F468094

General Info

Members Datasets Scaffolds Average Seq Length
601 351 592 215

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0030847|Ga0495597_0030847_32_688
Length 212
Sequence MRAGQFNLRVADFRILMAAGVIALTGLFSMSHARAIEMSREVSDLYTSVSIYPPSAGSMTICYGFVCRRRHAFDFTPADRAALTKLLAAGKASAAQKAVVWWDRRVGPVLGTDKRIANADFRYFDDKHNFDCWDTTRNVTSLLLIIQDWGLLKHHTVGNPRYRGNALVLQTPHNTAVLLDRATGTEWVVDMWTRGYAQLPDVKPADQWVKEN

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
4 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
5 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
6 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
7 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
8 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
332 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
333 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
340 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
341 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
342 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
343 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
344 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
345 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
346 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.33
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.32
Nodule 0.83
Rhizoplane 6.49
Rhizosphere 80.87
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000053 3300003203 Bacteria 53627
2 JGI25404J52841_10001478 3300003659 Bacteria 4145
3 Ga0065715_10190046 3300005293 Bacteria 1421
4 Ga0070683_100042499 3300005329 Bacteria 4185
5 Ga0070683_100893836 3300005329 Bacteria 852
6 Ga0068869_100054805 3300005334 Bacteria 2904
7 Ga0068869_100201984 3300005334 Bacteria 1568
8 Ga0070680_100111891 3300005336 Bacteria 2273
9 Ga0070680_100215092 3300005336 Bacteria 1622
10 Ga0070680_100415362 3300005336 Bacteria 1148
11 Ga0070682_100035583 3300005337 Bacteria 3041
12 Ga0070691_10283925 3300005341 Bacteria 899
13 Ga0070661_100293586 3300005344 Bacteria 1264
14 Ga0070668_100143353 3300005347 Bacteria 1927
15 Ga0070668_100145089 3300005347 Bacteria 1915
16 Ga0070669_100398383 3300005353 Bacteria 1126
17 Ga0070673_100145775 3300005364 Bacteria 2001
18 Ga0070659_100073710 3300005366 Bacteria 2718
19 Ga0070667_100425816 3300005367 Bacteria 1211
20 Ga0070709_10000403 3300005434 Bacteria 26346
21 Ga0070709_10338889 3300005434 Bacteria 1108
22 Ga0070714_100006308 3300005435 Bacteria 9139
23 Ga0070713_100023753 3300005436 Bacteria 4764
24 Ga0070713_100084736 3300005436 Bacteria 2713
25 Ga0070710_10002450 3300005437 Bacteria 8789
26 Ga0070710_10184661 3300005437 Bacteria 1308
27 Ga0070701_10035734 3300005438 Bacteria 2499
28 Ga0070711_100066299 3300005439 Bacteria 2528
29 Ga0070708_100218520 3300005445 Bacteria 1787
30 Ga0070663_100010706 3300005455 Bacteria 5725
31 Ga0070663_100032781 3300005455 Bacteria 3584
32 Ga0070663_100241990 3300005455 Bacteria 1425
33 Ga0070678_100264233 3300005456 Bacteria 1449
34 Ga0070681_10013957 3300005458 Bacteria 7992
35 Ga0070681_10113314 3300005458 Bacteria 2651
36 Ga0070681_10215011 3300005458 Bacteria 1839
37 Ga0070681_10400094 3300005458 Bacteria 1285
38 Ga0070707_100158450 3300005468 Bacteria 2205
39 Ga0070698_100198507 3300005471 Bacteria 1942
40 Ga0070679_100224122 3300005530 Bacteria 1840
41 Ga0070679_100307530 3300005530 Bacteria 1535
42 Ga0070684_100008771 3300005535 Bacteria 7927
43 Ga0070684_100012842 3300005535 Bacteria 6728
44 Ga0070697_100281107 3300005536 Bacteria 1428
45 Ga0070697_100369583 3300005536 Bacteria 1241
46 Ga0068853_100438728 3300005539 Bacteria 1227
47 Ga0068853_100615616 3300005539 Bacteria 1032
48 Ga0070686_100268820 3300005544 Bacteria 1253
49 Ga0070693_100281143 3300005547 Bacteria 1114
50 Ga0070665_100010052 3300005548 Bacteria 9574
51 Ga0070665_100077377 3300005548 Bacteria 3333
52 Ga0070665_100473803 3300005548 Bacteria 1263
53 Ga0070704_100275192 3300005549 Bacteria 1392
54 Ga0068855_100184228 3300005563 Bacteria 2359
55 Ga0068855_101004551 3300005563 Bacteria 876
56 Ga0068854_100246891 3300005578 Bacteria 1424
57 Ga0068854_100594510 3300005578 Bacteria 944
58 Ga0068856_100000255 3300005614 Bacteria 58233
59 Ga0068852_100002678 3300005616 Bacteria 12311
60 Ga0068870_10049642 3300005840 Bacteria 2214
61 Ga0068870_10315406 3300005840 Bacteria 992
62 Ga0068858_100576248 3300005842 Bacteria 1090
63 Ga0068860_100363885 3300005843 Bacteria 1425
64 Ga0068862_100116716 3300005844 Bacteria 2348
65 Ga0068862_100495862 3300005844 Bacteria 1158
66 Ga0081455_10012458 3300005937 Bacteria 8485
67 Ga0081455_10024496 3300005937 Bacteria 5587
68 Ga0081455_10273521 3300005937 Bacteria 1224
69 Ga0081540_1000078 3300005983 Bacteria 105731
70 Ga0081540_1004361 3300005983 Bacteria 10821
71 Ga0081540_1004490 3300005983 Bacteria 10610
72 Ga0081540_1009395 3300005983 Bacteria 6742
73 Ga0081540_1016522 3300005983 Bacteria 4613
74 Ga0081540_1054929 3300005983 Bacteria 1943
75 Ga0081540_1064466 3300005983 Bacteria 1728
76 Ga0081540_1080972 3300005983 Bacteria 1462
77 Ga0081539_10000471 3300005985 Bacteria 85272
78 Ga0070717_10126640 3300006028 Bacteria 2193
79 Ga0075365_10506249 3300006038 Bacteria 853
80 Ga0075363_100253832 3300006048 Bacteria 1013
81 Ga0075364_10151053 3300006051 Bacteria 1565
82 Ga0075364_10273719 3300006051 Bacteria 1148
83 Ga0070716_100011253 3300006173 Bacteria 4504
84 Ga0070712_100081372 3300006175 Bacteria 2346
85 Ga0070712_100127596 3300006175 Bacteria 1923
86 Ga0070712_100218246 3300006175 Bacteria 1508
87 Ga0075367_10011870 3300006178 Bacteria 4626
88 Ga0075367_10294992 3300006178 Unclassified 1020
89 Ga0075366_10086754 3300006195 Bacteria 1872
90 Ga0075366_10193094 3300006195 Bacteria 1237
91 Ga0075370_10051978 3300006353 Bacteria 2324
92 Ga0068871_100168089 3300006358 Bacteria 1878
93 Ga0075428_100476441 3300006844 Bacteria 1336
94 Ga0075434_100221546 3300006871 Bacteria 1912
95 Ga0075429_100097541 3300006880 Bacteria 2564
96 Ga0099794_10072905 3300007265 Bacteria 1684
97 Ga0099794_10133328 3300007265 Bacteria 1255
98 Ga0099794_10215355 3300007265 Bacteria 986
99 Ga0105240_10052104 3300009093 Bacteria 5145
100 Ga0105240_10211364 3300009093 Bacteria 2267
101 Ga0111539_10245086 3300009094 Bacteria 2086
102 Ga0105245_10093478 3300009098 Bacteria 2771
103 Ga0114129_10130405 3300009147 Bacteria 3453
104 Ga0105243_10223074 3300009148 Bacteria 1667
105 Ga0105241_10341519 3300009174 Bacteria 1297
106 Ga0105237_10045695 3300009545 Bacteria 4406
107 Ga0105237_10077319 3300009545 Bacteria 3318
108 Ga0105237_10317932 3300009545 Bacteria 1560
109 Ga0105237_10354260 3300009545 Bacteria 1472
110 Ga0105238_10325954 3300009551 Bacteria 1522
111 Ga0105249_10066739 3300009553 Bacteria 3313
112 Ga0099796_10014229 3300010159 Bacteria 2294
113 Ga0099796_10105770 3300010159 Bacteria 1065
114 Ga0105239_10181230 3300010375 Bacteria 2357
115 Ga0105239_10206174 3300010375 Bacteria 2203
116 Ga0105246_10173671 3300011119 Bacteria 1653
117 Ga0157371_10057862 3300013102 Bacteria 2750
118 Ga0157370_10056758 3300013104 Bacteria 3726
119 Ga0157370_10167808 3300013104 Bacteria 2041
120 Ga0157369_10002191 3300013105 Bacteria 23538
121 Ga0157369_10015878 3300013105 Bacteria 8480
122 Ga0157369_10116560 3300013105 Bacteria 2836
123 Ga0157369_10169842 3300013105 Bacteria 2298
124 Ga0157378_10148390 3300013297 Bacteria 2183
125 Ga0157378_10292405 3300013297 Bacteria 1574
126 Ga0163162_10247733 3300013306 Bacteria 1913
127 Ga0157372_10531674 3300013307 Bacteria 1371
128 Ga0157372_10967436 3300013307 Bacteria 986
129 Ga0163163_11423370 3300014325 Bacteria 755
130 Ga0157380_10149349 3300014326 Bacteria 2018
131 Ga0157379_10287109 3300014968 Bacteria 1498
132 Ga0157376_10449054 3300014969 Bacteria 1257
133 Ga0157376_10615567 3300014969 Bacteria 1082
134 Ga0197907_11260994 3300020069 Bacteria 1112
135 Ga0206353_10616236 3300020082 Bacteria 1097
136 Ga0213874_10049892 3300021377 Bacteria 1281
137 Ga0209758_1064975 3300025297 Bacteria 1180
138 Ga0207656_10071332 3300025321 Bacteria 1544
139 Ga0207692_10036157 3300025898 Bacteria 2405
140 Ga0207710_10067903 3300025900 Bacteria 1629
141 Ga0207688_10285403 3300025901 Bacteria 1006
142 Ga0207680_10574634 3300025903 Bacteria 805
143 Ga0207699_10000347 3300025906 Bacteria 24590
144 Ga0207699_10006907 3300025906 Bacteria 5522
145 Ga0207705_10056172 3300025909 Bacteria 2838
146 Ga0207705_10143889 3300025909 Bacteria 1782
147 Ga0207684_10652324 3300025910 Bacteria 897
148 Ga0207654_10287603 3300025911 Bacteria 1113
149 Ga0207707_10000462 3300025912 Bacteria 42120
150 Ga0207707_10091864 3300025912 Bacteria 2653
151 Ga0207707_10132662 3300025912 Bacteria 2178
152 Ga0207695_10074920 3300025913 Bacteria 3445
153 Ga0207695_10167645 3300025913 Bacteria 2123
154 Ga0207671_10069722 3300025914 Bacteria 2620
155 Ga0207693_10042368 3300025915 Bacteria 3584
156 Ga0207693_10063168 3300025915 Bacteria 2901
157 Ga0207693_10104230 3300025915 Bacteria 2224
158 Ga0207663_10085080 3300025916 Bacteria 2081
159 Ga0207663_10371826 3300025916 Bacteria 1087
160 Ga0207663_10483558 3300025916 Bacteria 960
161 Ga0207663_10651671 3300025916 Bacteria 831
162 Ga0207660_10082320 3300025917 Bacteria 2367
163 Ga0207660_10348180 3300025917 Bacteria 1187
164 Ga0207657_10127174 3300025919 Bacteria 2092
165 Ga0207652_10051300 3300025921 Bacteria 3537
166 Ga0207652_10341456 3300025921 Bacteria 1352
167 Ga0207652_10725150 3300025921 Bacteria 886
168 Ga0207646_10144882 3300025922 Bacteria 2140
169 Ga0207681_10530317 3300025923 Bacteria 967
170 Ga0207659_10434925 3300025926 Bacteria 1102
171 Ga0207687_10454550 3300025927 Bacteria 1063
172 Ga0207700_10255501 3300025928 Bacteria 1498
173 Ga0207700_10285425 3300025928 Bacteria 1421
174 Ga0207700_10534829 3300025928 Bacteria 1039
175 Ga0207664_10033776 3300025929 Bacteria 3935
176 Ga0207690_10115276 3300025932 Bacteria 1942
177 Ga0207690_10124712 3300025932 Bacteria 1876
178 Ga0207690_10287624 3300025932 Bacteria 1282
179 Ga0207706_10102748 3300025933 Bacteria 2515
180 Ga0207686_10056263 3300025934 Bacteria 2472
181 Ga0207686_10272232 3300025934 Bacteria 1246
182 Ga0207709_10049768 3300025935 Bacteria 2560
183 Ga0207670_10256585 3300025936 Bacteria 1353
184 Ga0207669_10109796 3300025937 Bacteria 1845
185 Ga0207669_10799430 3300025937 Bacteria 782
186 Ga0207665_10005942 3300025939 Bacteria 8122
187 Ga0207665_10047252 3300025939 Bacteria 2885
188 Ga0207665_10193048 3300025939 Bacteria 1480
189 Ga0207691_10144386 3300025940 Bacteria 2096
190 Ga0207711_10717658 3300025941 Bacteria 932
191 Ga0207689_10116568 3300025942 Bacteria 2196
192 Ga0207661_10032714 3300025944 Bacteria 4032
193 Ga0207661_10082676 3300025944 Bacteria 2655
194 Ga0207667_10338931 3300025949 Bacteria 1534
195 Ga0207651_10542384 3300025960 Bacteria 1010
196 Ga0207668_10065517 3300025972 Bacteria 2572
197 Ga0207640_10116379 3300025981 Bacteria 1906
198 Ga0207640_10182136 3300025981 Bacteria 1576
199 Ga0207658_10160375 3300025986 Bacteria 1843
200 Ga0207703_10174393 3300026035 Bacteria 1894
201 Ga0207639_10114912 3300026041 Bacteria 2200
202 Ga0207639_10124597 3300026041 Bacteria 2123
203 Ga0207639_10339961 3300026041 Bacteria 1338
204 Ga0207639_10584406 3300026041 Bacteria 1028
205 Ga0207678_10069844 3300026067 Bacteria 3012
206 Ga0207678_10111648 3300026067 Bacteria 2332
207 Ga0207678_10178230 3300026067 Bacteria 1815
208 Ga0207678_10410095 3300026067 Bacteria 1174
209 Ga0207678_10494265 3300026067 Bacteria 1066
210 Ga0207708_10092879 3300026075 Bacteria 2329
211 Ga0207702_10000390 3300026078 Bacteria 50020
212 Ga0207648_10674754 3300026089 Bacteria 956
213 Ga0207674_10036112 3300026116 Bacteria 5154
214 Ga0207674_10317001 3300026116 Bacteria 1508
215 Ga0207675_100224686 3300026118 Bacteria 1810
216 Ga0207683_10055123 3300026121 Bacteria 3486
217 Ga0207698_10206465 3300026142 Bacteria 1764
218 Ga0209588_1014130 3300027671 Bacteria 2442
219 Ga0209588_1027125 3300027671 Bacteria 1822
220 Ga0209813_10100709 3300027866 Bacteria 983
221 Ga0268266_10007255 3300028379 Bacteria 10021
222 Ga0268266_10033415 3300028379 Bacteria 4373
223 Ga0268266_10109213 3300028379 Bacteria 2449
224 Ga0268266_10672765 3300028379 Bacteria 997
225 Ga0268264_10176646 3300028381 Bacteria 1936
226 Ga0265332_10075241 3300031238 Bacteria 1436
227 Ga0265340_10005476 3300031247 Bacteria 7047
228 Ga0265331_10074711 3300031250 Bacteria 1581
229 Ga0265316_10080407 3300031344 Bacteria 2500
230 Ga0307408_100630262 3300031548 Bacteria 956
231 Ga0307508_10133194 3300031616 Bacteria 2089
232 Ga0265314_10077286 3300031711 Bacteria 2209
233 Ga0265342_10024685 3300031712 Bacteria 3792
234 Ga0307516_10108177 3300031730 Bacteria 2588
235 Ga0307416_100744881 3300032002 Bacteria 1072
236 Ga0307415_100434622 3300032126 Bacteria 1130
237 Ga0373926_0016830 3300035083 Bacteria 2506
238 Ga0373934_0003005 3300035086 Bacteria 6158
239 Ga0373952_0015932 3300035092 Bacteria 1523
240 Ga0373923_0124249 3300035111 Bacteria 1155
241 Ga0373945_0011722 3300035116 Bacteria 2902
242 Ga0373953_0002068 3300035117 Bacteria 5987
243 Ga0373953_0112435 3300035117 Bacteria 1152
244 Ga0373954_0318855 3300035118 Bacteria 767
245 Ga0373956_0000465 3300035119 Bacteria 16640
246 Ga0373957_0000114 3300035120 Bacteria 19511
247 Ga0373943_0000900 3300035170 Bacteria 13105
248 Ga0373943_0211025 3300035170 Bacteria 1078
249 Ga0373946_0172612 3300035171 Bacteria 1021
250 Ga0373955_0000133 3300035172 Bacteria 29304
251 Ga0373962_0104587 3300035242 Bacteria 887
252 Ga0373924_0234490 3300035410 Bacteria 811
253 Ga0373931_0204867 3300035691 Bacteria 1180
254 Ga0373935_0040906 3300035692 Bacteria 2910
255 Ga0373935_0143711 3300035692 Bacteria 1613
256 Ga0373935_0254390 3300035692 Bacteria 1230
257 Ga0373927_0001032 3300035695 Bacteria 21199
258 Ga0373927_0040850 3300035695 Bacteria 3009
259 Ga0373927_0048354 3300035695 Bacteria 2751
260 Ga0373927_0111791 3300035695 Bacteria 1780
261 Ga0373933_0000151 3300035724 Bacteria 45623
262 Ga0373933_0000286 3300035724 Bacteria 32640
263 Ga0373933_0016412 3300035724 Bacteria 4140
264 Ga0373933_0119571 3300035724 Bacteria 1649
265 Ga0373947_0008149 3300035725 Bacteria 6042
266 Ga0373947_0494742 3300035725 Bacteria 831
267 Ga0373937_0131817 3300036401 Bacteria 2334
268 Ga0373937_0412531 3300036401 Bacteria 1281
269 Ga0373925_0002484 3300037068 Bacteria 14744
270 Ga0373925_0059809 3300037068 Bacteria 2859
271 Ga0373925_0177652 3300037068 Bacteria 1683
272 Ga0395900_0052916 3300037418 Bacteria 4179
273 Ga0395898_0028926 3300037466 Bacteria 5554
274 Ga0395905_0101770 3300037471 Bacteria 2697
275 Ga0395901_1004492 3300038443 Bacteria 810
276 Ga0436365_0651557 3300039437 Bacteria 30425
277 Ga0436365_1885487 3300039437 Bacteria 2432
278 Ga0436365_1918864 3300039437 Bacteria 731
279 Ga0436360_0832736 3300039438 Bacteria 1923
280 Ga0436361_0146597 3300039447 Bacteria 4742
281 Ga0436361_0523452 3300039447 Bacteria 1876
282 Ga0436363_1116540 3300039450 Bacteria 1992
283 Ga0436363_1500653 3300039450 Bacteria 7533
284 Ga0436362_0379505 3300039453 Bacteria 5020
285 Ga0436362_0733513 3300039453 Bacteria 3093
286 Ga0439465_0012566 3300041413 Bacteria 2647
287 Ga0451791_0495528 3300041451 Bacteria 849
288 Ga0451802_2184100 3300041460 Bacteria 793
289 Ga0439431_0050076 3300041997 Bacteria 1082
290 Ga0466966_0053238 3300044684 Bacteria 2568
291 Ga0466968_0117353 3300044735 Bacteria 1202
292 Ga0466970_0124029 3300044765 Bacteria 1416
293 Ga0466970_0217143 3300044765 Bacteria 1067
294 Ga0466959_0094752 3300045049 Bacteria 2141
295 Ga0466959_0172154 3300045049 Bacteria 1518
296 Ga0495592_0000686 3300046454 Bacteria 23590
297 Ga0495592_0176371 3300046454 Bacteria 1459
298 Ga0495603_0000209 3300046455 Bacteria 30220
299 Ga0495590_0085741 3300046457 Bacteria 1111
300 Ga0495629_0000503 3300046459 Bacteria 32787
301 Ga0495629_0015792 3300046459 Bacteria 5422
302 Ga0495629_0220309 3300046459 Bacteria 1309
303 Ga0495641_0010107 3300046461 Bacteria 5525
304 Ga0495651_0006168 3300046462 Bacteria 9156
305 Ga0495651_0060038 3300046462 Bacteria 2914
306 Ga0495653_0066000 3300046463 Bacteria 2722
307 Ga0495653_0183879 3300046463 Bacteria 1432
308 Ga0495580_0001676 3300046472 Bacteria 19446
309 Ga0495580_0029809 3300046472 Bacteria 3957
310 Ga0495580_0083904 3300046472 Bacteria 2220
311 Ga0495582_0000152 3300046473 Bacteria 37542
312 Ga0495582_0009705 3300046473 Bacteria 5303
313 Ga0495582_0162888 3300046473 Bacteria 1269
314 Ga0495639_0000087 3300046475 Bacteria 44546
315 Ga0495639_0135693 3300046475 Bacteria 1180
316 Ga0495662_0001427 3300046476 Bacteria 11825
317 Ga0495662_0103242 3300046476 Bacteria 1395
318 Ga0495664_0019809 3300046477 Bacteria 3873
319 Ga0495664_0156304 3300046477 Bacteria 1383
320 Ga0495664_0172643 3300046477 Bacteria 1311
321 Ga0495664_0253499 3300046477 Bacteria 1064
322 Ga0495584_0057657 3300046491 Bacteria 1954
323 Ga0495594_0000129 3300046499 Bacteria 35623
324 Ga0495594_0185904 3300046499 Bacteria 1183
325 Ga0495583_0097667 3300046506 Bacteria 1257
326 Ga0495608_0000586 3300046511 Bacteria 25009
327 Ga0495618_0010020 3300046514 Bacteria 5732
328 Ga0495620_0006184 3300046515 Bacteria 6596
329 Ga0495628_0001371 3300046516 Bacteria 22344
330 Ga0495628_0193730 3300046516 Bacteria 1534
331 Ga0495630_0050670 3300046517 Bacteria 3107
332 Ga0495631_0056289 3300046518 Bacteria 1712
333 Ga0495637_0078848 3300046520 Bacteria 1316
334 Ga0495648_0001145 3300046524 Bacteria 26801
335 Ga0495663_0188020 3300046525 Bacteria 717
336 Ga0495666_0114509 3300046526 Bacteria 1265
337 Ga0495652_0001568 3300046529 Bacteria 25010
338 Ga0495654_0015913 3300046530 Bacteria 3985
339 Ga0495665_0000124 3300046531 Bacteria 36916
340 Ga0495640_0008795 3300046533 Bacteria 7900
341 Ga0495640_0035595 3300046533 Bacteria 3523
342 Ga0495586_0108137 3300046535 Bacteria 1547
343 Ga0495609_0031408 3300046538 Bacteria 2414
344 Ga0495609_0134590 3300046538 Bacteria 1057
345 Ga0495597_0030847 3300046542 Bacteria 2441
346 Ga0495645_0022212 3300046543 Bacteria 4589
347 Ga0495622_0011173 3300046557 Bacteria 4146
348 Ga0495667_0000795 3300046559 Bacteria 20300
349 Ga0495667_0213438 3300046559 Bacteria 1233
350 Ga0495656_0039061 3300046615 Bacteria 1969
351 Ga0495668_0049088 3300046616 Bacteria 2341
352 Ga0495634_0000599 3300046642 Bacteria 34949
353 Ga0495634_0006542 3300046642 Bacteria 8845
354 Ga0495634_0097914 3300046642 Bacteria 1898
355 Ga0495625_0059313 3300046660 Bacteria 2715
356 Ga0495625_0563289 3300046660 Bacteria 688
357 Ga0495635_0000417 3300046663 Bacteria 26913
358 Ga0495635_0003181 3300046663 Bacteria 11316
359 Ga0495659_0093847 3300046664 Bacteria 1155
360 Ga0495661_0042963 3300046665 Bacteria 2782
361 Ga0495661_0354334 3300046665 Bacteria 722
362 Ga0495588_0001335 3300046674 Bacteria 10537
363 Ga0495657_0000715 3300046675 Bacteria 29820
364 Ga0495657_0263851 3300046675 Bacteria 1034
365 Ga0495599_0002562 3300046678 Bacteria 10584
366 Ga0495599_0114418 3300046678 Bacteria 1679
367 Ga0495599_0348234 3300046678 Bacteria 888
368 Ga0495623_0002109 3300046679 Bacteria 13297
369 Ga0495623_0077317 3300046679 Bacteria 2064
370 Ga0495623_0150269 3300046679 Bacteria 1377
371 Ga0495646_0008630 3300046680 Bacteria 6474
372 Ga0495646_0062195 3300046680 Bacteria 2220
373 Ga0495647_0002338 3300046681 Bacteria 5951
374 Ga0495658_0001819 3300046683 Bacteria 10931
375 Ga0495658_0005829 3300046683 Bacteria 6048
376 Ga0495669_0005467 3300046684 Bacteria 5303
377 Ga0495613_0004447 3300046689 Bacteria 10502
378 Ga0495613_0016955 3300046689 Bacteria 5423
379 Ga0495613_0442568 3300046689 Bacteria 881
380 Ga0495624_0001738 3300046690 Bacteria 16643
381 Ga0495624_0064956 3300046690 Bacteria 2280
382 Ga0495670_0421456 3300046691 Bacteria 722
383 Ga0495600_0000372 3300046809 Bacteria 23407
384 Ga0495660_0253140 3300046810 Bacteria 816
385 Ga0495581_0000176 3300047315 Bacteria 29110
386 Ga0495581_0032467 3300047315 Bacteria 3023
387 Ga0495581_0188450 3300047315 Bacteria 1206
388 Ga0495604_0001526 3300047317 Bacteria 19062
389 Ga0495604_0217005 3300047317 Bacteria 1319
390 Ga0495604_0435193 3300047317 Bacteria 859
391 Ga0495636_0283483 3300047318 Bacteria 772
392 Ga0495674_0002170 3300047319 Bacteria 19272
393 Ga0495674_0002817 3300047319 Bacteria 16895
394 Ga0495674_0057538 3300047319 Bacteria 3402
395 Ga0495672_0084837 3300047320 Bacteria 1756
396 Ga0495676_0058409 3300047321 Bacteria 3035
397 Ga0495676_0111203 3300047321 Bacteria 2009
398 Ga0495676_0418533 3300047321 Bacteria 887
399 Ga0495680_0006935 3300047322 Bacteria 10456
400 Ga0495675_0000478 3300047444 Bacteria 26189
401 Ga0495677_0081325 3300047445 Bacteria 1214
402 Ga0495673_0029388 3300047469 Bacteria 2594
403 Ga0495673_0074267 3300047469 Bacteria 1423
404 Ga0495681_0050989 3300047470 Bacteria 1948
405 Ga0495684_0000155 3300047471 Bacteria 50734
406 Ga0495684_0022619 3300047471 Bacteria 4834
407 Ga0495593_0000022 3300047673 Bacteria 69741
408 Ga0495593_0002338 3300047673 Bacteria 11382
409 Ga0495602_0004699 3300048088 Bacteria 14272
410 Ga0495602_0559201 3300048088 Bacteria 792
411 Ga0495614_0018413 3300048089 Bacteria 3026
412 Ga0495614_0058031 3300048089 Bacteria 1662
413 Ga0496100_0030038 3300048903 Bacteria 3367
414 Ga0496100_0059107 3300048903 Bacteria 2518
415 Ga0496101_0206620 3300048904 Bacteria 1520
416 Ga0496101_0612458 3300048904 Bacteria 861
417 Ga0496102_0057015 3300048905 Bacteria 3565
418 Ga0496102_0115880 3300048905 Bacteria 2500
419 Ga0496102_0329074 3300048905 Bacteria 1439
420 Ga0496102_0473655 3300048905 Bacteria 1173
421 Ga0496102_0501551 3300048905 Bacteria 1136
422 Ga0496104_0087462 3300048907 Bacteria 2976
423 Ga0496104_0205471 3300048907 Bacteria 1881
424 Ga0496105_0200326 3300048908 Bacteria 1629
425 Ga0496105_0249278 3300048908 Bacteria 1439
426 Ga0496106_0229436 3300048909 Bacteria 1482
427 Ga0496107_0038553 3300048910 Bacteria 3427
428 Ga0496107_0182094 3300048910 Bacteria 1560
429 Ga0496108_0000801 3300048911 Bacteria 24438
430 Ga0496108_0065578 3300048911 Bacteria 3061
431 Ga0496109_0013479 3300048912 Bacteria 7092
432 Ga0496109_0121916 3300048912 Bacteria 2429
433 Ga0496110_0028041 3300048913 Bacteria 4832
434 Ga0496110_0108028 3300048913 Bacteria 2498
435 Ga0496111_0081019 3300048914 Bacteria 2369
436 Ga0496111_0192706 3300048914 Bacteria 1515
437 Ga0496112_0012703 3300048915 Bacteria 7745
438 Ga0496112_0165616 3300048915 Bacteria 2177
439 Ga0496113_0441427 3300048916 Bacteria 1045
440 Ga0496113_0705248 3300048916 Bacteria 805
441 Ga0496114_0046864 3300048917 Bacteria 3593
442 Ga0496114_0137864 3300048917 Bacteria 2110
443 Ga0496114_0175225 3300048917 Bacteria 1871
444 Ga0496115_0020855 3300048918 Bacteria 5058
445 Ga0496115_0058690 3300048918 Bacteria 3097
446 Ga0496115_0183314 3300048918 Bacteria 1730
447 Ga0496115_0338343 3300048918 Bacteria 1229
448 Ga0496115_0617059 3300048918 Bacteria 861
449 Ga0496121_0001041 3300048924 Bacteria 49426
450 Ga0496121_0126181 3300048924 Bacteria 1923
451 Ga0496125_0001356 3300048928 Bacteria 36075
452 Ga0496125_0010096 3300048928 Bacteria 9579
453 Ga0496126_0001870 3300048929 Bacteria 30630
454 Ga0496126_0039346 3300048929 Bacteria 4388
455 Ga0496126_0046311 3300048929 Bacteria 3990
456 Ga0496126_0048968 3300048929 Bacteria 3859
457 Ga0496126_0088139 3300048929 Bacteria 2734
458 Ga0496126_0134761 3300048929 Bacteria 2131
459 Ga0501031_0048554 3300049568 Bacteria 2765
460 Ga0501031_0350826 3300049568 Bacteria 955
461 Ga0501032_0002335 3300049569 Bacteria 14880
462 Ga0501032_0106256 3300049569 Bacteria 1859
463 Ga0501032_0166864 3300049569 Bacteria 1444
464 Ga0501032_0403833 3300049569 Bacteria 877
465 Ga0501033_0000116 3300049570 Bacteria 76410
466 Ga0501033_0000291 3300049570 Bacteria 48207
467 Ga0501033_0374945 3300049570 Bacteria 994
468 Ga0501033_0504719 3300049570 Bacteria 836
469 Ga0501034_0000108 3300049571 Bacteria 152258
470 Ga0501034_0070423 3300049571 Bacteria 3508
471 Ga0501034_0218421 3300049571 Bacteria 1859
472 Ga0501034_0315696 3300049571 Bacteria 1496
473 Ga0501034_0869956 3300049571 Bacteria 790
474 Ga0501036_0000065 3300049572 Bacteria 68031
475 Ga0501036_0004067 3300049572 Bacteria 11766
476 Ga0501037_0000507 3300049573 Bacteria 31211
477 Ga0501037_0008451 3300049573 Bacteria 7550
478 Ga0501037_0054997 3300049573 Bacteria 2910
479 Ga0501037_0377047 3300049573 Bacteria 975
480 Ga0501038_0006379 3300049574 Bacteria 10919
481 Ga0501038_0042047 3300049574 Bacteria 3982
482 Ga0501039_0000523 3300049575 Bacteria 27749
483 Ga0501039_0035535 3300049575 Bacteria 3845
484 Ga0501039_0042661 3300049575 Bacteria 3504
485 Ga0501039_0056308 3300049575 Bacteria 3045
486 Ga0501042_0161160 3300049578 Bacteria 1619
487 Ga0501043_0000226 3300049579 Bacteria 51303
488 Ga0501043_0001380 3300049579 Bacteria 21276
489 Ga0501043_0114767 3300049579 Bacteria 2114
490 Ga0501043_0252981 3300049579 Bacteria 1356
491 Ga0501043_0522477 3300049579 Bacteria 884
492 Ga0501046_0198703 3300049580 Bacteria 1492
493 Ga0501046_0203828 3300049580 Bacteria 1471
494 Ga0501047_0000325 3300049581 Bacteria 55223
495 Ga0501047_0014996 3300049581 Bacteria 7374
496 Ga0501047_0111971 3300049581 Bacteria 2612
497 Ga0501047_0328062 3300049581 Bacteria 1369
498 Ga0501047_0636394 3300049581 Bacteria 886
499 Ga0501048_0000202 3300049582 Bacteria 39003
500 Ga0501067_0000193 3300049583 Bacteria 34437
501 Ga0501067_0004861 3300049583 Bacteria 7459
502 Ga0501068_0025864 3300049584 Bacteria 3454
503 Ga0501068_0121956 3300049584 Bacteria 1626
504 Ga0501068_0170644 3300049584 Bacteria 1373
505 Ga0501069_0001648 3300049585 Bacteria 11090
506 Ga0501070_0089234 3300049586 Bacteria 2551
507 Ga0501070_0110625 3300049586 Bacteria 2270
508 Ga0501070_0467095 3300049586 Bacteria 1016
509 Ga0501070_0565484 3300049586 Bacteria 909
510 Ga0501071_0075720 3300049587 Bacteria 2457
511 Ga0501071_0124924 3300049587 Bacteria 1909
512 Ga0501071_0443240 3300049587 Bacteria 994
513 Ga0501072_0001162 3300049588 Bacteria 19608
514 Ga0501072_0051653 3300049588 Bacteria 3237
515 Ga0501073_0000373 3300049589 Bacteria 30171
516 Ga0501074_0000409 3300049590 Bacteria 25689
517 Ga0501074_0039509 3300049590 Bacteria 3417
518 Ga0501076_0089520 3300049592 Bacteria 2474
519 Ga0501076_0225551 3300049592 Bacteria 1531
520 Ga0501076_0419249 3300049592 Bacteria 1101
521 Ga0501079_0016590 3300049741 Bacteria 5624
522 Ga0501079_0034431 3300049741 Bacteria 3897
523 Ga0501079_0275301 3300049741 Bacteria 1316
524 Ga0501080_0116701 3300049742 Bacteria 2474
525 Ga0501080_0197228 3300049742 Bacteria 1849
526 Ga0501080_0591588 3300049742 Bacteria 985
527 Ga0501083_0000915 3300049744 Bacteria 19583
528 Ga0501083_0152777 3300049744 Bacteria 1511
529 Ga0501035_0000079 3300049822 Bacteria 118194
530 Ga0501035_0061886 3300049822 Bacteria 3330
531 Ga0501035_0104376 3300049822 Bacteria 2485
532 Ga0501035_0386273 3300049822 Bacteria 1167
533 Ga0501044_0000085 3300049823 Bacteria 114339
534 Ga0501044_0840446 3300049823 Bacteria 795
535 Ga0501045_0028832 3300049824 Bacteria 4006
536 Ga0501045_0283525 3300049824 Bacteria 1233
537 nmdc:mga03683_223836_c1 3300050489 Bacteria 869
538 nmdc:mga03n38_40904_c1 3300050490 Bacteria 2017
539 nmdc:mga00v17_188691_c1 3300050491 Bacteria 1331
540 nmdc:mga00v17_246253_c1 3300050491 Bacteria 1159
541 nmdc:mga00v17_308311_c1 3300050491 Bacteria 1028
542 nmdc:mga00v17_313591_c1 3300050491 Bacteria 1019
543 nmdc:mga0yw44_194022_c1 3300050492 Bacteria 1340
544 nmdc:mga0yw44_474110_c1 3300050492 Bacteria 849
545 nmdc:mga0k408_190461_c1 3300050493 Bacteria 1224
546 nmdc:mga06z11_16944_c1 3300050494 Bacteria 3295
547 nmdc:mga06z11_350470_c1 3300050494 Bacteria 884
548 nmdc:mga07m45_35580_c2 3300050496 Bacteria 2277
549 nmdc:mga05p37_264278_c1 3300050507 Bacteria 2058
550 nmdc:mga09592_107619_c1 3300050508 Bacteria 2391
551 nmdc:mga0n895_409198_c1 3300050512 Bacteria 1372
552 nmdc:mga0rr50_163933_c1 3300050513 Bacteria 1806
553 Ga0495601_0090081 3300053077 Bacteria 1973
554 Ga0495612_0010804 3300053078 Bacteria 3688
555 Ga0495612_0053536 3300053078 Bacteria 1662
556 Ga0495612_0058223 3300053078 Bacteria 1597
557 Ga0500635_0012936 3300053080 Bacteria 2410
558 Ga0495595_0000766 3300053084 Bacteria 12210
559 Ga0495619_0000322 3300053085 Bacteria 33576
560 Ga0500643_023038 3300053087 Bacteria 1995
561 Ga0500581_061902 3300053089 Bacteria 1893
562 Ga0500651_0129139 3300053093 Bacteria 1529
563 Ga0500566_0092485 3300053094 Bacteria 1670
564 Ga0500650_0004718 3300053098 Bacteria 4972
565 Ga0500554_001458 3300053102 Bacteria 4573
566 Ga0500554_005479 3300053102 Bacteria 2771
567 Ga0500554_070425 3300053102 Bacteria 1137
568 Ga0500555_017026 3300053103 Bacteria 2095
569 Ga0500556_0022186 3300053104 Bacteria 2059
570 Ga0500595_009636 3300053119 Bacteria 3889
571 Ga0500642_0000168 3300053130 Bacteria 27108
572 Ga0500568_0006518 3300053139 Bacteria 5848
573 Ga0500568_0030601 3300053139 Bacteria 2227
574 Ga0500568_0075290 3300053139 Bacteria 1287
575 Ga0500577_0126740 3300053142 Bacteria 1067
576 Ga0500603_000677 3300053150 Bacteria 8300
577 Ga0500604_0001390 3300053151 Bacteria 6740
578 Ga0500604_0015377 3300053151 Bacteria 2095
579 Ga0500634_0102149 3300053161 Bacteria 1433
580 Ga0500638_010285 3300053162 Bacteria 4089
581 Ga0500636_0045778 3300053177 Bacteria 2580
582 Ga0500637_0000490 3300053178 Bacteria 15336
583 Ga0500637_0004706 3300053178 Bacteria 6521
584 Ga0500645_016532 3300053730 Bacteria 2322
585 Ga0501084_0048225 3300054114 Bacteria 3565
586 Ga0501084_0056089 3300054114 Bacteria 3296
587 Ga0501084_0357871 3300054114 Bacteria 1233
588 Ga0500661_000389 3300055283 Bacteria 8086
589 Ga0501082_0003006 3300060353 Bacteria 14737
590 Ga0501082_0045208 3300060353 Bacteria 3797
591 Ga0501082_0438604 3300060353 Bacteria 1141
592 Ga0466962_0103541 3300061719 Bacteria 1367

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0048354 Ga0373927_0048354_193_936 177
2 3300005455 Ga0070663_100010706 Ga0070663_1000107062 189
3 3300005548 Ga0070665_100010052 Ga0070665_1000100524 189
4 3300006051 Ga0075364_10273719 Ga0075364_102737192 189
5 3300006178 Ga0075367_10011870 Ga0075367_100118703 189
6 3300006353 Ga0075370_10051978 Ga0075370_100519783 189
7 3300006358 Ga0068871_100168089 Ga0068871_1001680892 189
8 3300009174 Ga0105241_10341519 Ga0105241_103415192 189
9 3300014969 Ga0157376_10449054 Ga0157376_104490542 189
10 3300025297 Ga0209758_1064975 Ga0209758_10649752 189
11 3300025911 Ga0207654_10287603 Ga0207654_102876031 189
12 3300025936 Ga0207670_10256585 Ga0207670_102565852 189
13 3300025937 Ga0207669_10799430 Ga0207669_107994301 189
14 3300026067 Ga0207678_10069844 Ga0207678_100698442 189
15 3300028379 Ga0268266_10007255 Ga0268266_100072554 189
16 3300048905 Ga0496102_0473655 Ga0496102_0473655_382_1035 189
17 3300048917 Ga0496114_0046864 Ga0496114_0046864_2774_3427 189
18 3300050490 nmdc:mga03n38_40904_c1 nmdc:mga03n38_40904_c1_594_1247 189
19 3300050491 nmdc:mga00v17_313591_c1 nmdc:mga00v17_313591_c1_68_721 189
20 3300050494 nmdc:mga06z11_16944_c1 nmdc:mga06z11_16944_c1_1877_2530 189
21 3300050496 nmdc:mga07m45_35580_c2 nmdc:mga07m45_35580_c2_1108_1761 189
22 3300048904 Ga0496101_0612458 Ga0496101_0612458_27_662 192
23 3300005614 Ga0068856_100000255 Ga0068856_1000002558 193
24 3300026078 Ga0207702_10000390 Ga0207702_100003908 193
25 3300048918 Ga0496115_0617059 Ga0496115_0617059_24_629 193
26 3300031548 Ga0307408_100630262 Ga0307408_1006302622 195
27 3300025916 Ga0207663_10651671 Ga0207663_106516711 196
28 3300048904 Ga0496101_0206620 Ga0496101_0206620_177_821 196
29 3300048905 Ga0496102_0329074 Ga0496102_0329074_16_660 196
30 3300048907 Ga0496104_0087462 Ga0496104_0087462_1626_2270 196
31 3300048908 Ga0496105_0200326 Ga0496105_0200326_790_1434 196
32 3300048910 Ga0496107_0038553 Ga0496107_0038553_692_1336 196
33 3300048911 Ga0496108_0000801 Ga0496108_0000801_11074_11718 196
34 3300048912 Ga0496109_0013479 Ga0496109_0013479_4996_5640 196
35 3300048913 Ga0496110_0028041 Ga0496110_0028041_1692_2336 196
36 3300048914 Ga0496111_0192706 Ga0496111_0192706_13_657 196
37 3300048915 Ga0496112_0012703 Ga0496112_0012703_659_1303 196
38 3300048917 Ga0496114_0175225 Ga0496114_0175225_465_1109 196
39 3300031712 Ga0265342_10024685 Ga0265342_100246852 197
40 3300005548 Ga0070665_100077377 Ga0070665_1000773772 198
41 3300028379 Ga0268266_10109213 Ga0268266_101092132 198
42 3300005983 Ga0081540_1054929 Ga0081540_10549293 199
43 3300048929 Ga0496126_0001870 Ga0496126_0001870_26574_27221 199
44 3300048929 Ga0496126_0046311 Ga0496126_0046311_308_955 199
45 3300050492 nmdc:mga0yw44_474110_c1 nmdc:mga0yw44_474110_c1_160_765 199
46 iso_pu_bacteria 2524023210 2524469268 199
47 3300005293 Ga0065715_10190046 Ga0065715_101900461 200
48 3300005329 Ga0070683_100893836 Ga0070683_1008938361 200
49 3300005344 Ga0070661_100293586 Ga0070661_1002935862 200
50 3300005434 Ga0070709_10338889 Ga0070709_103388892 200
51 3300005455 Ga0070663_100241990 Ga0070663_1002419901 200
52 3300005458 Ga0070681_10400094 Ga0070681_104000941 200
53 3300005536 Ga0070697_100369583 Ga0070697_1003695832 200
54 3300005544 Ga0070686_100268820 Ga0070686_1002688201 200
55 3300005563 Ga0068855_101004551 Ga0068855_1010045511 200
56 3300005842 Ga0068858_100576248 Ga0068858_1005762482 200
57 3300009545 Ga0105237_10354260 Ga0105237_103542602 200
58 3300025900 Ga0207710_10067903 Ga0207710_100679032 200
59 3300025901 Ga0207688_10285403 Ga0207688_102854032 200
60 3300025903 Ga0207680_10574634 Ga0207680_105746341 200
61 3300025914 Ga0207671_10069722 Ga0207671_100697222 200
62 3300025916 Ga0207663_10371826 Ga0207663_103718261 200
63 3300025916 Ga0207663_10483558 Ga0207663_104835581 200
64 3300025919 Ga0207657_10127174 Ga0207657_101271742 200
65 3300025921 Ga0207652_10725150 Ga0207652_107251501 200
66 3300025927 Ga0207687_10454550 Ga0207687_104545502 200
67 3300025932 Ga0207690_10287624 Ga0207690_102876242 200
68 3300025933 Ga0207706_10102748 Ga0207706_101027484 200
69 3300025934 Ga0207686_10272232 Ga0207686_102722322 200
70 3300025935 Ga0207709_10049768 Ga0207709_100497683 200
71 3300025939 Ga0207665_10193048 Ga0207665_101930481 200
72 3300025940 Ga0207691_10144386 Ga0207691_101443861 200
73 3300025941 Ga0207711_10717658 Ga0207711_107176582 200
74 3300025960 Ga0207651_10542384 Ga0207651_105423841 200
75 3300025986 Ga0207658_10160375 Ga0207658_101603752 200
76 3300026041 Ga0207639_10124597 Ga0207639_101245971 200
77 3300026067 Ga0207678_10111648 Ga0207678_101116483 200
78 3300026067 Ga0207678_10178230 Ga0207678_101782302 200
79 3300026116 Ga0207674_10317001 Ga0207674_103170011 200
80 3300026118 Ga0207675_100224686 Ga0207675_1002246862 200
81 3300028379 Ga0268266_10033415 Ga0268266_100334153 200
82 3300031238 Ga0265332_10075241 Ga0265332_100752412 200
83 3300031711 Ga0265314_10077286 Ga0265314_100772862 200
84 3300035086 Ga0373934_0003005 Ga0373934_0003005_4989_5591 200
85 3300035092 Ga0373952_0015932 Ga0373952_0015932_868_1470 200
86 3300035117 Ga0373953_0002068 Ga0373953_0002068_1923_2525 200
87 3300035119 Ga0373956_0000465 Ga0373956_0000465_12528_13130 200
88 3300035120 Ga0373957_0000114 Ga0373957_0000114_1300_1902 200
89 3300035172 Ga0373955_0000133 Ga0373955_0000133_20496_21098 200
90 3300035692 Ga0373935_0254390 Ga0373935_0254390_509_1111 200
91 3300035724 Ga0373933_0000286 Ga0373933_0000286_7259_7861 200
92 3300041451 Ga0451791_0495528 Ga0451791_0495528_163_771 200
93 3300041997 Ga0439431_0050076 Ga0439431_0050076_32_634 200
94 3300046454 Ga0495592_0000686 Ga0495592_0000686_7755_8357 200
95 3300046457 Ga0495590_0085741 Ga0495590_0085741_23_625 200
96 3300046459 Ga0495629_0000503 Ga0495629_0000503_24572_25174 200
97 3300046462 Ga0495651_0006168 Ga0495651_0006168_7036_7638 200
98 3300046463 Ga0495653_0066000 Ga0495653_0066000_1519_2121 200
99 3300046491 Ga0495584_0057657 Ga0495584_0057657_352_954 200
100 3300046499 Ga0495594_0185904 Ga0495594_0185904_161_763 200
101 3300046511 Ga0495608_0000586 Ga0495608_0000586_17391_17993 200
102 3300046516 Ga0495628_0001371 Ga0495628_0001371_17636_18238 200
103 3300046524 Ga0495648_0001145 Ga0495648_0001145_14320_14922 200
104 3300046525 Ga0495663_0188020 Ga0495663_0188020_14_616 200
105 3300046529 Ga0495652_0001568 Ga0495652_0001568_9789_10391 200
106 3300046533 Ga0495640_0008795 Ga0495640_0008795_5413_6015 200
107 3300046538 Ga0495609_0031408 Ga0495609_0031408_250_852 200
108 3300046543 Ga0495645_0022212 Ga0495645_0022212_1294_1896 200
109 3300046559 Ga0495667_0000795 Ga0495667_0000795_6695_7297 200
110 3300046615 Ga0495656_0039061 Ga0495656_0039061_26_628 200
111 3300046616 Ga0495668_0049088 Ga0495668_0049088_302_904 200
112 3300046642 Ga0495634_0006542 Ga0495634_0006542_5337_5939 200
113 3300046660 Ga0495625_0563289 Ga0495625_0563289_57_659 200
114 3300046663 Ga0495635_0000417 Ga0495635_0000417_7587_8189 200
115 3300046675 Ga0495657_0000715 Ga0495657_0000715_19237_19839 200
116 3300046678 Ga0495599_0002562 Ga0495599_0002562_9305_9907 200
117 3300046679 Ga0495623_0002109 Ga0495623_0002109_7724_8326 200
118 3300046680 Ga0495646_0008630 Ga0495646_0008630_1177_1779 200
119 3300046684 Ga0495669_0005467 Ga0495669_0005467_4409_5011 200
120 3300046689 Ga0495613_0004447 Ga0495613_0004447_9744_10346 200
121 3300046691 Ga0495670_0421456 Ga0495670_0421456_66_668 200
122 3300046809 Ga0495600_0000372 Ga0495600_0000372_22204_22806 200
123 3300046810 Ga0495660_0253140 Ga0495660_0253140_136_738 200
124 3300047317 Ga0495604_0001526 Ga0495604_0001526_9177_9779 200
125 3300047317 Ga0495604_0435193 Ga0495604_0435193_84_686 200
126 3300047318 Ga0495636_0283483 Ga0495636_0283483_86_688 200
127 3300047319 Ga0495674_0002817 Ga0495674_0002817_13924_14526 200
128 3300047320 Ga0495672_0084837 Ga0495672_0084837_1090_1692 200
129 3300047322 Ga0495680_0006935 Ga0495680_0006935_9177_9779 200
130 3300047444 Ga0495675_0000478 Ga0495675_0000478_7768_8370 200
131 3300047471 Ga0495684_0000155 Ga0495684_0000155_30140_30742 200
132 3300047673 Ga0495593_0002338 Ga0495593_0002338_6036_6638 200
133 3300048088 Ga0495602_0004699 Ga0495602_0004699_6823_7425 200
134 3300048910 Ga0496107_0182094 Ga0496107_0182094_139_741 200
135 3300048924 Ga0496121_0001041 Ga0496121_0001041_24766_25368 200
136 3300048924 Ga0496121_0126181 Ga0496121_0126181_199_801 200
137 3300048929 Ga0496126_0134761 Ga0496126_0134761_513_1145 200
138 3300049592 Ga0501076_0419249 Ga0501076_0419249_43_666 200
139 3300049741 Ga0501079_0275301 Ga0501079_0275301_434_1057 200
140 3300053084 Ga0495595_0000766 Ga0495595_0000766_10938_11540 200
141 3300053085 Ga0495619_0000322 Ga0495619_0000322_32388_32990 200
142 3300053139 Ga0500568_0075290 Ga0500568_0075290_347_949 200
143 iso_pu_bacteria 2874604998 2874606296 200
144 3300005347 Ga0070668_100143353 Ga0070668_1001433532 201
145 3300006844 Ga0075428_100476441 Ga0075428_1004764411 201
146 3300006880 Ga0075429_100097541 Ga0075429_1000975412 201
147 3300009147 Ga0114129_10130405 Ga0114129_101304053 201
148 3300025909 Ga0207705_10143889 Ga0207705_101438892 201
149 3300035118 Ga0373954_0318855 Ga0373954_0318855_143_748 201
150 3300039453 Ga0436362_0379505 Ga0436362_0379505_1642_2247 201
151 3300046542 Ga0495597_0030847 Ga0495597_0030847_32_688 201
152 3300048928 Ga0496125_0001356 Ga0496125_0001356_14112_14744 201
153 3300048928 Ga0496125_0010096 Ga0496125_0010096_2879_3511 201
154 3300048929 Ga0496126_0088139 Ga0496126_0088139_110_742 201
155 3300049571 Ga0501034_0218421 Ga0501034_0218421_258_881 201
156 3300049579 Ga0501043_0114767 Ga0501043_0114767_923_1546 201
157 3300049580 Ga0501046_0203828 Ga0501046_0203828_739_1362 201
158 3300049581 Ga0501047_0636394 Ga0501047_0636394_151_774 201
159 3300049822 Ga0501035_0061886 Ga0501035_0061886_1985_2608 201
160 3300050507 nmdc:mga05p37_264278_c1 nmdc:mga05p37_264278_c1_1151_1756 201
161 3300050508 nmdc:mga09592_107619_c1 nmdc:mga09592_107619_c1_364_969 201
162 iso_pu_bacteria 2513237141 2513889677 201
163 3300007265 Ga0099794_10215355 Ga0099794_102153552 202
164 3300010159 Ga0099796_10105770 Ga0099796_101057701 202
165 3300031616 Ga0307508_10133194 Ga0307508_101331942 202
166 3300031730 Ga0307516_10108177 Ga0307516_101081772 202
167 3300035170 Ga0373943_0000900 Ga0373943_0000900_456_1082 202
168 3300035692 Ga0373935_0040906 Ga0373935_0040906_1958_2584 202
169 3300035695 Ga0373927_0001032 Ga0373927_0001032_11865_12491 202
170 3300036401 Ga0373937_0412531 Ga0373937_0412531_519_1145 202
171 3300037068 Ga0373925_0002484 Ga0373925_0002484_13722_14348 202
172 3300039437 Ga0436365_1885487 Ga0436365_1885487_393_1013 202
173 3300039447 Ga0436361_0146597 Ga0436361_0146597_1484_2146 202
174 3300039450 Ga0436363_1500653 Ga0436363_1500653_3549_4169 202
175 3300041460 Ga0451802_2184100 Ga0451802_2184100_81_701 202
176 3300044684 Ga0466966_0053238 Ga0466966_0053238_855_1505 202
177 3300044765 Ga0466970_0124029 Ga0466970_0124029_350_1000 202
178 3300045049 Ga0466959_0172154 Ga0466959_0172154_349_999 202
179 3300046454 Ga0495592_0176371 Ga0495592_0176371_596_1222 202
180 3300046455 Ga0495603_0000209 Ga0495603_0000209_20633_21259 202
181 3300046459 Ga0495629_0015792 Ga0495629_0015792_526_1152 202
182 3300046461 Ga0495641_0010107 Ga0495641_0010107_2615_3241 202
183 3300046472 Ga0495580_0001676 Ga0495580_0001676_16546_17172 202
184 3300046473 Ga0495582_0000152 Ga0495582_0000152_8656_9282 202
185 3300046475 Ga0495639_0000087 Ga0495639_0000087_18170_18796 202
186 3300046476 Ga0495662_0001427 Ga0495662_0001427_8636_9262 202
187 3300046477 Ga0495664_0019809 Ga0495664_0019809_2760_3386 202
188 3300046499 Ga0495594_0000129 Ga0495594_0000129_8960_9586 202
189 3300046516 Ga0495628_0193730 Ga0495628_0193730_316_942 202
190 3300046526 Ga0495666_0114509 Ga0495666_0114509_556_1182 202
191 3300046531 Ga0495665_0000124 Ga0495665_0000124_25028_25654 202
192 3300046533 Ga0495640_0035595 Ga0495640_0035595_393_1019 202
193 3300046557 Ga0495622_0011173 Ga0495622_0011173_2255_2881 202
194 3300046642 Ga0495634_0000599 Ga0495634_0000599_25339_25965 202
195 3300046663 Ga0495635_0003181 Ga0495635_0003181_489_1115 202
196 3300046674 Ga0495588_0001335 Ga0495588_0001335_630_1256 202
197 3300046680 Ga0495646_0062195 Ga0495646_0062195_548_1174 202
198 3300046681 Ga0495647_0002338 Ga0495647_0002338_2380_3006 202
199 3300046683 Ga0495658_0001819 Ga0495658_0001819_455_1081 202
200 3300046689 Ga0495613_0016955 Ga0495613_0016955_4265_4891 202
201 3300046690 Ga0495624_0001738 Ga0495624_0001738_7368_7994 202
202 3300047315 Ga0495581_0000176 Ga0495581_0000176_27310_27936 202
203 3300047319 Ga0495674_0002170 Ga0495674_0002170_8633_9259 202
204 3300047321 Ga0495676_0058409 Ga0495676_0058409_199_825 202
205 3300047469 Ga0495673_0029388 Ga0495673_0029388_1508_2134 202
206 3300047471 Ga0495684_0022619 Ga0495684_0022619_3739_4365 202
207 3300047673 Ga0495593_0000022 Ga0495593_0000022_43813_44439 202
208 3300048089 Ga0495614_0018413 Ga0495614_0018413_959_1585 202
209 3300048905 Ga0496102_0115880 Ga0496102_0115880_1594_2229 202
210 3300049571 Ga0501034_0869956 Ga0501034_0869956_76_723 202
211 3300049578 Ga0501042_0161160 Ga0501042_0161160_253_891 202
212 3300049581 Ga0501047_0111971 Ga0501047_0111971_1423_2070 202
213 3300049586 Ga0501070_0565484 Ga0501070_0565484_80_727 202
214 3300049587 Ga0501071_0124924 Ga0501071_0124924_1016_1654 202
215 3300049742 Ga0501080_0197228 Ga0501080_0197228_865_1503 202
216 3300049822 Ga0501035_0386273 Ga0501035_0386273_106_753 202
217 3300049823 Ga0501044_0840446 Ga0501044_0840446_107_754 202
218 3300053080 Ga0500635_0012936 Ga0500635_0012936_725_1345 202
219 3300053102 Ga0500554_001458 Ga0500554_001458_1440_2060 202
220 3300053150 Ga0500603_000677 Ga0500603_000677_5065_5685 202
221 3300053178 Ga0500637_0004706 Ga0500637_0004706_3392_4012 202
222 iso_pu_bacteria 2602042107 2603859894 202
223 iso_pu_bacteria 2893066018 2893071115 202
224 iso_pu_bacteria 2903748898 2903754263 202
225 iso_pu_bacteria 2919073203 2919078773 202
226 iso_pu_bacteria 8019565922 8019570746 202
227 3300005334 Ga0068869_100054805 Ga0068869_1000548052 203
228 3300005844 Ga0068862_100116716 Ga0068862_1001167161 203
229 3300006871 Ga0075434_100221546 Ga0075434_1002215462 203
230 3300009094 Ga0111539_10245086 Ga0111539_102450862 203
231 3300025909 Ga0207705_10056172 Ga0207705_100561724 203
232 3300026041 Ga0207639_10114912 Ga0207639_101149121 203
233 3300048915 Ga0496112_0165616 Ga0496112_0165616_1285_1941 203
234 3300049572 Ga0501036_0004067 Ga0501036_0004067_37_648 203
235 3300049573 Ga0501037_0377047 Ga0501037_0377047_47_658 203
236 3300049587 Ga0501071_0443240 Ga0501071_0443240_11_622 203
237 3300050512 nmdc:mga0n895_409198_c1 nmdc:mga0n895_409198_c1_104_745 203
238 3300050513 nmdc:mga0rr50_163933_c1 nmdc:mga0rr50_163933_c1_452_1087 203
239 3300005337 Ga0070682_100035583 Ga0070682_1000355832 204
240 3300005458 Ga0070681_10013957 Ga0070681_100139573 204
241 3300005530 Ga0070679_100307530 Ga0070679_1003075302 204
242 3300005547 Ga0070693_100281143 Ga0070693_1002811431 204
243 3300005578 Ga0068854_100246891 Ga0068854_1002468911 204
244 3300010375 Ga0105239_10181230 Ga0105239_101812302 204
245 3300013104 Ga0157370_10167808 Ga0157370_101678082 204
246 3300013307 Ga0157372_10967436 Ga0157372_109674361 204
247 3300025912 Ga0207707_10000462 Ga0207707_100004623 204
248 3300025917 Ga0207660_10082320 Ga0207660_100823202 204
249 3300025921 Ga0207652_10341456 Ga0207652_103414561 204
250 3300025981 Ga0207640_10116379 Ga0207640_101163793 204
251 3300039438 Ga0436360_0832736 Ga0436360_0832736_537_1181 204
252 3300039447 Ga0436361_0523452 Ga0436361_0523452_710_1354 204
253 3300039453 Ga0436362_0733513 Ga0436362_0733513_2171_2815 204
254 3300049575 Ga0501039_0035535 Ga0501039_0035535_2691_3320 204
255 3300049587 Ga0501071_0075720 Ga0501071_0075720_910_1539 204
256 3300049590 Ga0501074_0039509 Ga0501074_0039509_2223_2852 204
257 3300049592 Ga0501076_0089520 Ga0501076_0089520_1103_1732 204
258 3300054114 Ga0501084_0056089 Ga0501084_0056089_2172_2801 204
259 3300060353 Ga0501082_0438604 Ga0501082_0438604_115_729 204
260 iso_pu_bacteria 2857524615 2857524886 204
261 3300005336 Ga0070680_100215092 Ga0070680_1002150922 205
262 3300005364 Ga0070673_100145775 Ga0070673_1001457752 205
263 3300005456 Ga0070678_100264233 Ga0070678_1002642332 205
264 3300005458 Ga0070681_10215011 Ga0070681_102150112 205
265 3300005530 Ga0070679_100224122 Ga0070679_1002241221 205
266 3300005548 Ga0070665_100473803 Ga0070665_1004738031 205
267 3300005578 Ga0068854_100594510 Ga0068854_1005945101 205
268 3300005840 Ga0068870_10049642 Ga0068870_100496423 205
269 3300006048 Ga0075363_100253832 Ga0075363_1002538322 205
270 3300013297 Ga0157378_10148390 Ga0157378_101483901 205
271 3300014325 Ga0163163_11423370 Ga0163163_114233701 205
272 3300025912 Ga0207707_10091864 Ga0207707_100918642 205
273 3300025921 Ga0207652_10051300 Ga0207652_100513004 205
274 3300026121 Ga0207683_10055123 Ga0207683_100551233 205
275 3300035724 Ga0373933_0119571 Ga0373933_0119571_523_1203 205
276 3300035725 Ga0373947_0494742 Ga0373947_0494742_22_684 205
277 3300041413 Ga0439465_0012566 Ga0439465_0012566_715_1353 205
278 3300046477 Ga0495664_0172643 Ga0495664_0172643_79_780 205
279 3300046678 Ga0495599_0348234 Ga0495599_0348234_31_708 205
280 3300047470 Ga0495681_0050989 Ga0495681_0050989_903_1547 205
281 3300050491 nmdc:mga00v17_308311_c1 nmdc:mga00v17_308311_c1_373_1005 205
282 3300053078 Ga0495612_0010804 Ga0495612_0010804_638_1315 205
283 3300053102 Ga0500554_070425 Ga0500554_070425_332_952 205
284 3300053130 Ga0500642_0000168 Ga0500642_0000168_22658_23299 205
285 3300005329 Ga0070683_100042499 Ga0070683_1000424992 206
286 3300005336 Ga0070680_100415362 Ga0070680_1004153621 206
287 3300005535 Ga0070684_100008771 Ga0070684_1000087715 206
288 3300005539 Ga0068853_100615616 Ga0068853_1006156161 206
289 3300005563 Ga0068855_100184228 Ga0068855_1001842282 206
290 3300005616 Ga0068852_100002678 Ga0068852_10000267810 206
291 3300006175 Ga0070712_100081372 Ga0070712_1000813723 206
292 3300009093 Ga0105240_10211364 Ga0105240_102113641 206
293 3300009545 Ga0105237_10317932 Ga0105237_103179322 206
294 3300013105 Ga0157369_10002191 Ga0157369_1000219119 206
295 3300013105 Ga0157369_10015878 Ga0157369_100158782 206
296 3300020069 Ga0197907_11260994 Ga0197907_112609942 206
297 3300025913 Ga0207695_10074920 Ga0207695_100749203 206
298 3300025913 Ga0207695_10167645 Ga0207695_101676453 206
299 3300025932 Ga0207690_10124712 Ga0207690_101247122 206
300 3300025944 Ga0207661_10032714 Ga0207661_100327142 206
301 3300025949 Ga0207667_10338931 Ga0207667_103389313 206
302 3300025981 Ga0207640_10182136 Ga0207640_101821362 206
303 3300037418 Ga0395900_0052916 Ga0395900_0052916_2904_3563 206
304 3300037466 Ga0395898_0028926 Ga0395898_0028926_74_733 206
305 3300038443 Ga0395901_1004492 Ga0395901_1004492_135_794 206
306 3300048916 Ga0496113_0705248 Ga0496113_0705248_41_724 206
307 3300048918 Ga0496115_0183314 Ga0496115_0183314_223_888 206
308 3300053078 Ga0495612_0058223 Ga0495612_0058223_67_735 206
309 3300005336 Ga0070680_100111891 Ga0070680_1001118912 207
310 3300005341 Ga0070691_10283925 Ga0070691_102839251 207
311 3300005436 Ga0070713_100084736 Ga0070713_1000847364 207
312 3300005437 Ga0070710_10184661 Ga0070710_101846612 207
313 3300005445 Ga0070708_100218520 Ga0070708_1002185202 207
314 3300005458 Ga0070681_10113314 Ga0070681_101133143 207
315 3300005535 Ga0070684_100012842 Ga0070684_1000128426 207
316 3300005840 Ga0068870_10315406 Ga0068870_103154061 207
317 3300006028 Ga0070717_10126640 Ga0070717_101266402 207
318 3300006175 Ga0070712_100127596 Ga0070712_1001275961 207
319 3300006175 Ga0070712_100218246 Ga0070712_1002182462 207
320 3300007265 Ga0099794_10072905 Ga0099794_100729052 207
321 3300007265 Ga0099794_10133328 Ga0099794_101333281 207
322 3300009093 Ga0105240_10052104 Ga0105240_100521042 207
323 3300009545 Ga0105237_10045695 Ga0105237_100456954 207
324 3300009545 Ga0105237_10077319 Ga0105237_100773195 207
325 3300009551 Ga0105238_10325954 Ga0105238_103259544 207
326 3300010159 Ga0099796_10014229 Ga0099796_100142294 207
327 3300010375 Ga0105239_10206174 Ga0105239_102061742 207
328 3300013104 Ga0157370_10056758 Ga0157370_100567583 207
329 3300013105 Ga0157369_10116560 Ga0157369_101165601 207
330 3300013105 Ga0157369_10169842 Ga0157369_101698424 207
331 3300013306 Ga0163162_10247733 Ga0163162_102477332 207
332 3300013307 Ga0157372_10531674 Ga0157372_105316742 207
333 3300020082 Ga0206353_10616236 Ga0206353_106162362 207
334 3300025321 Ga0207656_10071332 Ga0207656_100713322 207
335 3300025898 Ga0207692_10036157 Ga0207692_100361572 207
336 3300025912 Ga0207707_10132662 Ga0207707_101326622 207
337 3300025915 Ga0207693_10063168 Ga0207693_100631682 207
338 3300025917 Ga0207660_10348180 Ga0207660_103481802 207
339 3300025928 Ga0207700_10285425 Ga0207700_102854252 207
340 3300025928 Ga0207700_10534829 Ga0207700_105348292 207
341 3300025939 Ga0207665_10047252 Ga0207665_100472522 207
342 3300025944 Ga0207661_10082676 Ga0207661_100826762 207
343 3300025972 Ga0207668_10065517 Ga0207668_100655174 207
344 3300026041 Ga0207639_10584406 Ga0207639_105844061 207
345 3300026067 Ga0207678_10410095 Ga0207678_104100951 207
346 3300026089 Ga0207648_10674754 Ga0207648_106747541 207
347 3300026116 Ga0207674_10036112 Ga0207674_100361124 207
348 3300027671 Ga0209588_1014130 Ga0209588_10141303 207
349 3300027671 Ga0209588_1027125 Ga0209588_10271251 207
350 3300028379 Ga0268266_10672765 Ga0268266_106727652 207
351 3300035691 Ga0373931_0204867 Ga0373931_0204867_399_1061 207
352 3300035695 Ga0373927_0111791 Ga0373927_0111791_107_763 207
353 3300035724 Ga0373933_0000151 Ga0373933_0000151_13061_13711 207
354 3300035725 Ga0373947_0008149 Ga0373947_0008149_18_689 207
355 3300037068 Ga0373925_0059809 Ga0373925_0059809_2028_2699 207
356 3300039437 Ga0436365_1918864 Ga0436365_1918864_34_696 207
357 3300044735 Ga0466968_0117353 Ga0466968_0117353_500_1171 207
358 3300044765 Ga0466970_0217143 Ga0466970_0217143_251_922 207
359 3300045049 Ga0466959_0094752 Ga0466959_0094752_114_785 207
360 3300046472 Ga0495580_0083904 Ga0495580_0083904_56_727 207
361 3300046473 Ga0495582_0162888 Ga0495582_0162888_477_1133 207
362 3300046506 Ga0495583_0097667 Ga0495583_0097667_421_1077 207
363 3300046515 Ga0495620_0006184 Ga0495620_0006184_2386_3042 207
364 3300046518 Ga0495631_0056289 Ga0495631_0056289_861_1517 207
365 3300046530 Ga0495654_0015913 Ga0495654_0015913_1391_2113 207
366 3300046535 Ga0495586_0108137 Ga0495586_0108137_621_1277 207
367 3300046660 Ga0495625_0059313 Ga0495625_0059313_1285_2007 207
368 3300046665 Ga0495661_0042963 Ga0495661_0042963_367_1023 207
369 3300046678 Ga0495599_0114418 Ga0495599_0114418_904_1584 207
370 3300047315 Ga0495581_0188450 Ga0495581_0188450_478_1128 207
371 3300047321 Ga0495676_0111203 Ga0495676_0111203_128_799 207
372 3300047469 Ga0495673_0074267 Ga0495673_0074267_59_715 207
373 3300048088 Ga0495602_0559201 Ga0495602_0559201_21_704 207
374 3300048903 Ga0496100_0030038 Ga0496100_0030038_742_1398 207
375 3300048905 Ga0496102_0501551 Ga0496102_0501551_82_738 207
376 3300048907 Ga0496104_0205471 Ga0496104_0205471_835_1497 207
377 3300048908 Ga0496105_0249278 Ga0496105_0249278_37_699 207
378 3300048911 Ga0496108_0065578 Ga0496108_0065578_2050_2712 207
379 3300048912 Ga0496109_0121916 Ga0496109_0121916_755_1417 207
380 3300048913 Ga0496110_0108028 Ga0496110_0108028_1082_1744 207
381 3300048914 Ga0496111_0081019 Ga0496111_0081019_64_726 207
382 3300048916 Ga0496113_0441427 Ga0496113_0441427_76_738 207
383 3300048918 Ga0496115_0020855 Ga0496115_0020855_1670_2326 207
384 3300048918 Ga0496115_0058690 Ga0496115_0058690_1984_2646 207
385 3300048918 Ga0496115_0338343 Ga0496115_0338343_471_1133 207
386 3300048929 Ga0496126_0039346 Ga0496126_0039346_187_909 207
387 3300048929 Ga0496126_0048968 Ga0496126_0048968_2950_3672 207
388 3300050491 nmdc:mga00v17_188691_c1 nmdc:mga00v17_188691_c1_170_826 207
389 3300053077 Ga0495601_0090081 Ga0495601_0090081_433_1089 207
390 3300053078 Ga0495612_0053536 Ga0495612_0053536_90_746 207
391 3300053087 Ga0500643_023038 Ga0500643_023038_73_729 207
392 3300053089 Ga0500581_061902 Ga0500581_061902_688_1344 207
393 3300053093 Ga0500651_0129139 Ga0500651_0129139_266_922 207
394 3300053094 Ga0500566_0092485 Ga0500566_0092485_386_1030 207
395 3300053098 Ga0500650_0004718 Ga0500650_0004718_3110_3832 207
396 3300053102 Ga0500554_005479 Ga0500554_005479_717_1361 207
397 3300053103 Ga0500555_017026 Ga0500555_017026_866_1522 207
398 3300053104 Ga0500556_0022186 Ga0500556_0022186_443_1114 207
399 3300053119 Ga0500595_009636 Ga0500595_009636_1702_2346 207
400 3300053139 Ga0500568_0006518 Ga0500568_0006518_2087_2809 207
401 3300053139 Ga0500568_0030601 Ga0500568_0030601_98_769 207
402 3300053142 Ga0500577_0126740 Ga0500577_0126740_363_1019 207
403 3300053151 Ga0500604_0001390 Ga0500604_0001390_5652_6374 207
404 3300053151 Ga0500604_0015377 Ga0500604_0015377_574_1230 207
405 3300053161 Ga0500634_0102149 Ga0500634_0102149_516_1172 207
406 3300053162 Ga0500638_010285 Ga0500638_010285_2142_2786 207
407 3300053178 Ga0500637_0000490 Ga0500637_0000490_6138_6782 207
408 3300053730 Ga0500645_016532 Ga0500645_016532_351_1073 207
409 3300055283 Ga0500661_000389 Ga0500661_000389_2988_3632 207
410 3300061719 Ga0466962_0103541 Ga0466962_0103541_425_1096 207
411 3300005334 Ga0068869_100201984 Ga0068869_1002019842 208
412 3300005347 Ga0070668_100145089 Ga0070668_1001450892 208
413 3300005353 Ga0070669_100398383 Ga0070669_1003983831 208
414 3300005366 Ga0070659_100073710 Ga0070659_1000737103 208
415 3300005367 Ga0070667_100425816 Ga0070667_1004258162 208
416 3300005438 Ga0070701_10035734 Ga0070701_100357343 208
417 3300005455 Ga0070663_100032781 Ga0070663_1000327811 208
418 3300005468 Ga0070707_100158450 Ga0070707_1001584502 208
419 3300005471 Ga0070698_100198507 Ga0070698_1001985073 208
420 3300005536 Ga0070697_100281107 Ga0070697_1002811072 208
421 3300005539 Ga0068853_100438728 Ga0068853_1004387282 208
422 3300005549 Ga0070704_100275192 Ga0070704_1002751922 208
423 3300005843 Ga0068860_100363885 Ga0068860_1003638852 208
424 3300005844 Ga0068862_100495862 Ga0068862_1004958622 208
425 3300006038 Ga0075365_10506249 Ga0075365_105062492 208
426 3300006051 Ga0075364_10151053 Ga0075364_101510533 208
427 3300006178 Ga0075367_10294992 Ga0075367_102949922 208
428 3300006195 Ga0075366_10086754 Ga0075366_100867542 208
429 3300006195 Ga0075366_10193094 Ga0075366_101930943 208
430 3300009098 Ga0105245_10093478 Ga0105245_100934783 208
431 3300009148 Ga0105243_10223074 Ga0105243_102230743 208
432 3300009553 Ga0105249_10066739 Ga0105249_100667392 208
433 3300011119 Ga0105246_10173671 Ga0105246_101736712 208
434 3300013297 Ga0157378_10292405 Ga0157378_102924051 208
435 3300014326 Ga0157380_10149349 Ga0157380_101493493 208
436 3300014968 Ga0157379_10287109 Ga0157379_102871092 208
437 3300014969 Ga0157376_10615567 Ga0157376_106155671 208
438 3300025910 Ga0207684_10652324 Ga0207684_106523242 208
439 3300025922 Ga0207646_10144882 Ga0207646_101448822 208
440 3300025923 Ga0207681_10530317 Ga0207681_105303171 208
441 3300025926 Ga0207659_10434925 Ga0207659_104349252 208
442 3300025932 Ga0207690_10115276 Ga0207690_101152762 208
443 3300025934 Ga0207686_10056263 Ga0207686_100562633 208
444 3300025937 Ga0207669_10109796 Ga0207669_101097961 208
445 3300025942 Ga0207689_10116568 Ga0207689_101165682 208
446 3300026035 Ga0207703_10174393 Ga0207703_101743932 208
447 3300026075 Ga0207708_10092879 Ga0207708_100928793 208
448 3300026142 Ga0207698_10206465 Ga0207698_102064652 208
449 3300027866 Ga0209813_10100709 Ga0209813_101007092 208
450 3300032126 Ga0307415_100434622 Ga0307415_1004346221 208
451 3300035242 Ga0373962_0104587 Ga0373962_0104587_140_799 208
452 3300037471 Ga0395905_0101770 Ga0395905_0101770_509_1168 208
453 3300046476 Ga0495662_0103242 Ga0495662_0103242_175_822 208
454 3300046520 Ga0495637_0078848 Ga0495637_0078848_526_1185 208
455 3300046538 Ga0495609_0134590 Ga0495609_0134590_379_1038 208
456 3300046664 Ga0495659_0093847 Ga0495659_0093847_248_907 208
457 3300046665 Ga0495661_0354334 Ga0495661_0354334_26_685 208
458 3300047445 Ga0495677_0081325 Ga0495677_0081325_345_1004 208
459 3300048903 Ga0496100_0059107 Ga0496100_0059107_1195_1854 208
460 3300048905 Ga0496102_0057015 Ga0496102_0057015_1269_1928 208
461 3300048909 Ga0496106_0229436 Ga0496106_0229436_192_851 208
462 3300048917 Ga0496114_0137864 Ga0496114_0137864_1051_1710 208
463 3300050489 nmdc:mga03683_223836_c1 nmdc:mga03683_223836_c1_89_721 208
464 3300050491 nmdc:mga00v17_246253_c1 nmdc:mga00v17_246253_c1_109_741 208
465 3300050492 nmdc:mga0yw44_194022_c1 nmdc:mga0yw44_194022_c1_469_1101 208
466 3300050493 nmdc:mga0k408_190461_c1 nmdc:mga0k408_190461_c1_473_1105 208
467 3300050494 nmdc:mga06z11_350470_c1 nmdc:mga06z11_350470_c1_80_712 208
468 3300053177 Ga0500636_0045778 Ga0500636_0045778_737_1396 208
469 3300005983 Ga0081540_1009395 Ga0081540_10093956 209
470 3300025906 Ga0207699_10006907 Ga0207699_100069072 209
471 3300031247 Ga0265340_10005476 Ga0265340_100054762 209
472 3300031250 Ga0265331_10074711 Ga0265331_100747112 209
473 3300031344 Ga0265316_10080407 Ga0265316_100804072 209
474 3300032002 Ga0307416_100744881 Ga0307416_1007448811 209
475 3300035083 Ga0373926_0016830 Ga0373926_0016830_892_1641 209
476 3300035111 Ga0373923_0124249 Ga0373923_0124249_72_821 209
477 3300035116 Ga0373945_0011722 Ga0373945_0011722_2005_2754 209
478 3300035117 Ga0373953_0112435 Ga0373953_0112435_344_1012 209
479 3300035170 Ga0373943_0211025 Ga0373943_0211025_213_962 209
480 3300035171 Ga0373946_0172612 Ga0373946_0172612_175_924 209
481 3300035410 Ga0373924_0234490 Ga0373924_0234490_96_764 209
482 3300035692 Ga0373935_0143711 Ga0373935_0143711_26_775 209
483 3300035695 Ga0373927_0040850 Ga0373927_0040850_2149_2898 209
484 3300035724 Ga0373933_0016412 Ga0373933_0016412_96_845 209
485 3300036401 Ga0373937_0131817 Ga0373937_0131817_1248_1997 209
486 3300037068 Ga0373925_0177652 Ga0373925_0177652_317_1066 209
487 3300046459 Ga0495629_0220309 Ga0495629_0220309_608_1276 209
488 3300046463 Ga0495653_0183879 Ga0495653_0183879_273_1022 209
489 3300046472 Ga0495580_0029809 Ga0495580_0029809_196_945 209
490 3300046473 Ga0495582_0009705 Ga0495582_0009705_1846_2595 209
491 3300046475 Ga0495639_0135693 Ga0495639_0135693_100_849 209
492 3300046477 Ga0495664_0156304 Ga0495664_0156304_486_1235 209
493 3300046514 Ga0495618_0010020 Ga0495618_0010020_4739_5488 209
494 3300046517 Ga0495630_0050670 Ga0495630_0050670_1760_2509 209
495 3300046559 Ga0495667_0213438 Ga0495667_0213438_469_1218 209
496 3300046642 Ga0495634_0097914 Ga0495634_0097914_204_872 209
497 3300046679 Ga0495623_0150269 Ga0495623_0150269_148_816 209
498 3300046683 Ga0495658_0005829 Ga0495658_0005829_15_764 209
499 3300046689 Ga0495613_0442568 Ga0495613_0442568_26_775 209
500 3300046690 Ga0495624_0064956 Ga0495624_0064956_113_862 209
501 3300047315 Ga0495581_0032467 Ga0495581_0032467_2170_2919 209
502 3300047317 Ga0495604_0217005 Ga0495604_0217005_621_1289 209
503 3300047319 Ga0495674_0057538 Ga0495674_0057538_232_981 209
504 3300047321 Ga0495676_0418533 Ga0495676_0418533_38_787 209
505 3300048089 Ga0495614_0058031 Ga0495614_0058031_613_1362 209
506 3300003659 JGI25404J52841_10001478 JGI25404J52841_100014783 210
507 3300005937 Ga0081455_10012458 Ga0081455_100124584 210
508 3300005937 Ga0081455_10024496 Ga0081455_100244961 210
509 3300005937 Ga0081455_10273521 Ga0081455_102735212 210
510 3300005983 Ga0081540_1004361 Ga0081540_10043618 210
511 3300005983 Ga0081540_1004490 Ga0081540_10044906 210
512 3300005983 Ga0081540_1016522 Ga0081540_10165223 210
513 3300005983 Ga0081540_1064466 Ga0081540_10644662 210
514 3300005983 Ga0081540_1080972 Ga0081540_10809722 210
515 3300013102 Ga0157371_10057862 Ga0157371_100578624 210
516 3300025915 Ga0207693_10104230 Ga0207693_101042301 210
517 3300026041 Ga0207639_10339961 Ga0207639_103399612 210
518 3300026067 Ga0207678_10494265 Ga0207678_104942652 210
519 3300046462 Ga0495651_0060038 Ga0495651_0060038_94_732 210
520 3300049568 Ga0501031_0048554 Ga0501031_0048554_600_1271 210
521 3300049568 Ga0501031_0350826 Ga0501031_0350826_246_914 210
522 3300049569 Ga0501032_0002335 Ga0501032_0002335_2305_2976 210
523 3300049569 Ga0501032_0106256 Ga0501032_0106256_1126_1794 210
524 3300049569 Ga0501032_0166864 Ga0501032_0166864_620_1288 210
525 3300049569 Ga0501032_0403833 Ga0501032_0403833_187_855 210
526 3300049570 Ga0501033_0000116 Ga0501033_0000116_50132_50803 210
527 3300049570 Ga0501033_0000291 Ga0501033_0000291_3226_3894 210
528 3300049570 Ga0501033_0374945 Ga0501033_0374945_256_924 210
529 3300049570 Ga0501033_0504719 Ga0501033_0504719_91_759 210
530 3300049571 Ga0501034_0000108 Ga0501034_0000108_73909_74580 210
531 3300049571 Ga0501034_0070423 Ga0501034_0070423_317_985 210
532 3300049571 Ga0501034_0315696 Ga0501034_0315696_809_1477 210
533 3300049572 Ga0501036_0000065 Ga0501036_0000065_62120_62791 210
534 3300049573 Ga0501037_0000507 Ga0501037_0000507_4612_5283 210
535 3300049573 Ga0501037_0008451 Ga0501037_0008451_812_1480 210
536 3300049573 Ga0501037_0054997 Ga0501037_0054997_849_1517 210
537 3300049574 Ga0501038_0006379 Ga0501038_0006379_1603_2271 210
538 3300049574 Ga0501038_0042047 Ga0501038_0042047_2996_3664 210
539 3300049575 Ga0501039_0000523 Ga0501039_0000523_11335_12006 210
540 3300049575 Ga0501039_0042661 Ga0501039_0042661_271_939 210
541 3300049575 Ga0501039_0056308 Ga0501039_0056308_1037_1705 210
542 3300049579 Ga0501043_0000226 Ga0501043_0000226_43370_44041 210
543 3300049579 Ga0501043_0001380 Ga0501043_0001380_14538_15206 210
544 3300049579 Ga0501043_0252981 Ga0501043_0252981_417_1085 210
545 3300049579 Ga0501043_0522477 Ga0501043_0522477_145_813 210
546 3300049580 Ga0501046_0198703 Ga0501046_0198703_289_957 210
547 3300049581 Ga0501047_0000325 Ga0501047_0000325_47290_47961 210
548 3300049581 Ga0501047_0014996 Ga0501047_0014996_1163_1831 210
549 3300049581 Ga0501047_0328062 Ga0501047_0328062_424_1092 210
550 3300049582 Ga0501048_0000202 Ga0501048_0000202_22668_23339 210
551 3300049583 Ga0501067_0000193 Ga0501067_0000193_17164_17835 210
552 3300049583 Ga0501067_0004861 Ga0501067_0004861_2901_3569 210
553 3300049584 Ga0501068_0025864 Ga0501068_0025864_2056_2727 210
554 3300049584 Ga0501068_0121956 Ga0501068_0121956_416_1084 210
555 3300049584 Ga0501068_0170644 Ga0501068_0170644_79_747 210
556 3300049585 Ga0501069_0001648 Ga0501069_0001648_7610_8281 210
557 3300049586 Ga0501070_0089234 Ga0501070_0089234_1035_1703 210
558 3300049586 Ga0501070_0110625 Ga0501070_0110625_1181_1852 210
559 3300049586 Ga0501070_0467095 Ga0501070_0467095_174_842 210
560 3300049588 Ga0501072_0001162 Ga0501072_0001162_3226_3897 210
561 3300049588 Ga0501072_0051653 Ga0501072_0051653_1098_1766 210
562 3300049589 Ga0501073_0000373 Ga0501073_0000373_6244_6915 210
563 3300049590 Ga0501074_0000409 Ga0501074_0000409_1770_2441 210
564 3300049592 Ga0501076_0225551 Ga0501076_0225551_426_1097 210
565 3300049741 Ga0501079_0016590 Ga0501079_0016590_2256_2927 210
566 3300049741 Ga0501079_0034431 Ga0501079_0034431_2527_3195 210
567 3300049742 Ga0501080_0116701 Ga0501080_0116701_1298_1966 210
568 3300049742 Ga0501080_0591588 Ga0501080_0591588_60_728 210
569 3300049744 Ga0501083_0000915 Ga0501083_0000915_7602_8273 210
570 3300049744 Ga0501083_0152777 Ga0501083_0152777_49_717 210
571 3300049822 Ga0501035_0000079 Ga0501035_0000079_72691_73362 210
572 3300049822 Ga0501035_0104376 Ga0501035_0104376_1460_2128 210
573 3300049823 Ga0501044_0000085 Ga0501044_0000085_47004_47675 210
574 3300049824 Ga0501045_0028832 Ga0501045_0028832_984_1652 210
575 3300049824 Ga0501045_0283525 Ga0501045_0283525_107_775 210
576 3300054114 Ga0501084_0048225 Ga0501084_0048225_2196_2867 210
577 3300054114 Ga0501084_0357871 Ga0501084_0357871_314_982 210
578 3300060353 Ga0501082_0003006 Ga0501082_0003006_3363_4034 210
579 3300060353 Ga0501082_0045208 Ga0501082_0045208_2464_3132 210
580 3300005434 Ga0070709_10000403 Ga0070709_1000040312 211
581 3300005435 Ga0070714_100006308 Ga0070714_1000063086 211
582 3300005436 Ga0070713_100023753 Ga0070713_1000237532 211
583 3300005437 Ga0070710_10002450 Ga0070710_100024502 211
584 3300005439 Ga0070711_100066299 Ga0070711_1000662993 211
585 3300006173 Ga0070716_100011253 Ga0070716_1000112535 211
586 3300021377 Ga0213874_10049892 Ga0213874_100498922 211
587 3300025906 Ga0207699_10000347 Ga0207699_1000034711 211
588 3300025915 Ga0207693_10042368 Ga0207693_100423684 211
589 3300025916 Ga0207663_10085080 Ga0207663_100850802 211
590 3300025928 Ga0207700_10255501 Ga0207700_102555011 211
591 3300025929 Ga0207664_10033776 Ga0207664_100337764 211
592 3300025939 Ga0207665_10005942 Ga0207665_100059422 211
593 3300028381 Ga0268264_10176646 Ga0268264_101766462 211
594 3300039437 Ga0436365_0651557 Ga0436365_0651557_3986_4654 211
595 3300039450 Ga0436363_1116540 Ga0436363_1116540_329_997 211
596 3300046477 Ga0495664_0253499 Ga0495664_0253499_324_992 211
597 3300046675 Ga0495657_0263851 Ga0495657_0263851_291_959 211
598 3300046679 Ga0495623_0077317 Ga0495623_0077317_1221_1889 211
599 3300005983 Ga0081540_1000078 Ga0081540_100007859 212
600 3300003203 JGI25406J46586_10000053 JGI25406J46586_1000005350 213
601 3300005985 Ga0081539_10000471 Ga0081539_1000047153 213

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hb2-assembly1.cif.gz_B crystal structure of crm1-ran-ranbp1 0.5125 154 189
2ebh-assembly1.cif.gz_X crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin 0.5098 142 210
2ebf-assembly1.cif.gz_X crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin 0.4997 142 210
2ec5-assembly1.cif.gz_A crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin 0.497 143 209
7eez-assembly1.cif.gz_A crystal structure of maize shh2 sawadee domain 0.4756 156 194
ID Description Score Start End Superfamily
af_D3ZMS4_259_380_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5512 155 205 2.30.29.30
af_A0A2R8Q0B2_15_124_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.526 154 189 2.30.29.30
af_Q4CUP5_32_156_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.519 148 196 2.30.29.30
af_Q10MW8_9_177_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.517 154 206 2.30.29.30
af_A0A1D6M2N3_13_163_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5168 154 206 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A257KSU1-F1-model_v4 Uncharacterized protein 0.938 33 213
AF-A0A431MBU3-F1-model_v4 Uncharacterized protein 0.9355 29 213
AF-A0A1M6PYZ1-F1-model_v4 Transglutaminase-like domain-containing protein 0.9338 27 213
AF-A0A257KSU1-F1-model_v4 Uncharacterized protein 0.933 33 213
AF-A0A1M6PYZ1-F1-model_v4 Transglutaminase-like domain-containing protein 0.9243 27 213

Feature Viewer

pLDDT pTM Quality
86.34 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map