Bacteria 2229
311 Ga0495642_0000241 3300046528 Bacteria 30854
312 Ga0495642_0000278 3300046528 Bacteria 28979
313 Ga0495642_0001633 3300046528 Bacteria 9756
314 Ga0495642_0002200 3300046528 Bacteria 7994
315 Ga0495642_0009606 3300046528 Bacteria 3701
316 Ga0495642_0014157 3300046528 Bacteria 3091
317 Ga0495642_0025070 3300046528 Bacteria 2362
318 Ga0495642_0027588 3300046528 Bacteria 2260
319 Ga0495642_0043996 3300046528 Bacteria 1822
320 Ga0495642_0048915 3300046528 Bacteria 1736
321 Ga0495642_0075134 3300046528 Bacteria 1417
322 Ga0495642_0127060 3300046528 Bacteria 1096
323 Ga0495642_0177886 3300046528 Bacteria 925
324 Ga0495642_0194976 3300046528 Bacteria 882
325 Ga0495652_0020738 3300046529 Bacteria 5842
326 Ga0495654_0005547 3300046530 Bacteria 7311
327 Ga0495654_0006647 3300046530 Bacteria 6544
328 Ga0495654_0062018 3300046530 Bacteria 1793
329 Ga0495654_0062339 3300046530 Bacteria 1788
330 Ga0495654_0181351 3300046530 Bacteria 912
331 Ga0495665_0030695 3300046531 Bacteria 2876
332 Ga0495665_0033808 3300046531 Bacteria 2734
333 Ga0495665_0305801 3300046531 Bacteria 813
334 Ga0495586_0023440 3300046535 Bacteria 3296
335 Ga0495586_0025894 3300046535 Bacteria 3138
336 Ga0495586_0244045 3300046535 Bacteria 1024
337 Ga0495587_0014574 3300046536 Bacteria 4926
338 Ga0495587_0147059 3300046536 Bacteria 1343
339 Ga0495609_0000005 3300046538 Bacteria 439165
340 Ga0495609_0001425 3300046538 Bacteria 15920
341 Ga0495609_0003420 3300046538 Bacteria 9099
342 Ga0495609_0021634 3300046538 Bacteria 2967
343 Ga0495609_0022303 3300046538 Bacteria 2916
344 Ga0495609_0037765 3300046538 Bacteria 2178
345 Ga0495609_0055048 3300046538 Bacteria 1765
346 Ga0495609_0066040 3300046538 Bacteria 1594
347 Ga0495609_0099081 3300046538 Bacteria 1263
348 Ga0495597_0000880 3300046542 Bacteria 23368
349 Ga0495597_0002096 3300046542 Bacteria 13271
350 Ga0495597_0004135 3300046542 Bacteria 8069
351 Ga0495597_0047563 3300046542 Bacteria 1898
352 Ga0495597_0049537 3300046542 Bacteria 1856
353 Ga0495597_0100609 3300046542 Bacteria 1219
354 Ga0495622_0035331 3300046557 Bacteria 2330
355 Ga0495622_0042329 3300046557 Bacteria 2117
356 Ga0495622_0061380 3300046557 Bacteria 1740
357 Ga0495633_0011807 3300046558 Bacteria 4685
358 Ga0495633_0013063 3300046558 Bacteria 4391
359 Ga0495633_0030712 3300046558 Bacteria 2608
360 Ga0495633_0030798 3300046558 Bacteria 2604
361 Ga0495633_0032646 3300046558 Bacteria 2514
362 Ga0495633_0064408 3300046558 Bacteria 1713
363 Ga0495656_0036948 3300046615 Bacteria 2014
364 Ga0495656_0113752 3300046615 Bacteria 1269
365 Ga0495656_0147750 3300046615 Bacteria 1133
366 Ga0495668_0000906 3300046616 Bacteria 33252
367 Ga0495668_0004601 3300046616 Bacteria 9707
368 Ga0495668_0005242 3300046616 Bacteria 8880
369 Ga0495668_0026929 3300046616 Bacteria 3260
370 Ga0495668_0036360 3300046616 Bacteria 2759
371 Ga0495668_0045599 3300046616 Bacteria 2438
372 Ga0495668_0059787 3300046616 Bacteria 2102
373 Ga0495668_0223003 3300046616 Bacteria 1032
374 Ga0495634_0021905 3300046642 Bacteria 4508
375 Ga0495611_0001207 3300046648 Bacteria 13363
376 Ga0495611_0001446 3300046648 Bacteria 11803
377 Ga0495611_0057854 3300046648 Bacteria 1757
378 Ga0495625_0006205 3300046660 Bacteria 10707
379 Ga0495625_0017099 3300046660 Bacteria 5684
380 Ga0495625_0205452 3300046660 Bacteria 1297
381 Ga0495625_0219347 3300046660 Bacteria 1247
382 Ga0495625_0345485 3300046660 Bacteria 942
383 Ga0495659_0161098 3300046664 Bacteria 906
384 Ga0495661_0000578 3300046665 Bacteria 38058
385 Ga0495661_0003483 3300046665 Bacteria 11603
386 Ga0495661_0003873 3300046665 Bacteria 10934
387 Ga0495661_0004130 3300046665 Bacteria 10573
388 Ga0495661_0005408 3300046665 Bacteria 9080
389 Ga0495661_0015188 3300046665 Bacteria 5141
390 Ga0495661_0020565 3300046665 Bacteria 4307
391 Ga0495661_0021095 3300046665 Bacteria 4250
392 Ga0495661_0031943 3300046665 Bacteria 3332
393 Ga0495661_0039435 3300046665 Bacteria 2935
394 Ga0495661_0041190 3300046665 Bacteria 2859
395 Ga0495661_0053209 3300046665 Bacteria 2435
396 Ga0495661_0054166 3300046665 Bacteria 2409
397 Ga0495661_0064250 3300046665 Bacteria 2166
398 Ga0495661_0072136 3300046665 Bacteria 2015
399 Ga0495661_0140829 3300046665 Bacteria 1312
400 Ga0495661_0176417 3300046665 Bacteria 1135
401 Ga0495661_0238580 3300046665 Bacteria 934
402 Ga0495588_0000139 3300046674 Bacteria 109955
403 Ga0495588_0000570 3300046674 Bacteria 17592
404 Ga0495588_0001750 3300046674 Bacteria 9244
405 Ga0495588_0002065 3300046674 Bacteria 8596
406 Ga0495588_0007737 3300046674 Bacteria 4909
407 Ga0495588_0030933 3300046674 Bacteria 2692
408 Ga0495588_0031581 3300046674 Bacteria 2666
409 Ga0495588_0068333 3300046674 Bacteria 1845
410 Ga0495588_0095071 3300046674 Bacteria 1562
411 Ga0495588_0098515 3300046674 Bacteria 1535
412 Ga0495588_0117213 3300046674 Bacteria 1403
413 Ga0495669_0000301 3300046684 Bacteria 27468
414 Ga0495669_0002255 3300046684 Bacteria 7906
415 Ga0495669_0002957 3300046684 Bacteria 6983
416 Ga0495669_0028829 3300046684 Bacteria 2432
417 Ga0495669_0080497 3300046684 Bacteria 1495
418 Ga0495669_0085425 3300046684 Bacteria 1452
419 Ga0495669_0090749 3300046684 Bacteria 1410
420 Ga0495613_0006245 3300046689 Bacteria 8913
421 Ga0495613_0087354 3300046689 Bacteria 2260
422 Ga0495624_0005759 3300046690 Bacteria 8882
423 Ga0495670_0001886 3300046691 Bacteria 10323
424 Ga0495670_0027484 3300046691 Bacteria 2819
425 Ga0495670_0030998 3300046691 Bacteria 2656
426 Ga0495670_0085678 3300046691 Bacteria 1608
427 Ga0495671_0004011 3300046692 Bacteria 8897
428 Ga0495671_0010168 3300046692 Bacteria 5228
429 Ga0495671_0036841 3300046692 Bacteria 2476
430 Ga0495671_0138228 3300046692 Bacteria 1187
431 Ga0495649_0001375 3300046694 Bacteria 18424
432 Ga0495649_0001574 3300046694 Bacteria 17076
433 Ga0495649_0016745 3300046694 Bacteria 4150
434 Ga0495649_0022389 3300046694 Bacteria 3536
435 Ga0495649_0153043 3300046694 Bacteria 1211
436 Ga0495589_0000277 3300046794 Bacteria 41776
437 Ga0495589_0000473 3300046794 Bacteria 29321
438 Ga0495589_0000595 3300046794 Bacteria 24705
439 Ga0495589_0019026 3300046794 Bacteria 3522
440 Ga0495589_0022821 3300046794 Bacteria 3190
441 Ga0495589_0030730 3300046794 Bacteria 2704
442 Ga0495589_0064818 3300046794 Bacteria 1791
443 Ga0495589_0130990 3300046794 Bacteria 1204
444 Ga0495589_0133907 3300046794 Bacteria 1189
445 Ga0495600_0138664 3300046809 Bacteria 1578
446 Ga0495660_0001919 3300046810 Bacteria 13580
447 Ga0495660_0001935 3300046810 Bacteria 13482
448 Ga0495660_0006823 3300046810 Bacteria 6733
449 Ga0495660_0012207 3300046810 Bacteria 4986
450 Ga0495660_0013977 3300046810 Bacteria 4654
451 Ga0495660_0034353 3300046810 Bacteria 2838
452 Ga0495660_0045857 3300046810 Bacteria 2398
453 Ga0495581_0014591 3300047315 Bacteria 4555
454 Ga0495581_0014663 3300047315 Bacteria 4544
455 Ga0495604_0002301 3300047317 Bacteria 15306
456 Ga0495604_0094516 3300047317 Bacteria 2209
457 Ga0495604_0129966 3300047317 Bacteria 1811
458 Ga0495636_0135371 3300047318 Bacteria 1098
459 Ga0495636_0136936 3300047318 Bacteria 1092
460 Ga0495674_0151649 3300047319 Bacteria 1943
461 Ga0495672_0000529 3300047320 Bacteria 43533
462 Ga0495672_0000732 3300047320 Bacteria 36104
463 Ga0495672_0000769 3300047320 Bacteria 34882
464 Ga0495672_0000931 3300047320 Bacteria 30567
465 Ga0495672_0009044 3300047320 Bacteria 7263
466 Ga0495672_0054298 3300047320 Bacteria 2342
467 Ga0495676_0000099 3300047321 Bacteria 65701
468 Ga0495676_0024625 3300047321 Bacteria 5207
469 Ga0495676_0088016 3300047321 Bacteria 2331
470 Ga0495680_0081255 3300047322 Bacteria 2447
471 Ga0495680_0088236 3300047322 Bacteria 2331
472 Ga0495683_0003551 3300047323 Bacteria 9063
473 Ga0495683_0003960 3300047323 Bacteria 8522
474 Ga0495683_0022101 3300047323 Bacteria 3273
475 Ga0495683_0029460 3300047323 Bacteria 2805
476 Ga0495687_000221 3300047443 Bacteria 80968
477 Ga0495687_001071 3300047443 Bacteria 26962
478 Ga0495687_001138 3300047443 Bacteria 25784
479 Ga0495675_0025639 3300047444 Bacteria 3757
480 Ga0495675_0212833 3300047444 Bacteria 1172
481 Ga0495677_0000060 3300047445 Bacteria 61831
482 Ga0495677_0000361 3300047445 Bacteria 19630
483 Ga0495677_0001077 3300047445 Bacteria 10965
484 Ga0495677_0006870 3300047445 Bacteria 4280
485 Ga0495677_0015928 3300047445 Bacteria 2729
486 Ga0495677_0030062 3300047445 Bacteria 1976
487 Ga0495677_0043523 3300047445 Bacteria 1646
488 Ga0495677_0063915 3300047445 Bacteria 1367
489 Ga0495679_002156 3300047446 Bacteria 10339
490 Ga0495679_002864 3300047446 Bacteria 8552
491 Ga0495679_028418 3300047446 Bacteria 1835
492 Ga0495673_0005475 3300047469 Bacteria 7667
493 Ga0495681_0002347 3300047470 Bacteria 13587
494 Ga0495681_0003675 3300047470 Bacteria 10650
495 Ga0495681_0004163 3300047470 Bacteria 9939
496 Ga0495681_0022997 3300047470 Bacteria 3323
497 Ga0495681_0025158 3300047470 Bacteria 3119
498 Ga0495681_0025226 3300047470 Bacteria 3113
499 Ga0495681_0052401 3300047470 Bacteria 1915
500 Ga0495681_0059095 3300047470 Bacteria 1774
501 Ga0495681_0067184 3300047470 Bacteria 1634
502 Ga0495681_0093269 3300047470 Bacteria 1326
503 Ga0495686_0000589 3300047472 Bacteria 51250
504 Ga0495686_0001068 3300047472 Bacteria 32627
505 Ga0495686_0175713 3300047472 Bacteria 1243
506 Ga0495593_0005273 3300047673 Bacteria 7637
507 Ga0495593_0047806 3300047673 Bacteria 2275
508 Ga0495602_0020996 3300048088 Bacteria 6436
509 Ga0495602_0090925 3300048088 Bacteria 2533
510 Ga0495615_0011986 3300048090 Bacteria 1777
511 Ga0495626_0000196 3300048091 Bacteria 73575
512 Ga0495626_0000550 3300048091 Bacteria 37251
513 Ga0495626_0001712 3300048091 Bacteria 16801
514 Ga0495626_0002853 3300048091 Bacteria 11536
515 Ga0495626_0003196 3300048091 Bacteria 10648
516 Ga0495626_0005686 3300048091 Bacteria 7218
517 Ga0495626_0006078 3300048091 Bacteria 6931
518 Ga0495626_0007814 3300048091 Bacteria 5925
519 Ga0495626_0008705 3300048091 Bacteria 5530
520 Ga0495626_0010787 3300048091 Bacteria 4855
521 Ga0495626_0025830 3300048091 Bacteria 2868
522 Ga0495626_0042076 3300048091 Bacteria 2148
523 Ga0495626_0043867 3300048091 Bacteria 2096
524 Ga0495626_0073844 3300048091 Bacteria 1527
525 Ga0495626_0192035 3300048091 Bacteria 841
526 Ga0496100_0052884 3300048903 Bacteria 2642
527 Ga0496101_0073780 3300048904 Bacteria 2507
528 Ga0496101_0278456 3300048904 Bacteria 1307
529 Ga0496102_0000097 3300048905 Bacteria 124414
530 Ga0496102_0000670 3300048905 Bacteria 34263
531 Ga0496102_0022099 3300048905 Bacteria 5635
532 Ga0496102_0098686 3300048905 Bacteria 2710
533 Ga0496102_0428866 3300048905 Bacteria 1242
534 Ga0496103_0033047 3300048906 Bacteria 3159
535 Ga0496103_0039736 3300048906 Bacteria 2891
536 Ga0496104_0625987 3300048907 Bacteria 986
537 Ga0496106_0007323 3300048909 Bacteria 8155
538 Ga0496106_0120718 3300048909 Bacteria 2049
539 Ga0496109_0008655 3300048912 Bacteria 8662
540 Ga0496110_0000333 3300048913 Bacteria 31529
541 Ga0496110_0060986 3300048913 Bacteria 3327
542 Ga0496110_0301659 3300048913 Bacteria 1459
543 Ga0496111_0155289 3300048914 Bacteria 1698
544 Ga0496111_0283756 3300048914 Bacteria 1228
545 Ga0496111_0571592 3300048914 Bacteria 829
546 Ga0496112_0139910 3300048915 Bacteria 2390
547 Ga0496112_0613648 3300048915 Bacteria 1019
548 Ga0496115_0021890 3300048918 Bacteria 4943
549 Ga0496122_0001500 3300048925 Bacteria 37270
550 Ga0496122_0002554 3300048925 Bacteria 25576
551 Ga0496123_0002561 3300048926 Bacteria 22137
552 Ga0496123_0007296 3300048926 Bacteria 10487
553 Ga0496124_0003131 3300048927 Bacteria 20504
554 Ga0496124_0006285 3300048927 Bacteria 12982
555 Ga0496124_0007580 3300048927 Bacteria 11507
556 Ga0496124_0012297 3300048927 Bacteria 8455
557 Ga0496124_0054541 3300048927 Bacteria 3383
558 Ga0496124_0060642 3300048927 Bacteria 3173
559 Ga0496124_0143142 3300048927 Bacteria 1884
560 Ga0496124_0211201 3300048927 Bacteria 1468
561 Ga0496125_0087226 3300048928 Bacteria 2358
562 Ga0495678_000146 3300049459 Bacteria 85995
563 Ga0495678_000561 3300049459 Bacteria 35692
564 Ga0495678_002372 3300049459 Bacteria 12917
565 Ga0495678_003259 3300049459 Bacteria 10148
566 Ga0495682_0000933 3300049460 Bacteria 17731
567 Ga0501036_0095662 3300049572 Bacteria 2511
568 Ga0501047_0139018 3300049581 Bacteria 2308
569 Ga0501279_003690 3300049775 Bacteria 2001
570 Ga0501035_0002697 3300049822 Bacteria 17270
571 Ga0500594_0013039 3300053118 Bacteria 1969
572 Ga0587066_005713 3300059490 Bacteria 1606
573 Ga0587066_016463 3300059490 Bacteria 1165
574 Ga0587070_016841 3300059491 Bacteria 1176
575 Ga0587077_009031 3300059493 Bacteria 1501
576 Ga0587080_004871 3300059503 Bacteria 1771
577 Ga0587080_030397 3300059503 Bacteria 938
578 Ga0587082_005022 3300059504 Bacteria 1697
579 Ga0587082_013619 3300059504 Bacteria 1228
580 Ga0587083_0018635 3300059505 Bacteria 1258
581 Ga0587091_053259 3300059511 Bacteria 838
582 Ga0587106_010563 3300059605 Bacteria 1200
583 Ga0587099_013119 3300059622 Bacteria 860
584 Ga0587101_027868 3300059623 Bacteria 862
585 Ga0587067_046343 3300059640 Bacteria 864
586 Ga0587068_006558 3300059641 Bacteria 1634
587 Ga0587079_009955 3300059647 Bacteria 1494
588 Ga0587079_015134 3300059647 Bacteria 1305
589 Ga0587100_007859 3300059648 Bacteria 851
590 Ga0587102_003081 3300059649 Bacteria 1334
591 Ga0587105_004614 3300059651 Bacteria 887
592 Ga0587107_025725 3300059652 Bacteria 859
593 Ga0587124_008344 3300059660 Bacteria 887
594 Ga0466962_0040669 3300061719 Bacteria 2224
595 Ga0466962_0054097 3300061719 Bacteria 1918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0150857 Ga0495639_0150857_472_1110 212
2 3300046518 Ga0495631_0024140 Ga0495631_0024140_369_1025 216
3 3300046542 Ga0495597_0049537 Ga0495597_0049537_172_918 216
4 3300047470 Ga0495681_0059095 Ga0495681_0059095_520_1260 216
5 3300049775 Ga0501279_003690 Ga0501279_003690_534_1229 217
6 3300046665 Ga0495661_0021095 Ga0495661_0021095_3157_3846 219
7 3300048091 Ga0495626_0003196 Ga0495626_0003196_9491_10180 219
8 3300048918 Ga0496115_0021890 Ga0496115_0021890_151_879 219
9 3300039447 Ga0436361_1116999 Ga0436361_1116999_854_1585 222
10 3300046674 Ga0495588_0098515 Ga0495588_0098515_115_867 223
11 3300044658 Ga0466972_0272886 Ga0466972_0272886_54_734 224
12 3300046538 Ga0495609_0099081 Ga0495609_0099081_46_738 224
13 3300046492 Ga0495585_0066933 Ga0495585_0066933_429_1115 227
14 3300046500 Ga0495596_0000594 Ga0495596_0000594_1279_1965 227
15 3300046500 Ga0495596_0015103 Ga0495596_0015103_2450_3169 227
16 3300046558 Ga0495633_0030798 Ga0495633_0030798_612_1298 227
17 3300046615 Ga0495656_0113752 Ga0495656_0113752_397_1083 227
18 3300046684 Ga0495669_0002255 Ga0495669_0002255_1645_2331 227
19 3300047470 Ga0495681_0052401 Ga0495681_0052401_778_1464 227
20 3300046506 Ga0495583_0202711 Ga0495583_0202711_80_772 228
21 3300046794 Ga0495589_0064818 Ga0495589_0064818_782_1474 228
22 3300048907 Ga0496104_0625987 Ga0496104_0625987_281_973 228
23 3300046523 Ga0495644_0150209 Ga0495644_0150209_122_814 229
24 3300046530 Ga0495654_0181351 Ga0495654_0181351_37_729 229
25 3300046457 Ga0495590_0000667 Ga0495590_0000667_7551_8339 230
26 3300046491 Ga0495584_0105996 Ga0495584_0105996_254_952 230
27 3300046524 Ga0495648_0087630 Ga0495648_0087630_295_1050 230
28 3300048925 Ga0496122_0001500 Ga0496122_0001500_5206_5964 230
29 3300048926 Ga0496123_0002561 Ga0496123_0002561_1452_2210 230
30 3300053118 Ga0500594_0013039 Ga0500594_0013039_108_863 230
31 3300042005 Ga0439448_0002623 Ga0439448_0002623_3466_4161 231
32 3300042012 Ga0439455_0016142 Ga0439455_0016142_1012_1707 231
33 3300044694 Ga0466963_0005854 Ga0466963_0005854_4756_5583 231
34 3300046526 Ga0495666_0030120 Ga0495666_0030120_663_1403 232
35 3300046531 Ga0495665_0030695 Ga0495665_0030695_893_1633 232
36 3300046535 Ga0495586_0244045 Ga0495586_0244045_137_877 232
37 3300046557 Ga0495622_0042329 Ga0495622_0042329_761_1501 232
38 3300046660 Ga0495625_0017099 Ga0495625_0017099_3766_4506 232
39 3300046660 Ga0495625_0219347 Ga0495625_0219347_118_858 232
40 3300046674 Ga0495588_0001750 Ga0495588_0001750_7941_8681 232
41 3300046690 Ga0495624_0005759 Ga0495624_0005759_3281_4021 232
42 3300047315 Ga0495581_0014591 Ga0495581_0014591_3431_4171 232
43 3300047317 Ga0495604_0129966 Ga0495604_0129966_541_1281 232
44 3300047321 Ga0495676_0088016 Ga0495676_0088016_101_841 232
45 3300047444 Ga0495675_0212833 Ga0495675_0212833_55_795 232
46 3300026041 Ga0207639_10388017 Ga0207639_103880172 233
47 3300031838 Ga0307518_10176242 Ga0307518_101762422 234
48 3300037312 Ga0395899_0096430 Ga0395899_0096430_344_1051 235
49 3300037418 Ga0395900_0047947 Ga0395900_0047947_102_809 235
50 3300044683 Ga0466965_0015350 Ga0466965_0015350_1656_2363 235
51 3300045049 Ga0466959_0035556 Ga0466959_0035556_2492_3199 235
52 3300046674 Ga0495588_0068333 Ga0495588_0068333_834_1586 237
53 3300047320 Ga0495672_0000931 Ga0495672_0000931_18034_18780 237
54 3300048903 Ga0496100_0052884 Ga0496100_0052884_1169_1915 237
55 iso_pu_bacteria 2643221556 2643801527 237
56 iso_pu_bacteria 2643221684 2644471411 237
57 3300005262 Ga0065165_1019263 Ga0065165_10192632 238
58 3300020080 Ga0206350_10202215 Ga0206350_102022152 238
59 3300044658 Ga0466972_0007567 Ga0466972_0007567_2457_3203 238
60 3300044658 Ga0466972_0081253 Ga0466972_0081253_507_1253 238
61 3300044672 Ga0466982_0093989 Ga0466982_0093989_1094_1825 238
62 3300044683 Ga0466965_0004866 Ga0466965_0004866_5186_5932 238
63 3300044683 Ga0466965_0017319 Ga0466965_0017319_1122_1868 238
64 3300044683 Ga0466965_0092787 Ga0466965_0092787_381_1127 238
65 3300044684 Ga0466966_0061945 Ga0466966_0061945_1083_1829 238
66 3300044706 Ga0466964_0001906 Ga0466964_0001906_193_939 238
67 3300044735 Ga0466968_0000169 Ga0466968_0000169_4113_4859 238
68 3300044765 Ga0466970_0247454 Ga0466970_0247454_197_943 238
69 3300044842 Ga0466957_0006790 Ga0466957_0006790_4054_4800 238
70 3300044842 Ga0466957_0086319 Ga0466957_0086319_318_1064 238
71 3300044901 Ga0466960_0028847 Ga0466960_0028847_1676_2422 238
72 3300045049 Ga0466959_0042931 Ga0466959_0042931_1502_2248 238
73 3300045049 Ga0466959_0258367 Ga0466959_0258367_305_1051 238
74 3300046463 Ga0495653_0013431 Ga0495653_0013431_5915_6661 238
75 3300046492 Ga0495585_0007166 Ga0495585_0007166_3015_3761 238
76 3300046492 Ga0495585_0019057 Ga0495585_0019057_3127_3873 238
77 3300046499 Ga0495594_0074071 Ga0495594_0074071_615_1364 238
78 3300046507 Ga0495606_0019736 Ga0495606_0019736_2708_3454 238
79 3300046507 Ga0495606_0127514 Ga0495606_0127514_692_1447 238
80 3300046515 Ga0495620_0005899 Ga0495620_0005899_5853_6599 238
81 3300046522 Ga0495643_0051995 Ga0495643_0051995_868_1614 238
82 3300046524 Ga0495648_0005486 Ga0495648_0005486_5253_5999 238
83 3300046528 Ga0495642_0075134 Ga0495642_0075134_110_874 238
84 3300046528 Ga0495642_0194976 Ga0495642_0194976_63_809 238
85 3300046536 Ga0495587_0147059 Ga0495587_0147059_484_1251 238
86 3300046558 Ga0495633_0011807 Ga0495633_0011807_2475_3221 238
87 3300046665 Ga0495661_0015188 Ga0495661_0015188_3500_4246 238
88 3300046665 Ga0495661_0020565 Ga0495661_0020565_1569_2315 238
89 3300046665 Ga0495661_0039435 Ga0495661_0039435_1918_2664 238
90 3300046674 Ga0495588_0000139 Ga0495588_0000139_68995_69741 238
91 3300046674 Ga0495588_0007737 Ga0495588_0007737_48_797 238
92 3300046684 Ga0495669_0080497 Ga0495669_0080497_720_1466 238
93 3300046691 Ga0495670_0027484 Ga0495670_0027484_1648_2394 238
94 3300046810 Ga0495660_0006823 Ga0495660_0006823_237_983 238
95 3300046810 Ga0495660_0012207 Ga0495660_0012207_3501_4253 238
96 3300047322 Ga0495680_0081255 Ga0495680_0081255_1042_1809 238
97 3300047470 Ga0495681_0022997 Ga0495681_0022997_142_888 238
98 3300048915 Ga0496112_0139910 Ga0496112_0139910_974_1720 238
99 3300048927 Ga0496124_0143142 Ga0496124_0143142_653_1399 238
100 3300049572 Ga0501036_0095662 Ga0501036_0095662_230_976 238
101 3300005327 Ga0070658_10026170 Ga0070658_100261703 239
102 3300025909 Ga0207705_10003544 Ga0207705_100035442 239
103 3300037471 Ga0395905_0032564 Ga0395905_0032564_2808_3539 239
104 3300044658 Ga0466972_0000531 Ga0466972_0000531_15391_16143 239
105 3300044658 Ga0466972_0031562 Ga0466972_0031562_61_807 239
106 3300044683 Ga0466965_0000081 Ga0466965_0000081_18417_19163 239
107 3300044706 Ga0466964_0007997 Ga0466964_0007997_1298_2044 239
108 3300044735 Ga0466968_0109985 Ga0466968_0109985_242_988 239
109 3300044901 Ga0466960_0058429 Ga0466960_0058429_801_1547 239
110 3300046506 Ga0495583_0029088 Ga0495583_0029088_893_1630 239
111 3300046542 Ga0495597_0047563 Ga0495597_0047563_63_800 239
112 3300059490 Ga0587066_005713 Ga0587066_005713_479_1210 239
113 3300005563 Ga0068855_100196905 Ga0068855_1001969053 240
114 3300021361 Ga0213872_10000944 Ga0213872_1000094417 240
115 3300025949 Ga0207667_10135988 Ga0207667_101359883 240
116 3300039447 Ga0436361_0464788 Ga0436361_0464788_20865_21602 240
117 3300046538 Ga0495609_0001425 Ga0495609_0001425_14373_15122 240
118 3300046665 Ga0495661_0140829 Ga0495661_0140829_293_1048 240
119 3300046794 Ga0495589_0133907 Ga0495589_0133907_111_860 240
120 3300048927 Ga0496124_0060642 Ga0496124_0060642_2278_3066 240
121 3300048927 Ga0496124_0211201 Ga0496124_0211201_133_888 240
122 iso_pu_bacteria 2885080285 2885086505 240
123 3300044706 Ga0466964_0101657 Ga0466964_0101657_190_963 241
124 3300044719 Ga0466971_0020927 Ga0466971_0020927_887_1705 241
125 3300044842 Ga0466957_0018184 Ga0466957_0018184_726_1499 241
126 3300044842 Ga0466957_0127145 Ga0466957_0127145_68_904 241
127 3300046615 Ga0495656_0036948 Ga0495656_0036948_15_788 241
128 3300046810 Ga0495660_0013977 Ga0495660_0013977_3048_3821 241
129 3300048091 Ga0495626_0002853 Ga0495626_0002853_8492_9265 241
130 3300049581 Ga0501047_0139018 Ga0501047_0139018_1195_1968 241
131 3300061719 Ga0466962_0054097 Ga0466962_0054097_619_1437 241
132 3300013102 Ga0157371_10000153 Ga0157371_1000015310 242
133 3300014497 Ga0182008_10026963 Ga0182008_100269634 242
134 3300015261 Ga0182006_1034670 Ga0182006_10346703 242
135 3300044683 Ga0466965_0029027 Ga0466965_0029027_1222_1959 242
136 3300046492 Ga0495585_0082923 Ga0495585_0082923_562_1290 242
137 3300046507 Ga0495606_0003529 Ga0495606_0003529_10760_11488 242
138 3300046518 Ga0495631_0024892 Ga0495631_0024892_1043_1771 242
139 3300046528 Ga0495642_0002200 Ga0495642_0002200_219_947 242
140 3300046558 Ga0495633_0030712 Ga0495633_0030712_638_1366 242
141 3300046665 Ga0495661_0005408 Ga0495661_0005408_7775_8503 242
142 3300046692 Ga0495671_0010168 Ga0495671_0010168_296_1024 242
143 3300048927 Ga0496124_0007580 Ga0496124_0007580_6913_7647 242
144 3300046616 Ga0495668_0223003 Ga0495668_0223003_60_848 243
145 3300047321 Ga0495676_0024625 Ga0495676_0024625_2518_3252 243
146 3300009036 Ga0105244_10005736 Ga0105244_100057367 244
147 3300046474 Ga0495605_0085442 Ga0495605_0085442_363_1100 244
148 3300046492 Ga0495585_0001106 Ga0495585_0001106_7568_8305 244
149 3300046500 Ga0495596_0000600 Ga0495596_0000600_745_1482 244
150 3300046518 Ga0495631_0046955 Ga0495631_0046955_259_996 244
151 3300046522 Ga0495643_0071716 Ga0495643_0071716_533_1270 244
152 3300046528 Ga0495642_0127060 Ga0495642_0127060_196_933 244
153 3300046616 Ga0495668_0026929 Ga0495668_0026929_1206_1943 244
154 3300046674 Ga0495588_0002065 Ga0495588_0002065_3579_4316 244
155 3300046691 Ga0495670_0030998 Ga0495670_0030998_1521_2258 244
156 3300047320 Ga0495672_0054298 Ga0495672_0054298_132_869 244
157 3300047445 Ga0495677_0043523 Ga0495677_0043523_450_1187 244
158 3300047469 Ga0495673_0005475 Ga0495673_0005475_2572_3309 244
159 iso_pu_bacteria 2643221556 2643797169 244
160 iso_pu_bacteria 2643221684 2644469727 244
161 iso_pu_bacteria 2808606418 2809147467 244
162 iso_pu_bacteria 8047673197 8047676545 244
163 3300046459 Ga0495629_0197200 Ga0495629_0197200_246_986 245
164 3300046463 Ga0495653_0122420 Ga0495653_0122420_414_1154 245
165 3300046473 Ga0495582_0059636 Ga0495582_0059636_200_940 245
166 3300046475 Ga0495639_0254359 Ga0495639_0254359_40_780 245
167 3300046517 Ga0495630_0090104 Ga0495630_0090104_124_864 245
168 3300046526 Ga0495666_0041447 Ga0495666_0041447_982_1722 245
169 3300046531 Ga0495665_0305801 Ga0495665_0305801_47_787 245
170 3300046535 Ga0495586_0025894 Ga0495586_0025894_1439_2179 245
171 3300046557 Ga0495622_0061380 Ga0495622_0061380_657_1397 245
172 3300046689 Ga0495613_0087354 Ga0495613_0087354_1222_1962 245
173 3300046809 Ga0495600_0138664 Ga0495600_0138664_63_803 245
174 3300047317 Ga0495604_0094516 Ga0495604_0094516_478_1218 245
175 3300047319 Ga0495674_0151649 Ga0495674_0151649_797_1537 245
176 3300047472 Ga0495686_0001068 Ga0495686_0001068_14027_14767 245
177 3300047673 Ga0495593_0005273 Ga0495593_0005273_6694_7434 245
178 3300048088 Ga0495602_0090925 Ga0495602_0090925_1677_2417 245
179 3300048905 Ga0496102_0000097 Ga0496102_0000097_11429_12175 245
180 3300048905 Ga0496102_0022099 Ga0496102_0022099_4573_5322 245
181 3300046453 Ga0495627_006030 Ga0495627_006030_2027_2776 246
182 3300046455 Ga0495603_0078479 Ga0495603_0078479_1051_1797 246
183 3300046492 Ga0495585_0005646 Ga0495585_0005646_4194_4946 246
184 3300046506 Ga0495583_0025159 Ga0495583_0025159_669_1418 246
185 3300046513 Ga0495616_0082481 Ga0495616_0082481_56_805 246
186 3300046519 Ga0495632_0002996 Ga0495632_0002996_9422_10171 246
187 3300046523 Ga0495644_0024480 Ga0495644_0024480_230_982 246
188 3300046528 Ga0495642_0048915 Ga0495642_0048915_211_960 246
189 3300046558 Ga0495633_0064408 Ga0495633_0064408_395_1144 246
190 3300046665 Ga0495661_0064250 Ga0495661_0064250_707_1456 246
191 3300046665 Ga0495661_0072136 Ga0495661_0072136_1013_1765 246
192 3300046692 Ga0495671_0138228 Ga0495671_0138228_316_1065 246
193 3300047445 Ga0495677_0030062 Ga0495677_0030062_991_1740 246
194 3300047470 Ga0495681_0025158 Ga0495681_0025158_1994_2743 246
195 3300038443 Ga0395901_0000802 Ga0395901_0000802_10155_10970 247
196 3300046457 Ga0495590_0021057 Ga0495590_0021057_857_1606 247
197 3300046474 Ga0495605_0090299 Ga0495605_0090299_597_1346 247
198 3300046499 Ga0495594_0004047 Ga0495594_0004047_2173_2934 247
199 3300046506 Ga0495583_0030355 Ga0495583_0030355_1440_2189 247
200 3300046513 Ga0495616_0026741 Ga0495616_0026741_1295_2044 247
201 3300046518 Ga0495631_0000531 Ga0495631_0000531_17047_17796 247
202 3300046520 Ga0495637_0092847 Ga0495637_0092847_41_790 247
203 3300046524 Ga0495648_0030634 Ga0495648_0030634_2526_3275 247
204 3300046530 Ga0495654_0006647 Ga0495654_0006647_2348_3097 247
205 3300046538 Ga0495609_0055048 Ga0495609_0055048_608_1357 247
206 3300046616 Ga0495668_0005242 Ga0495668_0005242_508_1257 247
207 3300046660 Ga0495625_0006205 Ga0495625_0006205_1965_2714 247
208 3300046692 Ga0495671_0004011 Ga0495671_0004011_6378_7127 247
209 3300047318 Ga0495636_0135371 Ga0495636_0135371_178_927 247
210 3300047446 Ga0495679_002864 Ga0495679_002864_7738_8487 247
211 3300047470 Ga0495681_0025226 Ga0495681_0025226_1182_1931 247
212 3300048091 Ga0495626_0043867 Ga0495626_0043867_251_1000 247
213 3300048927 Ga0496124_0003131 Ga0496124_0003131_3924_4670 247
214 3300003322 rootL2_10117945 rootL2_101179451 248
215 3300003574 Ga0007410J51695_1015573 Ga0007410J51695_10155731 248
216 3300003575 Ga0007409J51694_1006909 Ga0007409J51694_10069092 248
217 3300003693 Ga0032354_1042402 Ga0032354_10424021 248
218 3300003759 Ga0055525_1000179 Ga0055525_100017965 248
219 3300003762 Ga0055542_1026451 Ga0055542_10264511 248
220 3300005262 Ga0065165_1004993 Ga0065165_10049936 248
221 3300005262 Ga0065165_1021100 Ga0065165_10211003 248
222 3300005327 Ga0070658_10092903 Ga0070658_100929033 248
223 3300005329 Ga0070683_100297681 Ga0070683_1002976812 248
224 3300005336 Ga0070680_100085820 Ga0070680_1000858203 248
225 3300005339 Ga0070660_100088380 Ga0070660_1000883803 248
226 3300005339 Ga0070660_100243144 Ga0070660_1002431441 248
227 3300005339 Ga0070660_100641043 Ga0070660_1006410431 248
228 3300005366 Ga0070659_100025754 Ga0070659_1000257543 248
229 3300005366 Ga0070659_100359214 Ga0070659_1003592141 248
230 3300005455 Ga0070663_100172314 Ga0070663_1001723142 248
231 3300005457 Ga0070662_100140721 Ga0070662_1001407212 248
232 3300005563 Ga0068855_100053683 Ga0068855_1000536833 248
233 3300005564 Ga0070664_100187350 Ga0070664_1001873502 248
234 3300005564 Ga0070664_100418073 Ga0070664_1004180732 248
235 3300005616 Ga0068852_100017608 Ga0068852_1000176088 248
236 3300009036 Ga0105244_10066004 Ga0105244_100660043 248
237 3300009098 Ga0105245_10204286 Ga0105245_102042863 248
238 3300009148 Ga0105243_10013788 Ga0105243_100137884 248
239 3300009174 Ga0105241_10008850 Ga0105241_100088503 248
240 3300009176 Ga0105242_10115504 Ga0105242_101155044 248
241 3300009545 Ga0105237_10139431 Ga0105237_101394313 248
242 3300009551 Ga0105238_10590916 Ga0105238_105909161 248
243 3300013296 Ga0157374_10119100 Ga0157374_101191002 248
244 3300013307 Ga0157372_10403847 Ga0157372_104038472 248
245 3300014969 Ga0157376_10460761 Ga0157376_104607612 248
246 3300025230 Ga0209563_100143 Ga0209563_10014312 248
247 3300025254 Ga0209148_1000229 Ga0209148_100022973 248
248 3300025728 Ga0207655_1117207 Ga0207655_11172071 248
249 3300025909 Ga0207705_10062026 Ga0207705_100620263 248
250 3300025909 Ga0207705_10092635 Ga0207705_100926353 248
251 3300025913 Ga0207695_10418103 Ga0207695_104181031 248
252 3300025914 Ga0207671_10086571 Ga0207671_100865713 248
253 3300025917 Ga0207660_10065502 Ga0207660_100655023 248
254 3300025919 Ga0207657_10004829 Ga0207657_1000482913 248
255 3300025919 Ga0207657_10276980 Ga0207657_102769802 248
256 3300025919 Ga0207657_10589336 Ga0207657_105893361 248
257 3300025920 Ga0207649_10076586 Ga0207649_100765863 248
258 3300025927 Ga0207687_10132493 Ga0207687_101324932 248
259 3300025932 Ga0207690_10016222 Ga0207690_100162224 248
260 3300025932 Ga0207690_10282882 Ga0207690_102828822 248
261 3300025933 Ga0207706_10075222 Ga0207706_100752223 248
262 3300025934 Ga0207686_10021694 Ga0207686_100216943 248
263 3300025945 Ga0207679_10141176 Ga0207679_101411763 248
264 3300025945 Ga0207679_10158130 Ga0207679_101581302 248
265 3300025945 Ga0207679_10755194 Ga0207679_107551941 248
266 3300025949 Ga0207667_10006091 Ga0207667_1000609113 248
267 3300026067 Ga0207678_10220689 Ga0207678_102206893 248
268 3300026078 Ga0207702_10233271 Ga0207702_102332713 248
269 3300026089 Ga0207648_10272889 Ga0207648_102728892 248
270 3300026116 Ga0207674_10091952 Ga0207674_100919523 248
271 3300037312 Ga0395899_0112855 Ga0395899_0112855_96_842 248
272 3300037312 Ga0395899_0235789 Ga0395899_0235789_409_1155 248
273 3300037312 Ga0395899_0275430 Ga0395899_0275430_237_983 248
274 3300037312 Ga0395899_0356022 Ga0395899_0356022_125_877 248
275 3300037312 Ga0395899_0444235 Ga0395899_0444235_49_795 248
276 3300037418 Ga0395900_0003038 Ga0395900_0003038_10775_11521 248
277 3300037418 Ga0395900_0050396 Ga0395900_0050396_3408_4154 248
278 3300037418 Ga0395900_0103459 Ga0395900_0103459_133_879 248
279 3300037418 Ga0395900_0142998 Ga0395900_0142998_1437_2183 248
280 3300037418 Ga0395900_0282920 Ga0395900_0282920_533_1282 248
281 3300037418 Ga0395900_0282983 Ga0395900_0282983_821_1567 248
282 3300037418 Ga0395900_0644369 Ga0395900_0644369_24_770 248
283 3300037466 Ga0395898_0064407 Ga0395898_0064407_1472_2218 248
284 3300037466 Ga0395898_0179949 Ga0395898_0179949_154_906 248
285 3300037466 Ga0395898_0306248 Ga0395898_0306248_69_815 248
286 3300037466 Ga0395898_0316307 Ga0395898_0316307_325_1071 248
287 3300037466 Ga0395898_0340837 Ga0395898_0340837_642_1388 248
288 3300037466 Ga0395898_0350783 Ga0395898_0350783_348_1100 248
289 3300037466 Ga0395898_0486983 Ga0395898_0486983_408_1154 248
290 3300037466 Ga0395898_0577484 Ga0395898_0577484_246_992 248
291 3300037471 Ga0395905_0118477 Ga0395905_0118477_83_829 248
292 3300037471 Ga0395905_0166509 Ga0395905_0166509_1231_1977 248
293 3300037471 Ga0395905_0178358 Ga0395905_0178358_95_841 248
294 3300037471 Ga0395905_0294614 Ga0395905_0294614_492_1244 248
295 3300037471 Ga0395905_0383054 Ga0395905_0383054_444_1190 248
296 3300037471 Ga0395905_0551867 Ga0395905_0551867_221_967 248
297 3300038443 Ga0395901_0002761 Ga0395901_0002761_10774_11520 248
298 3300038443 Ga0395901_0063676 Ga0395901_0063676_135_881 248
299 3300038443 Ga0395901_0086147 Ga0395901_0086147_135_881 248
300 3300038443 Ga0395901_0122318 Ga0395901_0122318_1934_2680 248
301 3300042005 Ga0439448_0023935 Ga0439448_0023935_721_1467 248
302 3300042007 Ga0439449_0064111 Ga0439449_0064111_375_1121 248
303 3300042157 Ga0439458_0027775 Ga0439458_0027775_458_1204 248
304 3300044656 Ga0466969_0053028 Ga0466969_0053028_837_1583 248
305 3300044656 Ga0466969_0088962 Ga0466969_0088962_58_804 248
306 3300044658 Ga0466972_0059169 Ga0466972_0059169_549_1295 248
307 3300044658 Ga0466972_0083607 Ga0466972_0083607_512_1258 248
308 3300044658 Ga0466972_0126674 Ga0466972_0126674_209_955 248
309 3300044683 Ga0466965_0042815 Ga0466965_0042815_616_1362 248
310 3300044684 Ga0466966_0010056 Ga0466966_0010056_3862_4608 248
311 3300044684 Ga0466966_0063660 Ga0466966_0063660_1346_2092 248
312 3300044684 Ga0466966_0071476 Ga0466966_0071476_1232_1978 248
313 3300044694 Ga0466963_0006672 Ga0466963_0006672_289_1035 248
314 3300044706 Ga0466964_0000264 Ga0466964_0000264_12061_12807 248
315 3300044706 Ga0466964_0024266 Ga0466964_0024266_108_854 248
316 3300044735 Ga0466968_0002653 Ga0466968_0002653_2453_3199 248
317 3300044765 Ga0466970_0019832 Ga0466970_0019832_734_1480 248
318 3300044765 Ga0466970_0174354 Ga0466970_0174354_350_1096 248
319 3300045049 Ga0466959_0011351 Ga0466959_0011351_4674_5420 248
320 3300045049 Ga0466959_0046829 Ga0466959_0046829_2387_3133 248
321 3300045049 Ga0466959_0117361 Ga0466959_0117361_50_796 248
322 3300045836 Ga0466958_0016772 Ga0466958_0016772_2591_3337 248
323 3300045976 Ga0466967_0001340 Ga0466967_0001340_4404_5150 248
324 3300045976 Ga0466967_0118055 Ga0466967_0118055_1236_1982 248
325 3300046452 Ga0495617_000046 Ga0495617_000046_105887_106639 248
326 3300046453 Ga0495627_000476 Ga0495627_000476_24392_25144 248
327 3300046457 Ga0495590_0000022 Ga0495590_0000022_192284_193057 248
328 3300046457 Ga0495590_0000134 Ga0495590_0000134_33031_33783 248
329 3300046457 Ga0495590_0017693 Ga0495590_0017693_541_1287 248
330 3300046457 Ga0495590_0039896 Ga0495590_0039896_106_873 248
331 3300046458 Ga0495591_002206 Ga0495591_002206_10175_10927 248
332 3300046458 Ga0495591_020195 Ga0495591_020195_917_1684 248
333 3300046460 Ga0495638_0120085 Ga0495638_0120085_313_1065 248
334 3300046463 Ga0495653_0022020 Ga0495653_0022020_369_1115 248
335 3300046471 Ga0495650_0015423 Ga0495650_0015423_1566_2318 248
336 3300046472 Ga0495580_0051401 Ga0495580_0051401_1809_2555 248
337 3300046473 Ga0495582_0002206 Ga0495582_0002206_2163_2909 248
338 3300046474 Ga0495605_0000284 Ga0495605_0000284_8792_9544 248
339 3300046474 Ga0495605_0001426 Ga0495605_0001426_9815_10561 248
340 3300046474 Ga0495605_0003995 Ga0495605_0003995_7857_8603 248
341 3300046474 Ga0495605_0026482 Ga0495605_0026482_776_1543 248
342 3300046474 Ga0495605_0035703 Ga0495605_0035703_1043_1795 248
343 3300046474 Ga0495605_0050322 Ga0495605_0050322_1059_1805 248
344 3300046474 Ga0495605_0083097 Ga0495605_0083097_664_1416 248
345 3300046477 Ga0495664_0119106 Ga0495664_0119106_650_1399 248
346 3300046491 Ga0495584_0000276 Ga0495584_0000276_25592_26344 248
347 3300046491 Ga0495584_0006196 Ga0495584_0006196_1300_2067 248
348 3300046491 Ga0495584_0013942 Ga0495584_0013942_295_1041 248
349 3300046491 Ga0495584_0018200 Ga0495584_0018200_2454_3200 248
350 3300046491 Ga0495584_0055281 Ga0495584_0055281_1124_1876 248
351 3300046491 Ga0495584_0097980 Ga0495584_0097980_135_881 248
352 3300046491 Ga0495584_0105280 Ga0495584_0105280_253_1005 248
353 3300046491 Ga0495584_0205327 Ga0495584_0205327_177_929 248
354 3300046492 Ga0495585_0004129 Ga0495585_0004129_8284_9036 248
355 3300046492 Ga0495585_0005355 Ga0495585_0005355_3208_3960 248
356 3300046492 Ga0495585_0008165 Ga0495585_0008165_4987_5739 248
357 3300046492 Ga0495585_0116213 Ga0495585_0116213_22_774 248
358 3300046499 Ga0495594_0008107 Ga0495594_0008107_526_1278 248
359 3300046499 Ga0495594_0151299 Ga0495594_0151299_520_1266 248
360 3300046499 Ga0495594_0158138 Ga0495594_0158138_150_902 248
361 3300046500 Ga0495596_0004739 Ga0495596_0004739_5688_6452 248
362 3300046500 Ga0495596_0005389 Ga0495596_0005389_4897_5649 248
363 3300046500 Ga0495596_0018248 Ga0495596_0018248_1395_2147 248
364 3300046500 Ga0495596_0058611 Ga0495596_0058611_303_1070 248
365 3300046500 Ga0495596_0061201 Ga0495596_0061201_333_1100 248
366 3300046500 Ga0495596_0066652 Ga0495596_0066652_169_936 248
367 3300046500 Ga0495596_0090638 Ga0495596_0090638_403_1155 248
368 3300046501 Ga0495607_0001871 Ga0495607_0001871_6829_7575 248
369 3300046501 Ga0495607_0002451 Ga0495607_0002451_1280_2032 248
370 3300046501 Ga0495607_0004355 Ga0495607_0004355_6368_7120 248
371 3300046501 Ga0495607_0011719 Ga0495607_0011719_2982_3728 248
372 3300046501 Ga0495607_0019434 Ga0495607_0019434_362_1108 248
373 3300046501 Ga0495607_0019735 Ga0495607_0019735_1606_2358 248
374 3300046501 Ga0495607_0021114 Ga0495607_0021114_493_1239 248
375 3300046501 Ga0495607_0040788 Ga0495607_0040788_728_1495 248
376 3300046506 Ga0495583_0002351 Ga0495583_0002351_10175_10927 248
377 3300046506 Ga0495583_0003232 Ga0495583_0003232_8868_9614 248
378 3300046506 Ga0495583_0035814 Ga0495583_0035814_532_1299 248
379 3300046507 Ga0495606_0094362 Ga0495606_0094362_104_871 248
380 3300046512 Ga0495610_0048004 Ga0495610_0048004_33_785 248
381 3300046512 Ga0495610_0102200 Ga0495610_0102200_80_847 248
382 3300046513 Ga0495616_0002252 Ga0495616_0002252_10024_10776 248
383 3300046513 Ga0495616_0004841 Ga0495616_0004841_3653_4399 248
384 3300046513 Ga0495616_0005528 Ga0495616_0005528_1087_1833 248
385 3300046513 Ga0495616_0012956 Ga0495616_0012956_3229_3975 248
386 3300046513 Ga0495616_0019400 Ga0495616_0019400_2658_3425 248
387 3300046513 Ga0495616_0025042 Ga0495616_0025042_825_1577 248
388 3300046513 Ga0495616_0033059 Ga0495616_0033059_1073_1825 248
389 3300046513 Ga0495616_0065931 Ga0495616_0065931_507_1274 248
390 3300046517 Ga0495630_0006276 Ga0495630_0006276_7302_8048 248
391 3300046518 Ga0495631_0000279 Ga0495631_0000279_24645_25397 248
392 3300046518 Ga0495631_0002375 Ga0495631_0002375_7833_8579 248
393 3300046518 Ga0495631_0006597 Ga0495631_0006597_1101_1865 248
394 3300046518 Ga0495631_0006801 Ga0495631_0006801_292_1044 248
395 3300046518 Ga0495631_0015167 Ga0495631_0015167_139_891 248
396 3300046518 Ga0495631_0035592 Ga0495631_0035592_656_1423 248
397 3300046518 Ga0495631_0112034 Ga0495631_0112034_397_1149 248
398 3300046519 Ga0495632_0003125 Ga0495632_0003125_2308_3054 248
399 3300046519 Ga0495632_0003723 Ga0495632_0003723_7783_8535 248
400 3300046519 Ga0495632_0013892 Ga0495632_0013892_1239_1985 248
401 3300046519 Ga0495632_0016321 Ga0495632_0016321_751_1497 248
402 3300046519 Ga0495632_0031491 Ga0495632_0031491_456_1208 248
403 3300046519 Ga0495632_0087829 Ga0495632_0087829_671_1438 248
404 3300046520 Ga0495637_0000349 Ga0495637_0000349_24386_25138 248
405 3300046520 Ga0495637_0048420 Ga0495637_0048420_410_1177 248
406 3300046520 Ga0495637_0055861 Ga0495637_0055861_466_1233 248
407 3300046522 Ga0495643_0000931 Ga0495643_0000931_27172_27918 248
408 3300046522 Ga0495643_0001000 Ga0495643_0001000_9815_10561 248
409 3300046522 Ga0495643_0004741 Ga0495643_0004741_4810_5556 248
410 3300046522 Ga0495643_0017934 Ga0495643_0017934_323_1075 248
411 3300046522 Ga0495643_0036859 Ga0495643_0036859_1116_1874 248
412 3300046523 Ga0495644_0000610 Ga0495644_0000610_8233_8979 248
413 3300046523 Ga0495644_0003512 Ga0495644_0003512_3591_4358 248
414 3300046523 Ga0495644_0026688 Ga0495644_0026688_591_1343 248
415 3300046523 Ga0495644_0030289 Ga0495644_0030289_1279_2031 248
416 3300046523 Ga0495644_0040171 Ga0495644_0040171_187_939 248
417 3300046524 Ga0495648_0005224 Ga0495648_0005224_1318_2070 248
418 3300046524 Ga0495648_0005352 Ga0495648_0005352_3022_3768 248
419 3300046524 Ga0495648_0035234 Ga0495648_0035234_187_945 248
420 3300046524 Ga0495648_0084338 Ga0495648_0084338_464_1216 248
421 3300046524 Ga0495648_0102848 Ga0495648_0102848_380_1147 248
422 3300046526 Ga0495666_0000466 Ga0495666_0000466_9246_9992 248
423 3300046528 Ga0495642_0000241 Ga0495642_0000241_8796_9548 248
424 3300046528 Ga0495642_0000278 Ga0495642_0000278_20704_21450 248
425 3300046528 Ga0495642_0001633 Ga0495642_0001633_1259_2011 248
426 3300046528 Ga0495642_0009606 Ga0495642_0009606_1743_2489 248
427 3300046528 Ga0495642_0014157 Ga0495642_0014157_474_1220 248
428 3300046528 Ga0495642_0025070 Ga0495642_0025070_886_1638 248
429 3300046528 Ga0495642_0027588 Ga0495642_0027588_894_1661 248
430 3300046528 Ga0495642_0043996 Ga0495642_0043996_76_828 248
431 3300046528 Ga0495642_0177886 Ga0495642_0177886_105_857 248
432 3300046529 Ga0495652_0020738 Ga0495652_0020738_2359_3105 248
433 3300046530 Ga0495654_0005547 Ga0495654_0005547_3715_4467 248
434 3300046530 Ga0495654_0062018 Ga0495654_0062018_743_1495 248
435 3300046530 Ga0495654_0062339 Ga0495654_0062339_257_1009 248
436 3300046531 Ga0495665_0033808 Ga0495665_0033808_1973_2719 248
437 3300046535 Ga0495586_0023440 Ga0495586_0023440_1758_2504 248
438 3300046536 Ga0495587_0014574 Ga0495587_0014574_472_1218 248
439 3300046538 Ga0495609_0000005 Ga0495609_0000005_429384_430130 248
440 3300046538 Ga0495609_0003420 Ga0495609_0003420_6707_7465 248
441 3300046538 Ga0495609_0021634 Ga0495609_0021634_1373_2140 248
442 3300046538 Ga0495609_0022303 Ga0495609_0022303_160_912 248
443 3300046538 Ga0495609_0037765 Ga0495609_0037765_74_826 248
444 3300046538 Ga0495609_0066040 Ga0495609_0066040_682_1434 248
445 3300046542 Ga0495597_0000880 Ga0495597_0000880_20625_21377 248
446 3300046542 Ga0495597_0002096 Ga0495597_0002096_11746_12513 248
447 3300046542 Ga0495597_0004135 Ga0495597_0004135_196_948 248
448 3300046542 Ga0495597_0100609 Ga0495597_0100609_308_1060 248
449 3300046557 Ga0495622_0035331 Ga0495622_0035331_697_1449 248
450 3300046558 Ga0495633_0013063 Ga0495633_0013063_2234_2986 248
451 3300046558 Ga0495633_0032646 Ga0495633_0032646_1511_2257 248
452 3300046615 Ga0495656_0147750 Ga0495656_0147750_49_801 248
453 3300046616 Ga0495668_0000906 Ga0495668_0000906_25200_25952 248
454 3300046616 Ga0495668_0004601 Ga0495668_0004601_1224_1970 248
455 3300046616 Ga0495668_0036360 Ga0495668_0036360_168_920 248
456 3300046616 Ga0495668_0045599 Ga0495668_0045599_1601_2353 248
457 3300046616 Ga0495668_0059787 Ga0495668_0059787_823_1590 248
458 3300046642 Ga0495634_0021905 Ga0495634_0021905_1419_2165 248
459 3300046648 Ga0495611_0001207 Ga0495611_0001207_5028_5792 248
460 3300046648 Ga0495611_0001446 Ga0495611_0001446_8347_9099 248
461 3300046648 Ga0495611_0057854 Ga0495611_0057854_501_1247 248
462 3300046660 Ga0495625_0205452 Ga0495625_0205452_449_1207 248
463 3300046660 Ga0495625_0345485 Ga0495625_0345485_88_834 248
464 3300046664 Ga0495659_0161098 Ga0495659_0161098_50_802 248
465 3300046665 Ga0495661_0000578 Ga0495661_0000578_28234_28980 248
466 3300046665 Ga0495661_0003483 Ga0495661_0003483_7802_8554 248
467 3300046665 Ga0495661_0003873 Ga0495661_0003873_8789_9541 248
468 3300046665 Ga0495661_0004130 Ga0495661_0004130_946_1692 248
469 3300046665 Ga0495661_0031943 Ga0495661_0031943_961_1713 248
470 3300046665 Ga0495661_0041190 Ga0495661_0041190_93_839 248
471 3300046665 Ga0495661_0053209 Ga0495661_0053209_648_1394 248
472 3300046665 Ga0495661_0054166 Ga0495661_0054166_656_1423 248
473 3300046665 Ga0495661_0176417 Ga0495661_0176417_231_977 248
474 3300046665 Ga0495661_0238580 Ga0495661_0238580_77_838 248
475 3300046674 Ga0495588_0000570 Ga0495588_0000570_9021_9767 248
476 3300046674 Ga0495588_0030933 Ga0495588_0030933_1897_2649 248
477 3300046674 Ga0495588_0031581 Ga0495588_0031581_566_1312 248
478 3300046674 Ga0495588_0095071 Ga0495588_0095071_82_834 248
479 3300046674 Ga0495588_0117213 Ga0495588_0117213_413_1165 248
480 3300046684 Ga0495669_0000301 Ga0495669_0000301_7775_8527 248
481 3300046684 Ga0495669_0002957 Ga0495669_0002957_6113_6877 248
482 3300046684 Ga0495669_0028829 Ga0495669_0028829_125_877 248
483 3300046684 Ga0495669_0085425 Ga0495669_0085425_348_1094 248
484 3300046684 Ga0495669_0090749 Ga0495669_0090749_476_1243 248
485 3300046689 Ga0495613_0006245 Ga0495613_0006245_513_1265 248
486 3300046691 Ga0495670_0001886 Ga0495670_0001886_7971_8723 248
487 3300046691 Ga0495670_0085678 Ga0495670_0085678_814_1581 248
488 3300046692 Ga0495671_0036841 Ga0495671_0036841_11_778 248
489 3300046694 Ga0495649_0001375 Ga0495649_0001375_10175_10927 248
490 3300046694 Ga0495649_0001574 Ga0495649_0001574_7208_7954 248
491 3300046694 Ga0495649_0016745 Ga0495649_0016745_3290_4036 248
492 3300046694 Ga0495649_0022389 Ga0495649_0022389_499_1266 248
493 3300046694 Ga0495649_0153043 Ga0495649_0153043_46_834 248
494 3300046794 Ga0495589_0000277 Ga0495589_0000277_31990_32736 248
495 3300046794 Ga0495589_0000473 Ga0495589_0000473_18759_19505 248
496 3300046794 Ga0495589_0000595 Ga0495589_0000595_20778_21545 248
497 3300046794 Ga0495589_0019026 Ga0495589_0019026_1590_2336 248
498 3300046794 Ga0495589_0022821 Ga0495589_0022821_1065_1817 248
499 3300046794 Ga0495589_0030730 Ga0495589_0030730_1045_1797 248
500 3300046794 Ga0495589_0130990 Ga0495589_0130990_314_1081 248
501 3300046810 Ga0495660_0001919 Ga0495660_0001919_9815_10561 248
502 3300046810 Ga0495660_0001935 Ga0495660_0001935_12145_12891 248
503 3300046810 Ga0495660_0034353 Ga0495660_0034353_1353_2105 248
504 3300046810 Ga0495660_0045857 Ga0495660_0045857_1464_2231 248
505 3300047315 Ga0495581_0014663 Ga0495581_0014663_1124_1876 248
506 3300047317 Ga0495604_0002301 Ga0495604_0002301_1273_2019 248
507 3300047318 Ga0495636_0136936 Ga0495636_0136936_225_977 248
508 3300047320 Ga0495672_0000529 Ga0495672_0000529_9866_10612 248
509 3300047320 Ga0495672_0000732 Ga0495672_0000732_24185_24937 248
510 3300047320 Ga0495672_0000769 Ga0495672_0000769_23956_24708 248
511 3300047320 Ga0495672_0009044 Ga0495672_0009044_2362_3114 248
512 3300047321 Ga0495676_0000099 Ga0495676_0000099_41924_42676 248
513 3300047322 Ga0495680_0088236 Ga0495680_0088236_1067_1813 248
514 3300047323 Ga0495683_0003551 Ga0495683_0003551_6141_6893 248
515 3300047323 Ga0495683_0003960 Ga0495683_0003960_5390_6136 248
516 3300047323 Ga0495683_0022101 Ga0495683_0022101_1297_2043 248
517 3300047323 Ga0495683_0029460 Ga0495683_0029460_1559_2326 248
518 3300047443 Ga0495687_000221 Ga0495687_000221_9231_9977 248
519 3300047443 Ga0495687_001071 Ga0495687_001071_7784_8542 248
520 3300047443 Ga0495687_001138 Ga0495687_001138_17249_18016 248
521 3300047444 Ga0495675_0025639 Ga0495675_0025639_2653_3399 248
522 3300047445 Ga0495677_0000060 Ga0495677_0000060_52001_52747 248
523 3300047445 Ga0495677_0000361 Ga0495677_0000361_10180_10932 248
524 3300047445 Ga0495677_0001077 Ga0495677_0001077_956_1702 248
525 3300047445 Ga0495677_0006870 Ga0495677_0006870_2651_3397 248
526 3300047445 Ga0495677_0015928 Ga0495677_0015928_120_872 248
527 3300047445 Ga0495677_0063915 Ga0495677_0063915_266_1024 248
528 3300047446 Ga0495679_002156 Ga0495679_002156_6396_7142 248
529 3300047446 Ga0495679_028418 Ga0495679_028418_1037_1789 248
530 3300047470 Ga0495681_0002347 Ga0495681_0002347_1512_2258 248
531 3300047470 Ga0495681_0003675 Ga0495681_0003675_7748_8500 248
532 3300047470 Ga0495681_0004163 Ga0495681_0004163_1318_2070 248
533 3300047470 Ga0495681_0067184 Ga0495681_0067184_732_1484 248
534 3300047470 Ga0495681_0093269 Ga0495681_0093269_492_1259 248
535 3300047472 Ga0495686_0000589 Ga0495686_0000589_49349_50101 248
536 3300047472 Ga0495686_0175713 Ga0495686_0175713_383_1135 248
537 3300047673 Ga0495593_0047806 Ga0495593_0047806_39_791 248
538 3300048088 Ga0495602_0020996 Ga0495602_0020996_2127_2873 248
539 3300048090 Ga0495615_0011986 Ga0495615_0011986_1010_1756 248
540 3300048091 Ga0495626_0000196 Ga0495626_0000196_64714_65460 248
541 3300048091 Ga0495626_0000550 Ga0495626_0000550_9815_10561 248
542 3300048091 Ga0495626_0001712 Ga0495626_0001712_9060_9806 248
543 3300048091 Ga0495626_0005686 Ga0495626_0005686_1266_2018 248
544 3300048091 Ga0495626_0006078 Ga0495626_0006078_583_1347 248
545 3300048091 Ga0495626_0007814 Ga0495626_0007814_3897_4643 248
546 3300048091 Ga0495626_0008705 Ga0495626_0008705_1090_1836 248
547 3300048091 Ga0495626_0010787 Ga0495626_0010787_3859_4611 248
548 3300048091 Ga0495626_0025830 Ga0495626_0025830_638_1405 248
549 3300048091 Ga0495626_0042076 Ga0495626_0042076_214_981 248
550 3300048091 Ga0495626_0073844 Ga0495626_0073844_698_1450 248
551 3300048091 Ga0495626_0192035 Ga0495626_0192035_30_776 248
552 3300048904 Ga0496101_0073780 Ga0496101_0073780_393_1139 248
553 3300048904 Ga0496101_0278456 Ga0496101_0278456_477_1223 248
554 3300048905 Ga0496102_0000670 Ga0496102_0000670_24711_25463 248
555 3300048905 Ga0496102_0098686 Ga0496102_0098686_480_1226 248
556 3300048905 Ga0496102_0428866 Ga0496102_0428866_106_852 248
557 3300048906 Ga0496103_0033047 Ga0496103_0033047_1634_2386 248
558 3300048906 Ga0496103_0039736 Ga0496103_0039736_2034_2780 248
559 3300048909 Ga0496106_0007323 Ga0496106_0007323_7295_8041 248
560 3300048909 Ga0496106_0120718 Ga0496106_0120718_600_1346 248
561 3300048912 Ga0496109_0008655 Ga0496109_0008655_363_1115 248
562 3300048913 Ga0496110_0000333 Ga0496110_0000333_22763_23509 248
563 3300048913 Ga0496110_0060986 Ga0496110_0060986_439_1206 248
564 3300048913 Ga0496110_0301659 Ga0496110_0301659_575_1321 248
565 3300048914 Ga0496111_0155289 Ga0496111_0155289_790_1536 248
566 3300048914 Ga0496111_0283756 Ga0496111_0283756_222_968 248
567 3300048914 Ga0496111_0571592 Ga0496111_0571592_49_816 248
568 3300048915 Ga0496112_0613648 Ga0496112_0613648_153_899 248
569 3300048925 Ga0496122_0002554 Ga0496122_0002554_14409_15155 248
570 3300048926 Ga0496123_0007296 Ga0496123_0007296_9608_10354 248
571 3300048927 Ga0496124_0006285 Ga0496124_0006285_487_1233 248
572 3300048927 Ga0496124_0012297 Ga0496124_0012297_6466_7212 248
573 3300048927 Ga0496124_0054541 Ga0496124_0054541_1326_2078 248
574 3300048928 Ga0496125_0087226 Ga0496125_0087226_1586_2332 248
575 3300049459 Ga0495678_000146 Ga0495678_000146_75067_75819 248
576 3300049459 Ga0495678_000561 Ga0495678_000561_25157_25924 248
577 3300049459 Ga0495678_002372 Ga0495678_002372_7742_8509 248
578 3300049459 Ga0495678_003259 Ga0495678_003259_272_1024 248
579 3300049460 Ga0495682_0000933 Ga0495682_0000933_7783_8550 248
580 3300049822 Ga0501035_0002697 Ga0501035_0002697_13216_13962 248
581 3300059490 Ga0587066_016463 Ga0587066_016463_51_797 248
582 3300059491 Ga0587070_016841 Ga0587070_016841_348_1094 248
583 3300059493 Ga0587077_009031 Ga0587077_009031_430_1176 248
584 3300059503 Ga0587080_004871 Ga0587080_004871_401_1147 248
585 3300059503 Ga0587080_030397 Ga0587080_030397_125_871 248
586 3300059504 Ga0587082_005022 Ga0587082_005022_582_1328 248
587 3300059504 Ga0587082_013619 Ga0587082_013619_36_782 248
588 3300059505 Ga0587083_0018635 Ga0587083_0018635_373_1119 248
589 3300059511 Ga0587091_053259 Ga0587091_053259_25_771 248
590 3300059605 Ga0587106_010563 Ga0587106_010563_345_1091 248
591 3300059622 Ga0587099_013119 Ga0587099_013119_61_807 248
592 3300059623 Ga0587101_027868 Ga0587101_027868_55_801 248
593 3300059640 Ga0587067_046343 Ga0587067_046343_41_787 248
594 3300059641 Ga0587068_006558 Ga0587068_006558_413_1159 248
595 3300059647 Ga0587079_009955 Ga0587079_009955_356_1102 248
596 3300059647 Ga0587079_015134 Ga0587079_015134_519_1265 248
597 3300059648 Ga0587100_007859 Ga0587100_007859_60_806 248
598 3300059649 Ga0587102_003081 Ga0587102_003081_231_977 248
599 3300059651 Ga0587105_004614 Ga0587105_004614_81_827 248
600 3300059652 Ga0587107_025725 Ga0587107_025725_53_799 248
601 3300059660 Ga0587124_008344 Ga0587124_008344_100_846 248
602 3300061719 Ga0466962_0040669 Ga0466962_0040669_234_980 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09694

Gcw_chp

Bacterial protein of unknown function (Gcw_chp)

42

272

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fqe-assembly1.cif.gz_A kdgm porin 0.797 37 248
4pr7-assembly1.cif.gz_A kdgm porin in complex with disordered oligogalacturonate 0.7796 37 248
4fqe-assembly1.cif.gz_A kdgm porin 0.772 37 248
4pr7-assembly1.cif.gz_A kdgm porin in complex with disordered oligogalacturonate 0.7556 37 248
2wjr-assembly1.cif.gz_A nanc porin structure in rhombohedral crystal form. 0.6616 36 247
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.797 37 248 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.772 37 248 2.40.160.40
2gr8F00 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.7211 180 244 3.30.1300.30
2gr7A00 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.6919 174 244 3.30.1300.30
2wjrA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6616 36 247 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A2D2DIU5-F1-model_v4 Uncharacterized protein 0.9867 32 248
AF-F1W226-F1-model_v4 Uncharacterized protein 0.9787 24 248
AF-A0A7Z0LBB3-F1-model_v4 deleted 0.9755 75 199
AF-A4G5J2-F1-model_v4 Uncharacterized protein 0.9749 9 248
AF-A0A4Q7XQ62-F1-model_v4 deleted 0.9712 35 248

Feature Viewer

pLDDT pTM Quality
87.58 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map