F468094
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 601 | 351 | 592 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300046542|Ga0495597_0030847|Ga0495597_0030847_32_688 |
| Length | 212 |
| Sequence | MRAGQFNLRVADFRILMAAGVIALTGLFSMSHARAIEMSREVSDLYTSVSIYPPSAGSMTICYGFVCRRRHAFDFTPADRAALTKLLAAGKASAAQKAVVWWDRRVGPVLGTDKRIANADFRYFDDKHNFDCWDTTRNVTSLLLIIQDWGLLKHHTVGNPRYRGNALVLQTPHNTAVLLDRATGTEWVVDMWTRGYAQLPDVKPADQWVKEN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 3 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 4 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 5 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 6 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 7 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 8 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 93 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 189 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 333 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 334 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 339 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 346 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 351 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 0.33 |
| Isolates | 1.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.32 |
| Nodule | 0.83 |
| Rhizoplane | 6.49 |
| Rhizosphere | 80.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000053 | 3300003203 | Bacteria | 53627 |
| 2 | JGI25404J52841_10001478 | 3300003659 | Bacteria | 4145 |
| 3 | Ga0065715_10190046 | 3300005293 | Bacteria | 1421 |
| 4 | Ga0070683_100042499 | 3300005329 | Bacteria | 4185 |
| 5 | Ga0070683_100893836 | 3300005329 | Bacteria | 852 |
| 6 | Ga0068869_100054805 | 3300005334 | Bacteria | 2904 |
| 7 | Ga0068869_100201984 | 3300005334 | Bacteria | 1568 |
| 8 | Ga0070680_100111891 | 3300005336 | Bacteria | 2273 |
| 9 | Ga0070680_100215092 | 3300005336 | Bacteria | 1622 |
| 10 | Ga0070680_100415362 | 3300005336 | Bacteria | 1148 |
| 11 | Ga0070682_100035583 | 3300005337 | Bacteria | 3041 |
| 12 | Ga0070691_10283925 | 3300005341 | Bacteria | 899 |
| 13 | Ga0070661_100293586 | 3300005344 | Bacteria | 1264 |
| 14 | Ga0070668_100143353 | 3300005347 | Bacteria | 1927 |
| 15 | Ga0070668_100145089 | 3300005347 | Bacteria | 1915 |
| 16 | Ga0070669_100398383 | 3300005353 | Bacteria | 1126 |
| 17 | Ga0070673_100145775 | 3300005364 | Bacteria | 2001 |
| 18 | Ga0070659_100073710 | 3300005366 | Bacteria | 2718 |
| 19 | Ga0070667_100425816 | 3300005367 | Bacteria | 1211 |
| 20 | Ga0070709_10000403 | 3300005434 | Bacteria | 26346 |
| 21 | Ga0070709_10338889 | 3300005434 | Bacteria | 1108 |
| 22 | Ga0070714_100006308 | 3300005435 | Bacteria | 9139 |
| 23 | Ga0070713_100023753 | 3300005436 | Bacteria | 4764 |
| 24 | Ga0070713_100084736 | 3300005436 | Bacteria | 2713 |
| 25 | Ga0070710_10002450 | 3300005437 | Bacteria | 8789 |
| 26 | Ga0070710_10184661 | 3300005437 | Bacteria | 1308 |
| 27 | Ga0070701_10035734 | 3300005438 | Bacteria | 2499 |
| 28 | Ga0070711_100066299 | 3300005439 | Bacteria | 2528 |
| 29 | Ga0070708_100218520 | 3300005445 | Bacteria | 1787 |
| 30 | Ga0070663_100010706 | 3300005455 | Bacteria | 5725 |
| 31 | Ga0070663_100032781 | 3300005455 | Bacteria | 3584 |
| 32 | Ga0070663_100241990 | 3300005455 | Bacteria | 1425 |
| 33 | Ga0070678_100264233 | 3300005456 | Bacteria | 1449 |
| 34 | Ga0070681_10013957 | 3300005458 | Bacteria | 7992 |
| 35 | Ga0070681_10113314 | 3300005458 | Bacteria | 2651 |
| 36 | Ga0070681_10215011 | 3300005458 | Bacteria | 1839 |
| 37 | Ga0070681_10400094 | 3300005458 | Bacteria | 1285 |
| 38 | Ga0070707_100158450 | 3300005468 | Bacteria | 2205 |
| 39 | Ga0070698_100198507 | 3300005471 | Bacteria | 1942 |
| 40 | Ga0070679_100224122 | 3300005530 | Bacteria | 1840 |
| 41 | Ga0070679_100307530 | 3300005530 | Bacteria | 1535 |
| 42 | Ga0070684_100008771 | 3300005535 | Bacteria | 7927 |
| 43 | Ga0070684_100012842 | 3300005535 | Bacteria | 6728 |
| 44 | Ga0070697_100281107 | 3300005536 | Bacteria | 1428 |
| 45 | Ga0070697_100369583 | 3300005536 | Bacteria | 1241 |
| 46 | Ga0068853_100438728 | 3300005539 | Bacteria | 1227 |
| 47 | Ga0068853_100615616 | 3300005539 | Bacteria | 1032 |
| 48 | Ga0070686_100268820 | 3300005544 | Bacteria | 1253 |
| 49 | Ga0070693_100281143 | 3300005547 | Bacteria | 1114 |
| 50 | Ga0070665_100010052 | 3300005548 | Bacteria | 9574 |
| 51 | Ga0070665_100077377 | 3300005548 | Bacteria | 3333 |
| 52 | Ga0070665_100473803 | 3300005548 | Bacteria | 1263 |
| 53 | Ga0070704_100275192 | 3300005549 | Bacteria | 1392 |
| 54 | Ga0068855_100184228 | 3300005563 | Bacteria | 2359 |
| 55 | Ga0068855_101004551 | 3300005563 | Bacteria | 876 |
| 56 | Ga0068854_100246891 | 3300005578 | Bacteria | 1424 |
| 57 | Ga0068854_100594510 | 3300005578 | Bacteria | 944 |
| 58 | Ga0068856_100000255 | 3300005614 | Bacteria | 58233 |
| 59 | Ga0068852_100002678 | 3300005616 | Bacteria | 12311 |
| 60 | Ga0068870_10049642 | 3300005840 | Bacteria | 2214 |
| 61 | Ga0068870_10315406 | 3300005840 | Bacteria | 992 |
| 62 | Ga0068858_100576248 | 3300005842 | Bacteria | 1090 |
| 63 | Ga0068860_100363885 | 3300005843 | Bacteria | 1425 |
| 64 | Ga0068862_100116716 | 3300005844 | Bacteria | 2348 |
| 65 | Ga0068862_100495862 | 3300005844 | Bacteria | 1158 |
| 66 | Ga0081455_10012458 | 3300005937 | Bacteria | 8485 |
| 67 | Ga0081455_10024496 | 3300005937 | Bacteria | 5587 |
| 68 | Ga0081455_10273521 | 3300005937 | Bacteria | 1224 |
| 69 | Ga0081540_1000078 | 3300005983 | Bacteria | 105731 |
| 70 | Ga0081540_1004361 | 3300005983 | Bacteria | 10821 |
| 71 | Ga0081540_1004490 | 3300005983 | Bacteria | 10610 |
| 72 | Ga0081540_1009395 | 3300005983 | Bacteria | 6742 |
| 73 | Ga0081540_1016522 | 3300005983 | Bacteria | 4613 |
| 74 | Ga0081540_1054929 | 3300005983 | Bacteria | 1943 |
| 75 | Ga0081540_1064466 | 3300005983 | Bacteria | 1728 |
| 76 | Ga0081540_1080972 | 3300005983 | Bacteria | 1462 |
| 77 | Ga0081539_10000471 | 3300005985 | Bacteria | 85272 |
| 78 | Ga0070717_10126640 | 3300006028 | Bacteria | 2193 |
| 79 | Ga0075365_10506249 | 3300006038 | Bacteria | 853 |
| 80 | Ga0075363_100253832 | 3300006048 | Bacteria | 1013 |
| 81 | Ga0075364_10151053 | 3300006051 | Bacteria | 1565 |
| 82 | Ga0075364_10273719 | 3300006051 | Bacteria | 1148 |
| 83 | Ga0070716_100011253 | 3300006173 | Bacteria | 4504 |
| 84 | Ga0070712_100081372 | 3300006175 | Bacteria | 2346 |
| 85 | Ga0070712_100127596 | 3300006175 | Bacteria | 1923 |
| 86 | Ga0070712_100218246 | 3300006175 | Bacteria | 1508 |
| 87 | Ga0075367_10011870 | 3300006178 | Bacteria | 4626 |
| 88 | Ga0075367_10294992 | 3300006178 | Unclassified | 1020 |
| 89 | Ga0075366_10086754 | 3300006195 | Bacteria | 1872 |
| 90 | Ga0075366_10193094 | 3300006195 | Bacteria | 1237 |
| 91 | Ga0075370_10051978 | 3300006353 | Bacteria | 2324 |
| 92 | Ga0068871_100168089 | 3300006358 | Bacteria | 1878 |
| 93 | Ga0075428_100476441 | 3300006844 | Bacteria | 1336 |
| 94 | Ga0075434_100221546 | 3300006871 | Bacteria | 1912 |
| 95 | Ga0075429_100097541 | 3300006880 | Bacteria | 2564 |
| 96 | Ga0099794_10072905 | 3300007265 | Bacteria | 1684 |
| 97 | Ga0099794_10133328 | 3300007265 | Bacteria | 1255 |
| 98 | Ga0099794_10215355 | 3300007265 | Bacteria | 986 |
| 99 | Ga0105240_10052104 | 3300009093 | Bacteria | 5145 |
| 100 | Ga0105240_10211364 | 3300009093 | Bacteria | 2267 |
| 101 | Ga0111539_10245086 | 3300009094 | Bacteria | 2086 |
| 102 | Ga0105245_10093478 | 3300009098 | Bacteria | 2771 |
| 103 | Ga0114129_10130405 | 3300009147 | Bacteria | 3453 |
| 104 | Ga0105243_10223074 | 3300009148 | Bacteria | 1667 |
| 105 | Ga0105241_10341519 | 3300009174 | Bacteria | 1297 |
| 106 | Ga0105237_10045695 | 3300009545 | Bacteria | 4406 |
| 107 | Ga0105237_10077319 | 3300009545 | Bacteria | 3318 |
| 108 | Ga0105237_10317932 | 3300009545 | Bacteria | 1560 |
| 109 | Ga0105237_10354260 | 3300009545 | Bacteria | 1472 |
| 110 | Ga0105238_10325954 | 3300009551 | Bacteria | 1522 |
| 111 | Ga0105249_10066739 | 3300009553 | Bacteria | 3313 |
| 112 | Ga0099796_10014229 | 3300010159 | Bacteria | 2294 |
| 113 | Ga0099796_10105770 | 3300010159 | Bacteria | 1065 |
| 114 | Ga0105239_10181230 | 3300010375 | Bacteria | 2357 |
| 115 | Ga0105239_10206174 | 3300010375 | Bacteria | 2203 |
| 116 | Ga0105246_10173671 | 3300011119 | Bacteria | 1653 |
| 117 | Ga0157371_10057862 | 3300013102 | Bacteria | 2750 |
| 118 | Ga0157370_10056758 | 3300013104 | Bacteria | 3726 |
| 119 | Ga0157370_10167808 | 3300013104 | Bacteria | 2041 |
| 120 | Ga0157369_10002191 | 3300013105 | Bacteria | 23538 |
| 121 | Ga0157369_10015878 | 3300013105 | Bacteria | 8480 |
| 122 | Ga0157369_10116560 | 3300013105 | Bacteria | 2836 |
| 123 | Ga0157369_10169842 | 3300013105 | Bacteria | 2298 |
| 124 | Ga0157378_10148390 | 3300013297 | Bacteria | 2183 |
| 125 | Ga0157378_10292405 | 3300013297 | Bacteria | 1574 |
| 126 | Ga0163162_10247733 | 3300013306 | Bacteria | 1913 |
| 127 | Ga0157372_10531674 | 3300013307 | Bacteria | 1371 |
| 128 | Ga0157372_10967436 | 3300013307 | Bacteria | 986 |
| 129 | Ga0163163_11423370 | 3300014325 | Bacteria | 755 |
| 130 | Ga0157380_10149349 | 3300014326 | Bacteria | 2018 |
| 131 | Ga0157379_10287109 | 3300014968 | Bacteria | 1498 |
| 132 | Ga0157376_10449054 | 3300014969 | Bacteria | 1257 |
| 133 | Ga0157376_10615567 | 3300014969 | Bacteria | 1082 |
| 134 | Ga0197907_11260994 | 3300020069 | Bacteria | 1112 |
| 135 | Ga0206353_10616236 | 3300020082 | Bacteria | 1097 |
| 136 | Ga0213874_10049892 | 3300021377 | Bacteria | 1281 |
| 137 | Ga0209758_1064975 | 3300025297 | Bacteria | 1180 |
| 138 | Ga0207656_10071332 | 3300025321 | Bacteria | 1544 |
| 139 | Ga0207692_10036157 | 3300025898 | Bacteria | 2405 |
| 140 | Ga0207710_10067903 | 3300025900 | Bacteria | 1629 |
| 141 | Ga0207688_10285403 | 3300025901 | Bacteria | 1006 |
| 142 | Ga0207680_10574634 | 3300025903 | Bacteria | 805 |
| 143 | Ga0207699_10000347 | 3300025906 | Bacteria | 24590 |
| 144 | Ga0207699_10006907 | 3300025906 | Bacteria | 5522 |
| 145 | Ga0207705_10056172 | 3300025909 | Bacteria | 2838 |
| 146 | Ga0207705_10143889 | 3300025909 | Bacteria | 1782 |
| 147 | Ga0207684_10652324 | 3300025910 | Bacteria | 897 |
| 148 | Ga0207654_10287603 | 3300025911 | Bacteria | 1113 |
| 149 | Ga0207707_10000462 | 3300025912 | Bacteria | 42120 |
| 150 | Ga0207707_10091864 | 3300025912 | Bacteria | 2653 |
| 151 | Ga0207707_10132662 | 3300025912 | Bacteria | 2178 |
| 152 | Ga0207695_10074920 | 3300025913 | Bacteria | 3445 |
| 153 | Ga0207695_10167645 | 3300025913 | Bacteria | 2123 |
| 154 | Ga0207671_10069722 | 3300025914 | Bacteria | 2620 |
| 155 | Ga0207693_10042368 | 3300025915 | Bacteria | 3584 |
| 156 | Ga0207693_10063168 | 3300025915 | Bacteria | 2901 |
| 157 | Ga0207693_10104230 | 3300025915 | Bacteria | 2224 |
| 158 | Ga0207663_10085080 | 3300025916 | Bacteria | 2081 |
| 159 | Ga0207663_10371826 | 3300025916 | Bacteria | 1087 |
| 160 | Ga0207663_10483558 | 3300025916 | Bacteria | 960 |
| 161 | Ga0207663_10651671 | 3300025916 | Bacteria | 831 |
| 162 | Ga0207660_10082320 | 3300025917 | Bacteria | 2367 |
| 163 | Ga0207660_10348180 | 3300025917 | Bacteria | 1187 |
| 164 | Ga0207657_10127174 | 3300025919 | Bacteria | 2092 |
| 165 | Ga0207652_10051300 | 3300025921 | Bacteria | 3537 |
| 166 | Ga0207652_10341456 | 3300025921 | Bacteria | 1352 |
| 167 | Ga0207652_10725150 | 3300025921 | Bacteria | 886 |
| 168 | Ga0207646_10144882 | 3300025922 | Bacteria | 2140 |
| 169 | Ga0207681_10530317 | 3300025923 | Bacteria | 967 |
| 170 | Ga0207659_10434925 | 3300025926 | Bacteria | 1102 |
| 171 | Ga0207687_10454550 | 3300025927 | Bacteria | 1063 |
| 172 | Ga0207700_10255501 | 3300025928 | Bacteria | 1498 |
| 173 | Ga0207700_10285425 | 3300025928 | Bacteria | 1421 |
| 174 | Ga0207700_10534829 | 3300025928 | Bacteria | 1039 |
| 175 | Ga0207664_10033776 | 3300025929 | Bacteria | 3935 |
| 176 | Ga0207690_10115276 | 3300025932 | Bacteria | 1942 |
| 177 | Ga0207690_10124712 | 3300025932 | Bacteria | 1876 |
| 178 | Ga0207690_10287624 | 3300025932 | Bacteria | 1282 |
| 179 | Ga0207706_10102748 | 3300025933 | Bacteria | 2515 |
| 180 | Ga0207686_10056263 | 3300025934 | Bacteria | 2472 |
| 181 | Ga0207686_10272232 | 3300025934 | Bacteria | 1246 |
| 182 | Ga0207709_10049768 | 3300025935 | Bacteria | 2560 |
| 183 | Ga0207670_10256585 | 3300025936 | Bacteria | 1353 |
| 184 | Ga0207669_10109796 | 3300025937 | Bacteria | 1845 |
| 185 | Ga0207669_10799430 | 3300025937 | Bacteria | 782 |
| 186 | Ga0207665_10005942 | 3300025939 | Bacteria | 8122 |
| 187 | Ga0207665_10047252 | 3300025939 | Bacteria | 2885 |
| 188 | Ga0207665_10193048 | 3300025939 | Bacteria | 1480 |
| 189 | Ga0207691_10144386 | 3300025940 | Bacteria | 2096 |
| 190 | Ga0207711_10717658 | 3300025941 | Bacteria | 932 |
| 191 | Ga0207689_10116568 | 3300025942 | Bacteria | 2196 |
| 192 | Ga0207661_10032714 | 3300025944 | Bacteria | 4032 |
| 193 | Ga0207661_10082676 | 3300025944 | Bacteria | 2655 |
| 194 | Ga0207667_10338931 | 3300025949 | Bacteria | 1534 |
| 195 | Ga0207651_10542384 | 3300025960 | Bacteria | 1010 |
| 196 | Ga0207668_10065517 | 3300025972 | Bacteria | 2572 |
| 197 | Ga0207640_10116379 | 3300025981 | Bacteria | 1906 |
| 198 | Ga0207640_10182136 | 3300025981 | Bacteria | 1576 |
| 199 | Ga0207658_10160375 | 3300025986 | Bacteria | 1843 |
| 200 | Ga0207703_10174393 | 3300026035 | Bacteria | 1894 |
| 201 | Ga0207639_10114912 | 3300026041 | Bacteria | 2200 |
| 202 | Ga0207639_10124597 | 3300026041 | Bacteria | 2123 |
| 203 | Ga0207639_10339961 | 3300026041 | Bacteria | 1338 |
| 204 | Ga0207639_10584406 | 3300026041 | Bacteria | 1028 |
| 205 | Ga0207678_10069844 | 3300026067 | Bacteria | 3012 |
| 206 | Ga0207678_10111648 | 3300026067 | Bacteria | 2332 |
| 207 | Ga0207678_10178230 | 3300026067 | Bacteria | 1815 |
| 208 | Ga0207678_10410095 | 3300026067 | Bacteria | 1174 |
| 209 | Ga0207678_10494265 | 3300026067 | Bacteria | 1066 |
| 210 | Ga0207708_10092879 | 3300026075 | Bacteria | 2329 |
| 211 | Ga0207702_10000390 | 3300026078 | Bacteria | 50020 |
| 212 | Ga0207648_10674754 | 3300026089 | Bacteria | 956 |
| 213 | Ga0207674_10036112 | 3300026116 | Bacteria | 5154 |
| 214 | Ga0207674_10317001 | 3300026116 | Bacteria | 1508 |
| 215 | Ga0207675_100224686 | 3300026118 | Bacteria | 1810 |
| 216 | Ga0207683_10055123 | 3300026121 | Bacteria | 3486 |
| 217 | Ga0207698_10206465 | 3300026142 | Bacteria | 1764 |
| 218 | Ga0209588_1014130 | 3300027671 | Bacteria | 2442 |
| 219 | Ga0209588_1027125 | 3300027671 | Bacteria | 1822 |
| 220 | Ga0209813_10100709 | 3300027866 | Bacteria | 983 |
| 221 | Ga0268266_10007255 | 3300028379 | Bacteria | 10021 |
| 222 | Ga0268266_10033415 | 3300028379 | Bacteria | 4373 |
| 223 | Ga0268266_10109213 | 3300028379 | Bacteria | 2449 |
| 224 | Ga0268266_10672765 | 3300028379 | Bacteria | 997 |
| 225 | Ga0268264_10176646 | 3300028381 | Bacteria | 1936 |
| 226 | Ga0265332_10075241 | 3300031238 | Bacteria | 1436 |
| 227 | Ga0265340_10005476 | 3300031247 | Bacteria | 7047 |
| 228 | Ga0265331_10074711 | 3300031250 | Bacteria | 1581 |
| 229 | Ga0265316_10080407 | 3300031344 | Bacteria | 2500 |
| 230 | Ga0307408_100630262 | 3300031548 | Bacteria | 956 |
| 231 | Ga0307508_10133194 | 3300031616 | Bacteria | 2089 |
| 232 | Ga0265314_10077286 | 3300031711 | Bacteria | 2209 |
| 233 | Ga0265342_10024685 | 3300031712 | Bacteria | 3792 |
| 234 | Ga0307516_10108177 | 3300031730 | Bacteria | 2588 |
| 235 | Ga0307416_100744881 | 3300032002 | Bacteria | 1072 |
| 236 | Ga0307415_100434622 | 3300032126 | Bacteria | 1130 |
| 237 | Ga0373926_0016830 | 3300035083 | Bacteria | 2506 |
| 238 | Ga0373934_0003005 | 3300035086 | Bacteria | 6158 |
| 239 | Ga0373952_0015932 | 3300035092 | Bacteria | 1523 |
| 240 | Ga0373923_0124249 | 3300035111 | Bacteria | 1155 |
| 241 | Ga0373945_0011722 | 3300035116 | Bacteria | 2902 |
| 242 | Ga0373953_0002068 | 3300035117 | Bacteria | 5987 |
| 243 | Ga0373953_0112435 | 3300035117 | Bacteria | 1152 |
| 244 | Ga0373954_0318855 | 3300035118 | Bacteria | 767 |
| 245 | Ga0373956_0000465 | 3300035119 | Bacteria | 16640 |
| 246 | Ga0373957_0000114 | 3300035120 | Bacteria | 19511 |
| 247 | Ga0373943_0000900 | 3300035170 | Bacteria | 13105 |
| 248 | Ga0373943_0211025 | 3300035170 | Bacteria | 1078 |
| 249 | Ga0373946_0172612 | 3300035171 | Bacteria | 1021 |
| 250 | Ga0373955_0000133 | 3300035172 | Bacteria | 29304 |
| 251 | Ga0373962_0104587 | 3300035242 | Bacteria | 887 |
| 252 | Ga0373924_0234490 | 3300035410 | Bacteria | 811 |
| 253 | Ga0373931_0204867 | 3300035691 | Bacteria | 1180 |
| 254 | Ga0373935_0040906 | 3300035692 | Bacteria | 2910 |
| 255 | Ga0373935_0143711 | 3300035692 | Bacteria | 1613 |
| 256 | Ga0373935_0254390 | 3300035692 | Bacteria | 1230 |
| 257 | Ga0373927_0001032 | 3300035695 | Bacteria | 21199 |
| 258 | Ga0373927_0040850 | 3300035695 | Bacteria | 3009 |
| 259 | Ga0373927_0048354 | 3300035695 | Bacteria | 2751 |
| 260 | Ga0373927_0111791 | 3300035695 | Bacteria | 1780 |
| 261 | Ga0373933_0000151 | 3300035724 | Bacteria | 45623 |
| 262 | Ga0373933_0000286 | 3300035724 | Bacteria | 32640 |
| 263 | Ga0373933_0016412 | 3300035724 | Bacteria | 4140 |
| 264 | Ga0373933_0119571 | 3300035724 | Bacteria | 1649 |
| 265 | Ga0373947_0008149 | 3300035725 | Bacteria | 6042 |
| 266 | Ga0373947_0494742 | 3300035725 | Bacteria | 831 |
| 267 | Ga0373937_0131817 | 3300036401 | Bacteria | 2334 |
| 268 | Ga0373937_0412531 | 3300036401 | Bacteria | 1281 |
| 269 | Ga0373925_0002484 | 3300037068 | Bacteria | 14744 |
| 270 | Ga0373925_0059809 | 3300037068 | Bacteria | 2859 |
| 271 | Ga0373925_0177652 | 3300037068 | Bacteria | 1683 |
| 272 | Ga0395900_0052916 | 3300037418 | Bacteria | 4179 |
| 273 | Ga0395898_0028926 | 3300037466 | Bacteria | 5554 |
| 274 | Ga0395905_0101770 | 3300037471 | Bacteria | 2697 |
| 275 | Ga0395901_1004492 | 3300038443 | Bacteria | 810 |
| 276 | Ga0436365_0651557 | 3300039437 | Bacteria | 30425 |
| 277 | Ga0436365_1885487 | 3300039437 | Bacteria | 2432 |
| 278 | Ga0436365_1918864 | 3300039437 | Bacteria | 731 |
| 279 | Ga0436360_0832736 | 3300039438 | Bacteria | 1923 |
| 280 | Ga0436361_0146597 | 3300039447 | Bacteria | 4742 |
| 281 | Ga0436361_0523452 | 3300039447 | Bacteria | 1876 |
| 282 | Ga0436363_1116540 | 3300039450 | Bacteria | 1992 |
| 283 | Ga0436363_1500653 | 3300039450 | Bacteria | 7533 |
| 284 | Ga0436362_0379505 | 3300039453 | Bacteria | 5020 |
| 285 | Ga0436362_0733513 | 3300039453 | Bacteria | 3093 |
| 286 | Ga0439465_0012566 | 3300041413 | Bacteria | 2647 |
| 287 | Ga0451791_0495528 | 3300041451 | Bacteria | 849 |
| 288 | Ga0451802_2184100 | 3300041460 | Bacteria | 793 |
| 289 | Ga0439431_0050076 | 3300041997 | Bacteria | 1082 |
| 290 | Ga0466966_0053238 | 3300044684 | Bacteria | 2568 |
| 291 | Ga0466968_0117353 | 3300044735 | Bacteria | 1202 |
| 292 | Ga0466970_0124029 | 3300044765 | Bacteria | 1416 |
| 293 | Ga0466970_0217143 | 3300044765 | Bacteria | 1067 |
| 294 | Ga0466959_0094752 | 3300045049 | Bacteria | 2141 |
| 295 | Ga0466959_0172154 | 3300045049 | Bacteria | 1518 |
| 296 | Ga0495592_0000686 | 3300046454 | Bacteria | 23590 |
| 297 | Ga0495592_0176371 | 3300046454 | Bacteria | 1459 |
| 298 | Ga0495603_0000209 | 3300046455 | Bacteria | 30220 |
| 299 | Ga0495590_0085741 | 3300046457 | Bacteria | 1111 |
| 300 | Ga0495629_0000503 | 3300046459 | Bacteria | 32787 |
| 301 | Ga0495629_0015792 | 3300046459 | Bacteria | 5422 |
| 302 | Ga0495629_0220309 | 3300046459 | Bacteria | 1309 |
| 303 | Ga0495641_0010107 | 3300046461 | Bacteria | 5525 |
| 304 | Ga0495651_0006168 | 3300046462 | Bacteria | 9156 |
| 305 | Ga0495651_0060038 | 3300046462 | Bacteria | 2914 |
| 306 | Ga0495653_0066000 | 3300046463 | Bacteria | 2722 |
| 307 | Ga0495653_0183879 | 3300046463 | Bacteria | 1432 |
| 308 | Ga0495580_0001676 | 3300046472 | Bacteria | 19446 |
| 309 | Ga0495580_0029809 | 3300046472 | Bacteria | 3957 |
| 310 | Ga0495580_0083904 | 3300046472 | Bacteria | 2220 |
| 311 | Ga0495582_0000152 | 3300046473 | Bacteria | 37542 |
| 312 | Ga0495582_0009705 | 3300046473 | Bacteria | 5303 |
| 313 | Ga0495582_0162888 | 3300046473 | Bacteria | 1269 |
| 314 | Ga0495639_0000087 | 3300046475 | Bacteria | 44546 |
| 315 | Ga0495639_0135693 | 3300046475 | Bacteria | 1180 |
| 316 | Ga0495662_0001427 | 3300046476 | Bacteria | 11825 |
| 317 | Ga0495662_0103242 | 3300046476 | Bacteria | 1395 |
| 318 | Ga0495664_0019809 | 3300046477 | Bacteria | 3873 |
| 319 | Ga0495664_0156304 | 3300046477 | Bacteria | 1383 |
| 320 | Ga0495664_0172643 | 3300046477 | Bacteria | 1311 |
| 321 | Ga0495664_0253499 | 3300046477 | Bacteria | 1064 |
| 322 | Ga0495584_0057657 | 3300046491 | Bacteria | 1954 |
| 323 | Ga0495594_0000129 | 3300046499 | Bacteria | 35623 |
| 324 | Ga0495594_0185904 | 3300046499 | Bacteria | 1183 |
| 325 | Ga0495583_0097667 | 3300046506 | Bacteria | 1257 |
| 326 | Ga0495608_0000586 | 3300046511 | Bacteria | 25009 |
| 327 | Ga0495618_0010020 | 3300046514 | Bacteria | 5732 |
| 328 | Ga0495620_0006184 | 3300046515 | Bacteria | 6596 |
| 329 | Ga0495628_0001371 | 3300046516 | Bacteria | 22344 |
| 330 | Ga0495628_0193730 | 3300046516 | Bacteria | 1534 |
| 331 | Ga0495630_0050670 | 3300046517 | Bacteria | 3107 |
| 332 | Ga0495631_0056289 | 3300046518 | Bacteria | 1712 |
| 333 | Ga0495637_0078848 | 3300046520 | Bacteria | 1316 |
| 334 | Ga0495648_0001145 | 3300046524 | Bacteria | 26801 |
| 335 | Ga0495663_0188020 | 3300046525 | Bacteria | 717 |
| 336 | Ga0495666_0114509 | 3300046526 | Bacteria | 1265 |
| 337 | Ga0495652_0001568 | 3300046529 | Bacteria | 25010 |
| 338 | Ga0495654_0015913 | 3300046530 | Bacteria | 3985 |
| 339 | Ga0495665_0000124 | 3300046531 | Bacteria | 36916 |
| 340 | Ga0495640_0008795 | 3300046533 | Bacteria | 7900 |
| 341 | Ga0495640_0035595 | 3300046533 | Bacteria | 3523 |
| 342 | Ga0495586_0108137 | 3300046535 | Bacteria | 1547 |
| 343 | Ga0495609_0031408 | 3300046538 | Bacteria | 2414 |
| 344 | Ga0495609_0134590 | 3300046538 | Bacteria | 1057 |
| 345 | Ga0495597_0030847 | 3300046542 | Bacteria | 2441 |
| 346 | Ga0495645_0022212 | 3300046543 | Bacteria | 4589 |
| 347 | Ga0495622_0011173 | 3300046557 | Bacteria | 4146 |
| 348 | Ga0495667_0000795 | 3300046559 | Bacteria | 20300 |
| 349 | Ga0495667_0213438 | 3300046559 | Bacteria | 1233 |
| 350 | Ga0495656_0039061 | 3300046615 | Bacteria | 1969 |
| 351 | Ga0495668_0049088 | 3300046616 | Bacteria | 2341 |
| 352 | Ga0495634_0000599 | 3300046642 | Bacteria | 34949 |
| 353 | Ga0495634_0006542 | 3300046642 | Bacteria | 8845 |
| 354 | Ga0495634_0097914 | 3300046642 | Bacteria | 1898 |
| 355 | Ga0495625_0059313 | 3300046660 | Bacteria | 2715 |
| 356 | Ga0495625_0563289 | 3300046660 | Bacteria | 688 |
| 357 | Ga0495635_0000417 | 3300046663 | Bacteria | 26913 |
| 358 | Ga0495635_0003181 | 3300046663 | Bacteria | 11316 |
| 359 | Ga0495659_0093847 | 3300046664 | Bacteria | 1155 |
| 360 | Ga0495661_0042963 | 3300046665 | Bacteria | 2782 |
| 361 | Ga0495661_0354334 | 3300046665 | Bacteria | 722 |
| 362 | Ga0495588_0001335 | 3300046674 | Bacteria | 10537 |
| 363 | Ga0495657_0000715 | 3300046675 | Bacteria | 29820 |
| 364 | Ga0495657_0263851 | 3300046675 | Bacteria | 1034 |
| 365 | Ga0495599_0002562 | 3300046678 | Bacteria | 10584 |
| 366 | Ga0495599_0114418 | 3300046678 | Bacteria | 1679 |
| 367 | Ga0495599_0348234 | 3300046678 | Bacteria | 888 |
| 368 | Ga0495623_0002109 | 3300046679 | Bacteria | 13297 |
| 369 | Ga0495623_0077317 | 3300046679 | Bacteria | 2064 |
| 370 | Ga0495623_0150269 | 3300046679 | Bacteria | 1377 |
| 371 | Ga0495646_0008630 | 3300046680 | Bacteria | 6474 |
| 372 | Ga0495646_0062195 | 3300046680 | Bacteria | 2220 |
| 373 | Ga0495647_0002338 | 3300046681 | Bacteria | 5951 |
| 374 | Ga0495658_0001819 | 3300046683 | Bacteria | 10931 |
| 375 | Ga0495658_0005829 | 3300046683 | Bacteria | 6048 |
| 376 | Ga0495669_0005467 | 3300046684 | Bacteria | 5303 |
| 377 | Ga0495613_0004447 | 3300046689 | Bacteria | 10502 |
| 378 | Ga0495613_0016955 | 3300046689 | Bacteria | 5423 |
| 379 | Ga0495613_0442568 | 3300046689 | Bacteria | 881 |
| 380 | Ga0495624_0001738 | 3300046690 | Bacteria | 16643 |
| 381 | Ga0495624_0064956 | 3300046690 | Bacteria | 2280 |
| 382 | Ga0495670_0421456 | 3300046691 | Bacteria | 722 |
| 383 | Ga0495600_0000372 | 3300046809 | Bacteria | 23407 |
| 384 | Ga0495660_0253140 | 3300046810 | Bacteria | 816 |
| 385 | Ga0495581_0000176 | 3300047315 | Bacteria | 29110 |
| 386 | Ga0495581_0032467 | 3300047315 | Bacteria | 3023 |
| 387 | Ga0495581_0188450 | 3300047315 | Bacteria | 1206 |
| 388 | Ga0495604_0001526 | 3300047317 | Bacteria | 19062 |
| 389 | Ga0495604_0217005 | 3300047317 | Bacteria | 1319 |
| 390 | Ga0495604_0435193 | 3300047317 | Bacteria | 859 |
| 391 | Ga0495636_0283483 | 3300047318 | Bacteria | 772 |
| 392 | Ga0495674_0002170 | 3300047319 | Bacteria | 19272 |
| 393 | Ga0495674_0002817 | 3300047319 | Bacteria | 16895 |
| 394 | Ga0495674_0057538 | 3300047319 | Bacteria | 3402 |
| 395 | Ga0495672_0084837 | 3300047320 | Bacteria | 1756 |
| 396 | Ga0495676_0058409 | 3300047321 | Bacteria | 3035 |
| 397 | Ga0495676_0111203 | 3300047321 | Bacteria | 2009 |
| 398 | Ga0495676_0418533 | 3300047321 | Bacteria | 887 |
| 399 | Ga0495680_0006935 | 3300047322 | Bacteria | 10456 |
| 400 | Ga0495675_0000478 | 3300047444 | Bacteria | 26189 |
| 401 | Ga0495677_0081325 | 3300047445 | Bacteria | 1214 |
| 402 | Ga0495673_0029388 | 3300047469 | Bacteria | 2594 |
| 403 | Ga0495673_0074267 | 3300047469 | Bacteria | 1423 |
| 404 | Ga0495681_0050989 | 3300047470 | Bacteria | 1948 |
| 405 | Ga0495684_0000155 | 3300047471 | Bacteria | 50734 |
| 406 | Ga0495684_0022619 | 3300047471 | Bacteria | 4834 |
| 407 | Ga0495593_0000022 | 3300047673 | Bacteria | 69741 |
| 408 | Ga0495593_0002338 | 3300047673 | Bacteria | 11382 |
| 409 | Ga0495602_0004699 | 3300048088 | Bacteria | 14272 |
| 410 | Ga0495602_0559201 | 3300048088 | Bacteria | 792 |
| 411 | Ga0495614_0018413 | 3300048089 | Bacteria | 3026 |
| 412 | Ga0495614_0058031 | 3300048089 | Bacteria | 1662 |
| 413 | Ga0496100_0030038 | 3300048903 | Bacteria | 3367 |
| 414 | Ga0496100_0059107 | 3300048903 | Bacteria | 2518 |
| 415 | Ga0496101_0206620 | 3300048904 | Bacteria | 1520 |
| 416 | Ga0496101_0612458 | 3300048904 | Bacteria | 861 |
| 417 | Ga0496102_0057015 | 3300048905 | Bacteria | 3565 |
| 418 | Ga0496102_0115880 | 3300048905 | Bacteria | 2500 |
| 419 | Ga0496102_0329074 | 3300048905 | Bacteria | 1439 |
| 420 | Ga0496102_0473655 | 3300048905 | Bacteria | 1173 |
| 421 | Ga0496102_0501551 | 3300048905 | Bacteria | 1136 |
| 422 | Ga0496104_0087462 | 3300048907 | Bacteria | 2976 |
| 423 | Ga0496104_0205471 | 3300048907 | Bacteria | 1881 |
| 424 | Ga0496105_0200326 | 3300048908 | Bacteria | 1629 |
| 425 | Ga0496105_0249278 | 3300048908 | Bacteria | 1439 |
| 426 | Ga0496106_0229436 | 3300048909 | Bacteria | 1482 |
| 427 | Ga0496107_0038553 | 3300048910 | Bacteria | 3427 |
| 428 | Ga0496107_0182094 | 3300048910 | Bacteria | 1560 |
| 429 | Ga0496108_0000801 | 3300048911 | Bacteria | 24438 |
| 430 | Ga0496108_0065578 | 3300048911 | Bacteria | 3061 |
| 431 | Ga0496109_0013479 | 3300048912 | Bacteria | 7092 |
| 432 | Ga0496109_0121916 | 3300048912 | Bacteria | 2429 |
| 433 | Ga0496110_0028041 | 3300048913 | Bacteria | 4832 |
| 434 | Ga0496110_0108028 | 3300048913 | Bacteria | 2498 |
| 435 | Ga0496111_0081019 | 3300048914 | Bacteria | 2369 |
| 436 | Ga0496111_0192706 | 3300048914 | Bacteria | 1515 |
| 437 | Ga0496112_0012703 | 3300048915 | Bacteria | 7745 |
| 438 | Ga0496112_0165616 | 3300048915 | Bacteria | 2177 |
| 439 | Ga0496113_0441427 | 3300048916 | Bacteria | 1045 |
| 440 | Ga0496113_0705248 | 3300048916 | Bacteria | 805 |
| 441 | Ga0496114_0046864 | 3300048917 | Bacteria | 3593 |
| 442 | Ga0496114_0137864 | 3300048917 | Bacteria | 2110 |
| 443 | Ga0496114_0175225 | 3300048917 | Bacteria | 1871 |
| 444 | Ga0496115_0020855 | 3300048918 | Bacteria | 5058 |
| 445 | Ga0496115_0058690 | 3300048918 | Bacteria | 3097 |
| 446 | Ga0496115_0183314 | 3300048918 | Bacteria | 1730 |
| 447 | Ga0496115_0338343 | 3300048918 | Bacteria | 1229 |
| 448 | Ga0496115_0617059 | 3300048918 | Bacteria | 861 |
| 449 | Ga0496121_0001041 | 3300048924 | Bacteria | 49426 |
| 450 | Ga0496121_0126181 | 3300048924 | Bacteria | 1923 |
| 451 | Ga0496125_0001356 | 3300048928 | Bacteria | 36075 |
| 452 | Ga0496125_0010096 | 3300048928 | Bacteria | 9579 |
| 453 | Ga0496126_0001870 | 3300048929 | Bacteria | 30630 |
| 454 | Ga0496126_0039346 | 3300048929 | Bacteria | 4388 |
| 455 | Ga0496126_0046311 | 3300048929 | Bacteria | 3990 |
| 456 | Ga0496126_0048968 | 3300048929 | Bacteria | 3859 |
| 457 | Ga0496126_0088139 | 3300048929 | Bacteria | 2734 |
| 458 | Ga0496126_0134761 | 3300048929 | Bacteria | 2131 |
| 459 | Ga0501031_0048554 | 3300049568 | Bacteria | 2765 |
| 460 | Ga0501031_0350826 | 3300049568 | Bacteria | 955 |
| 461 | Ga0501032_0002335 | 3300049569 | Bacteria | 14880 |
| 462 | Ga0501032_0106256 | 3300049569 | Bacteria | 1859 |
| 463 | Ga0501032_0166864 | 3300049569 | Bacteria | 1444 |
| 464 | Ga0501032_0403833 | 3300049569 | Bacteria | 877 |
| 465 | Ga0501033_0000116 | 3300049570 | Bacteria | 76410 |
| 466 | Ga0501033_0000291 | 3300049570 | Bacteria | 48207 |
| 467 | Ga0501033_0374945 | 3300049570 | Bacteria | 994 |
| 468 | Ga0501033_0504719 | 3300049570 | Bacteria | 836 |
| 469 | Ga0501034_0000108 | 3300049571 | Bacteria | 152258 |
| 470 | Ga0501034_0070423 | 3300049571 | Bacteria | 3508 |
| 471 | Ga0501034_0218421 | 3300049571 | Bacteria | 1859 |
| 472 | Ga0501034_0315696 | 3300049571 | Bacteria | 1496 |
| 473 | Ga0501034_0869956 | 3300049571 | Bacteria | 790 |
| 474 | Ga0501036_0000065 | 3300049572 | Bacteria | 68031 |
| 475 | Ga0501036_0004067 | 3300049572 | Bacteria | 11766 |
| 476 | Ga0501037_0000507 | 3300049573 | Bacteria | 31211 |
| 477 | Ga0501037_0008451 | 3300049573 | Bacteria | 7550 |
| 478 | Ga0501037_0054997 | 3300049573 | Bacteria | 2910 |
| 479 | Ga0501037_0377047 | 3300049573 | Bacteria | 975 |
| 480 | Ga0501038_0006379 | 3300049574 | Bacteria | 10919 |
| 481 | Ga0501038_0042047 | 3300049574 | Bacteria | 3982 |
| 482 | Ga0501039_0000523 | 3300049575 | Bacteria | 27749 |
| 483 | Ga0501039_0035535 | 3300049575 | Bacteria | 3845 |
| 484 | Ga0501039_0042661 | 3300049575 | Bacteria | 3504 |
| 485 | Ga0501039_0056308 | 3300049575 | Bacteria | 3045 |
| 486 | Ga0501042_0161160 | 3300049578 | Bacteria | 1619 |
| 487 | Ga0501043_0000226 | 3300049579 | Bacteria | 51303 |
| 488 | Ga0501043_0001380 | 3300049579 | Bacteria | 21276 |
| 489 | Ga0501043_0114767 | 3300049579 | Bacteria | 2114 |
| 490 | Ga0501043_0252981 | 3300049579 | Bacteria | 1356 |
| 491 | Ga0501043_0522477 | 3300049579 | Bacteria | 884 |
| 492 | Ga0501046_0198703 | 3300049580 | Bacteria | 1492 |
| 493 | Ga0501046_0203828 | 3300049580 | Bacteria | 1471 |
| 494 | Ga0501047_0000325 | 3300049581 | Bacteria | 55223 |
| 495 | Ga0501047_0014996 | 3300049581 | Bacteria | 7374 |
| 496 | Ga0501047_0111971 | 3300049581 | Bacteria | 2612 |
| 497 | Ga0501047_0328062 | 3300049581 | Bacteria | 1369 |
| 498 | Ga0501047_0636394 | 3300049581 | Bacteria | 886 |
| 499 | Ga0501048_0000202 | 3300049582 | Bacteria | 39003 |
| 500 | Ga0501067_0000193 | 3300049583 | Bacteria | 34437 |
| 501 | Ga0501067_0004861 | 3300049583 | Bacteria | 7459 |
| 502 | Ga0501068_0025864 | 3300049584 | Bacteria | 3454 |
| 503 | Ga0501068_0121956 | 3300049584 | Bacteria | 1626 |
| 504 | Ga0501068_0170644 | 3300049584 | Bacteria | 1373 |
| 505 | Ga0501069_0001648 | 3300049585 | Bacteria | 11090 |
| 506 | Ga0501070_0089234 | 3300049586 | Bacteria | 2551 |
| 507 | Ga0501070_0110625 | 3300049586 | Bacteria | 2270 |
| 508 | Ga0501070_0467095 | 3300049586 | Bacteria | 1016 |
| 509 | Ga0501070_0565484 | 3300049586 | Bacteria | 909 |
| 510 | Ga0501071_0075720 | 3300049587 | Bacteria | 2457 |
| 511 | Ga0501071_0124924 | 3300049587 | Bacteria | 1909 |
| 512 | Ga0501071_0443240 | 3300049587 | Bacteria | 994 |
| 513 | Ga0501072_0001162 | 3300049588 | Bacteria | 19608 |
| 514 | Ga0501072_0051653 | 3300049588 | Bacteria | 3237 |
| 515 | Ga0501073_0000373 | 3300049589 | Bacteria | 30171 |
| 516 | Ga0501074_0000409 | 3300049590 | Bacteria | 25689 |
| 517 | Ga0501074_0039509 | 3300049590 | Bacteria | 3417 |
| 518 | Ga0501076_0089520 | 3300049592 | Bacteria | 2474 |
| 519 | Ga0501076_0225551 | 3300049592 | Bacteria | 1531 |
| 520 | Ga0501076_0419249 | 3300049592 | Bacteria | 1101 |
| 521 | Ga0501079_0016590 | 3300049741 | Bacteria | 5624 |
| 522 | Ga0501079_0034431 | 3300049741 | Bacteria | 3897 |
| 523 | Ga0501079_0275301 | 3300049741 | Bacteria | 1316 |
| 524 | Ga0501080_0116701 | 3300049742 | Bacteria | 2474 |
| 525 | Ga0501080_0197228 | 3300049742 | Bacteria | 1849 |
| 526 | Ga0501080_0591588 | 3300049742 | Bacteria | 985 |
| 527 | Ga0501083_0000915 | 3300049744 | Bacteria | 19583 |
| 528 | Ga0501083_0152777 | 3300049744 | Bacteria | 1511 |
| 529 | Ga0501035_0000079 | 3300049822 | Bacteria | 118194 |
| 530 | Ga0501035_0061886 | 3300049822 | Bacteria | 3330 |
| 531 | Ga0501035_0104376 | 3300049822 | Bacteria | 2485 |
| 532 | Ga0501035_0386273 | 3300049822 | Bacteria | 1167 |
| 533 | Ga0501044_0000085 | 3300049823 | Bacteria | 114339 |
| 534 | Ga0501044_0840446 | 3300049823 | Bacteria | 795 |
| 535 | Ga0501045_0028832 | 3300049824 | Bacteria | 4006 |
| 536 | Ga0501045_0283525 | 3300049824 | Bacteria | 1233 |
| 537 | nmdc:mga03683_223836_c1 | 3300050489 | Bacteria | 869 |
| 538 | nmdc:mga03n38_40904_c1 | 3300050490 | Bacteria | 2017 |
| 539 | nmdc:mga00v17_188691_c1 | 3300050491 | Bacteria | 1331 |
| 540 | nmdc:mga00v17_246253_c1 | 3300050491 | Bacteria | 1159 |
| 541 | nmdc:mga00v17_308311_c1 | 3300050491 | Bacteria | 1028 |
| 542 | nmdc:mga00v17_313591_c1 | 3300050491 | Bacteria | 1019 |
| 543 | nmdc:mga0yw44_194022_c1 | 3300050492 | Bacteria | 1340 |
| 544 | nmdc:mga0yw44_474110_c1 | 3300050492 | Bacteria | 849 |
| 545 | nmdc:mga0k408_190461_c1 | 3300050493 | Bacteria | 1224 |
| 546 | nmdc:mga06z11_16944_c1 | 3300050494 | Bacteria | 3295 |
| 547 | nmdc:mga06z11_350470_c1 | 3300050494 | Bacteria | 884 |
| 548 | nmdc:mga07m45_35580_c2 | 3300050496 | Bacteria | 2277 |
| 549 | nmdc:mga05p37_264278_c1 | 3300050507 | Bacteria | 2058 |
| 550 | nmdc:mga09592_107619_c1 | 3300050508 | Bacteria | 2391 |
| 551 | nmdc:mga0n895_409198_c1 | 3300050512 | Bacteria | 1372 |
| 552 | nmdc:mga0rr50_163933_c1 | 3300050513 | Bacteria | 1806 |
| 553 | Ga0495601_0090081 | 3300053077 | Bacteria | 1973 |
| 554 | Ga0495612_0010804 | 3300053078 | Bacteria | 3688 |
| 555 | Ga0495612_0053536 | 3300053078 | Bacteria | 1662 |
| 556 | Ga0495612_0058223 | 3300053078 | Bacteria | 1597 |
| 557 | Ga0500635_0012936 | 3300053080 | Bacteria | 2410 |
| 558 | Ga0495595_0000766 | 3300053084 | Bacteria | 12210 |
| 559 | Ga0495619_0000322 | 3300053085 | Bacteria | 33576 |
| 560 | Ga0500643_023038 | 3300053087 | Bacteria | 1995 |
| 561 | Ga0500581_061902 | 3300053089 | Bacteria | 1893 |
| 562 | Ga0500651_0129139 | 3300053093 | Bacteria | 1529 |
| 563 | Ga0500566_0092485 | 3300053094 | Bacteria | 1670 |
| 564 | Ga0500650_0004718 | 3300053098 | Bacteria | 4972 |
| 565 | Ga0500554_001458 | 3300053102 | Bacteria | 4573 |
| 566 | Ga0500554_005479 | 3300053102 | Bacteria | 2771 |
| 567 | Ga0500554_070425 | 3300053102 | Bacteria | 1137 |
| 568 | Ga0500555_017026 | 3300053103 | Bacteria | 2095 |
| 569 | Ga0500556_0022186 | 3300053104 | Bacteria | 2059 |
| 570 | Ga0500595_009636 | 3300053119 | Bacteria | 3889 |
| 571 | Ga0500642_0000168 | 3300053130 | Bacteria | 27108 |
| 572 | Ga0500568_0006518 | 3300053139 | Bacteria | 5848 |
| 573 | Ga0500568_0030601 | 3300053139 | Bacteria | 2227 |
| 574 | Ga0500568_0075290 | 3300053139 | Bacteria | 1287 |
| 575 | Ga0500577_0126740 | 3300053142 | Bacteria | 1067 |
| 576 | Ga0500603_000677 | 3300053150 | Bacteria | 8300 |
| 577 | Ga0500604_0001390 | 3300053151 | Bacteria | 6740 |
| 578 | Ga0500604_0015377 | 3300053151 | Bacteria | 2095 |
| 579 | Ga0500634_0102149 | 3300053161 | Bacteria | 1433 |
| 580 | Ga0500638_010285 | 3300053162 | Bacteria | 4089 |
| 581 | Ga0500636_0045778 | 3300053177 | Bacteria | 2580 |
| 582 | Ga0500637_0000490 | 3300053178 | Bacteria | 15336 |
| 583 | Ga0500637_0004706 | 3300053178 | Bacteria | 6521 |
| 584 | Ga0500645_016532 | 3300053730 | Bacteria | 2322 |
| 585 | Ga0501084_0048225 | 3300054114 | Bacteria | 3565 |
| 586 | Ga0501084_0056089 | 3300054114 | Bacteria | 3296 |
| 587 | Ga0501084_0357871 | 3300054114 | Bacteria | 1233 |
| 588 | Ga0500661_000389 | 3300055283 | Bacteria | 8086 |
| 589 | Ga0501082_0003006 | 3300060353 | Bacteria | 14737 |
| 590 | Ga0501082_0045208 | 3300060353 | Bacteria | 3797 |
| 591 | Ga0501082_0438604 | 3300060353 | Bacteria | 1141 |
| 592 | Ga0466962_0103541 | 3300061719 | Bacteria | 1367 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0048354 | Ga0373927_0048354_193_936 | 177 |
| 2 | 3300005455 | Ga0070663_100010706 | Ga0070663_1000107062 | 189 |
| 3 | 3300005548 | Ga0070665_100010052 | Ga0070665_1000100524 | 189 |
| 4 | 3300006051 | Ga0075364_10273719 | Ga0075364_102737192 | 189 |
| 5 | 3300006178 | Ga0075367_10011870 | Ga0075367_100118703 | 189 |
| 6 | 3300006353 | Ga0075370_10051978 | Ga0075370_100519783 | 189 |
| 7 | 3300006358 | Ga0068871_100168089 | Ga0068871_1001680892 | 189 |
| 8 | 3300009174 | Ga0105241_10341519 | Ga0105241_103415192 | 189 |
| 9 | 3300014969 | Ga0157376_10449054 | Ga0157376_104490542 | 189 |
| 10 | 3300025297 | Ga0209758_1064975 | Ga0209758_10649752 | 189 |
| 11 | 3300025911 | Ga0207654_10287603 | Ga0207654_102876031 | 189 |
| 12 | 3300025936 | Ga0207670_10256585 | Ga0207670_102565852 | 189 |
| 13 | 3300025937 | Ga0207669_10799430 | Ga0207669_107994301 | 189 |
| 14 | 3300026067 | Ga0207678_10069844 | Ga0207678_100698442 | 189 |
| 15 | 3300028379 | Ga0268266_10007255 | Ga0268266_100072554 | 189 |
| 16 | 3300048905 | Ga0496102_0473655 | Ga0496102_0473655_382_1035 | 189 |
| 17 | 3300048917 | Ga0496114_0046864 | Ga0496114_0046864_2774_3427 | 189 |
| 18 | 3300050490 | nmdc:mga03n38_40904_c1 | nmdc:mga03n38_40904_c1_594_1247 | 189 |
| 19 | 3300050491 | nmdc:mga00v17_313591_c1 | nmdc:mga00v17_313591_c1_68_721 | 189 |
| 20 | 3300050494 | nmdc:mga06z11_16944_c1 | nmdc:mga06z11_16944_c1_1877_2530 | 189 |
| 21 | 3300050496 | nmdc:mga07m45_35580_c2 | nmdc:mga07m45_35580_c2_1108_1761 | 189 |
| 22 | 3300048904 | Ga0496101_0612458 | Ga0496101_0612458_27_662 | 192 |
| 23 | 3300005614 | Ga0068856_100000255 | Ga0068856_1000002558 | 193 |
| 24 | 3300026078 | Ga0207702_10000390 | Ga0207702_100003908 | 193 |
| 25 | 3300048918 | Ga0496115_0617059 | Ga0496115_0617059_24_629 | 193 |
| 26 | 3300031548 | Ga0307408_100630262 | Ga0307408_1006302622 | 195 |
| 27 | 3300025916 | Ga0207663_10651671 | Ga0207663_106516711 | 196 |
| 28 | 3300048904 | Ga0496101_0206620 | Ga0496101_0206620_177_821 | 196 |
| 29 | 3300048905 | Ga0496102_0329074 | Ga0496102_0329074_16_660 | 196 |
| 30 | 3300048907 | Ga0496104_0087462 | Ga0496104_0087462_1626_2270 | 196 |
| 31 | 3300048908 | Ga0496105_0200326 | Ga0496105_0200326_790_1434 | 196 |
| 32 | 3300048910 | Ga0496107_0038553 | Ga0496107_0038553_692_1336 | 196 |
| 33 | 3300048911 | Ga0496108_0000801 | Ga0496108_0000801_11074_11718 | 196 |
| 34 | 3300048912 | Ga0496109_0013479 | Ga0496109_0013479_4996_5640 | 196 |
| 35 | 3300048913 | Ga0496110_0028041 | Ga0496110_0028041_1692_2336 | 196 |
| 36 | 3300048914 | Ga0496111_0192706 | Ga0496111_0192706_13_657 | 196 |
| 37 | 3300048915 | Ga0496112_0012703 | Ga0496112_0012703_659_1303 | 196 |
| 38 | 3300048917 | Ga0496114_0175225 | Ga0496114_0175225_465_1109 | 196 |
| 39 | 3300031712 | Ga0265342_10024685 | Ga0265342_100246852 | 197 |
| 40 | 3300005548 | Ga0070665_100077377 | Ga0070665_1000773772 | 198 |
| 41 | 3300028379 | Ga0268266_10109213 | Ga0268266_101092132 | 198 |
| 42 | 3300005983 | Ga0081540_1054929 | Ga0081540_10549293 | 199 |
| 43 | 3300048929 | Ga0496126_0001870 | Ga0496126_0001870_26574_27221 | 199 |
| 44 | 3300048929 | Ga0496126_0046311 | Ga0496126_0046311_308_955 | 199 |
| 45 | 3300050492 | nmdc:mga0yw44_474110_c1 | nmdc:mga0yw44_474110_c1_160_765 | 199 |
| 46 | iso_pu_bacteria | 2524023210 | 2524469268 | 199 |
| 47 | 3300005293 | Ga0065715_10190046 | Ga0065715_101900461 | 200 |
| 48 | 3300005329 | Ga0070683_100893836 | Ga0070683_1008938361 | 200 |
| 49 | 3300005344 | Ga0070661_100293586 | Ga0070661_1002935862 | 200 |
| 50 | 3300005434 | Ga0070709_10338889 | Ga0070709_103388892 | 200 |
| 51 | 3300005455 | Ga0070663_100241990 | Ga0070663_1002419901 | 200 |
| 52 | 3300005458 | Ga0070681_10400094 | Ga0070681_104000941 | 200 |
| 53 | 3300005536 | Ga0070697_100369583 | Ga0070697_1003695832 | 200 |
| 54 | 3300005544 | Ga0070686_100268820 | Ga0070686_1002688201 | 200 |
| 55 | 3300005563 | Ga0068855_101004551 | Ga0068855_1010045511 | 200 |
| 56 | 3300005842 | Ga0068858_100576248 | Ga0068858_1005762482 | 200 |
| 57 | 3300009545 | Ga0105237_10354260 | Ga0105237_103542602 | 200 |
| 58 | 3300025900 | Ga0207710_10067903 | Ga0207710_100679032 | 200 |
| 59 | 3300025901 | Ga0207688_10285403 | Ga0207688_102854032 | 200 |
| 60 | 3300025903 | Ga0207680_10574634 | Ga0207680_105746341 | 200 |
| 61 | 3300025914 | Ga0207671_10069722 | Ga0207671_100697222 | 200 |
| 62 | 3300025916 | Ga0207663_10371826 | Ga0207663_103718261 | 200 |
| 63 | 3300025916 | Ga0207663_10483558 | Ga0207663_104835581 | 200 |
| 64 | 3300025919 | Ga0207657_10127174 | Ga0207657_101271742 | 200 |
| 65 | 3300025921 | Ga0207652_10725150 | Ga0207652_107251501 | 200 |
| 66 | 3300025927 | Ga0207687_10454550 | Ga0207687_104545502 | 200 |
| 67 | 3300025932 | Ga0207690_10287624 | Ga0207690_102876242 | 200 |
| 68 | 3300025933 | Ga0207706_10102748 | Ga0207706_101027484 | 200 |
| 69 | 3300025934 | Ga0207686_10272232 | Ga0207686_102722322 | 200 |
| 70 | 3300025935 | Ga0207709_10049768 | Ga0207709_100497683 | 200 |
| 71 | 3300025939 | Ga0207665_10193048 | Ga0207665_101930481 | 200 |
| 72 | 3300025940 | Ga0207691_10144386 | Ga0207691_101443861 | 200 |
| 73 | 3300025941 | Ga0207711_10717658 | Ga0207711_107176582 | 200 |
| 74 | 3300025960 | Ga0207651_10542384 | Ga0207651_105423841 | 200 |
| 75 | 3300025986 | Ga0207658_10160375 | Ga0207658_101603752 | 200 |
| 76 | 3300026041 | Ga0207639_10124597 | Ga0207639_101245971 | 200 |
| 77 | 3300026067 | Ga0207678_10111648 | Ga0207678_101116483 | 200 |
| 78 | 3300026067 | Ga0207678_10178230 | Ga0207678_101782302 | 200 |
| 79 | 3300026116 | Ga0207674_10317001 | Ga0207674_103170011 | 200 |
| 80 | 3300026118 | Ga0207675_100224686 | Ga0207675_1002246862 | 200 |
| 81 | 3300028379 | Ga0268266_10033415 | Ga0268266_100334153 | 200 |
| 82 | 3300031238 | Ga0265332_10075241 | Ga0265332_100752412 | 200 |
| 83 | 3300031711 | Ga0265314_10077286 | Ga0265314_100772862 | 200 |
| 84 | 3300035086 | Ga0373934_0003005 | Ga0373934_0003005_4989_5591 | 200 |
| 85 | 3300035092 | Ga0373952_0015932 | Ga0373952_0015932_868_1470 | 200 |
| 86 | 3300035117 | Ga0373953_0002068 | Ga0373953_0002068_1923_2525 | 200 |
| 87 | 3300035119 | Ga0373956_0000465 | Ga0373956_0000465_12528_13130 | 200 |
| 88 | 3300035120 | Ga0373957_0000114 | Ga0373957_0000114_1300_1902 | 200 |
| 89 | 3300035172 | Ga0373955_0000133 | Ga0373955_0000133_20496_21098 | 200 |
| 90 | 3300035692 | Ga0373935_0254390 | Ga0373935_0254390_509_1111 | 200 |
| 91 | 3300035724 | Ga0373933_0000286 | Ga0373933_0000286_7259_7861 | 200 |
| 92 | 3300041451 | Ga0451791_0495528 | Ga0451791_0495528_163_771 | 200 |
| 93 | 3300041997 | Ga0439431_0050076 | Ga0439431_0050076_32_634 | 200 |
| 94 | 3300046454 | Ga0495592_0000686 | Ga0495592_0000686_7755_8357 | 200 |
| 95 | 3300046457 | Ga0495590_0085741 | Ga0495590_0085741_23_625 | 200 |
| 96 | 3300046459 | Ga0495629_0000503 | Ga0495629_0000503_24572_25174 | 200 |
| 97 | 3300046462 | Ga0495651_0006168 | Ga0495651_0006168_7036_7638 | 200 |
| 98 | 3300046463 | Ga0495653_0066000 | Ga0495653_0066000_1519_2121 | 200 |
| 99 | 3300046491 | Ga0495584_0057657 | Ga0495584_0057657_352_954 | 200 |
| 100 | 3300046499 | Ga0495594_0185904 | Ga0495594_0185904_161_763 | 200 |
| 101 | 3300046511 | Ga0495608_0000586 | Ga0495608_0000586_17391_17993 | 200 |
| 102 | 3300046516 | Ga0495628_0001371 | Ga0495628_0001371_17636_18238 | 200 |
| 103 | 3300046524 | Ga0495648_0001145 | Ga0495648_0001145_14320_14922 | 200 |
| 104 | 3300046525 | Ga0495663_0188020 | Ga0495663_0188020_14_616 | 200 |
| 105 | 3300046529 | Ga0495652_0001568 | Ga0495652_0001568_9789_10391 | 200 |
| 106 | 3300046533 | Ga0495640_0008795 | Ga0495640_0008795_5413_6015 | 200 |
| 107 | 3300046538 | Ga0495609_0031408 | Ga0495609_0031408_250_852 | 200 |
| 108 | 3300046543 | Ga0495645_0022212 | Ga0495645_0022212_1294_1896 | 200 |
| 109 | 3300046559 | Ga0495667_0000795 | Ga0495667_0000795_6695_7297 | 200 |
| 110 | 3300046615 | Ga0495656_0039061 | Ga0495656_0039061_26_628 | 200 |
| 111 | 3300046616 | Ga0495668_0049088 | Ga0495668_0049088_302_904 | 200 |
| 112 | 3300046642 | Ga0495634_0006542 | Ga0495634_0006542_5337_5939 | 200 |
| 113 | 3300046660 | Ga0495625_0563289 | Ga0495625_0563289_57_659 | 200 |
| 114 | 3300046663 | Ga0495635_0000417 | Ga0495635_0000417_7587_8189 | 200 |
| 115 | 3300046675 | Ga0495657_0000715 | Ga0495657_0000715_19237_19839 | 200 |
| 116 | 3300046678 | Ga0495599_0002562 | Ga0495599_0002562_9305_9907 | 200 |
| 117 | 3300046679 | Ga0495623_0002109 | Ga0495623_0002109_7724_8326 | 200 |
| 118 | 3300046680 | Ga0495646_0008630 | Ga0495646_0008630_1177_1779 | 200 |
| 119 | 3300046684 | Ga0495669_0005467 | Ga0495669_0005467_4409_5011 | 200 |
| 120 | 3300046689 | Ga0495613_0004447 | Ga0495613_0004447_9744_10346 | 200 |
| 121 | 3300046691 | Ga0495670_0421456 | Ga0495670_0421456_66_668 | 200 |
| 122 | 3300046809 | Ga0495600_0000372 | Ga0495600_0000372_22204_22806 | 200 |
| 123 | 3300046810 | Ga0495660_0253140 | Ga0495660_0253140_136_738 | 200 |
| 124 | 3300047317 | Ga0495604_0001526 | Ga0495604_0001526_9177_9779 | 200 |
| 125 | 3300047317 | Ga0495604_0435193 | Ga0495604_0435193_84_686 | 200 |
| 126 | 3300047318 | Ga0495636_0283483 | Ga0495636_0283483_86_688 | 200 |
| 127 | 3300047319 | Ga0495674_0002817 | Ga0495674_0002817_13924_14526 | 200 |
| 128 | 3300047320 | Ga0495672_0084837 | Ga0495672_0084837_1090_1692 | 200 |
| 129 | 3300047322 | Ga0495680_0006935 | Ga0495680_0006935_9177_9779 | 200 |
| 130 | 3300047444 | Ga0495675_0000478 | Ga0495675_0000478_7768_8370 | 200 |
| 131 | 3300047471 | Ga0495684_0000155 | Ga0495684_0000155_30140_30742 | 200 |
| 132 | 3300047673 | Ga0495593_0002338 | Ga0495593_0002338_6036_6638 | 200 |
| 133 | 3300048088 | Ga0495602_0004699 | Ga0495602_0004699_6823_7425 | 200 |
| 134 | 3300048910 | Ga0496107_0182094 | Ga0496107_0182094_139_741 | 200 |
| 135 | 3300048924 | Ga0496121_0001041 | Ga0496121_0001041_24766_25368 | 200 |
| 136 | 3300048924 | Ga0496121_0126181 | Ga0496121_0126181_199_801 | 200 |
| 137 | 3300048929 | Ga0496126_0134761 | Ga0496126_0134761_513_1145 | 200 |
| 138 | 3300049592 | Ga0501076_0419249 | Ga0501076_0419249_43_666 | 200 |
| 139 | 3300049741 | Ga0501079_0275301 | Ga0501079_0275301_434_1057 | 200 |
| 140 | 3300053084 | Ga0495595_0000766 | Ga0495595_0000766_10938_11540 | 200 |
| 141 | 3300053085 | Ga0495619_0000322 | Ga0495619_0000322_32388_32990 | 200 |
| 142 | 3300053139 | Ga0500568_0075290 | Ga0500568_0075290_347_949 | 200 |
| 143 | iso_pu_bacteria | 2874604998 | 2874606296 | 200 |
| 144 | 3300005347 | Ga0070668_100143353 | Ga0070668_1001433532 | 201 |
| 145 | 3300006844 | Ga0075428_100476441 | Ga0075428_1004764411 | 201 |
| 146 | 3300006880 | Ga0075429_100097541 | Ga0075429_1000975412 | 201 |
| 147 | 3300009147 | Ga0114129_10130405 | Ga0114129_101304053 | 201 |
| 148 | 3300025909 | Ga0207705_10143889 | Ga0207705_101438892 | 201 |
| 149 | 3300035118 | Ga0373954_0318855 | Ga0373954_0318855_143_748 | 201 |
| 150 | 3300039453 | Ga0436362_0379505 | Ga0436362_0379505_1642_2247 | 201 |
| 151 | 3300046542 | Ga0495597_0030847 | Ga0495597_0030847_32_688 | 201 |
| 152 | 3300048928 | Ga0496125_0001356 | Ga0496125_0001356_14112_14744 | 201 |
| 153 | 3300048928 | Ga0496125_0010096 | Ga0496125_0010096_2879_3511 | 201 |
| 154 | 3300048929 | Ga0496126_0088139 | Ga0496126_0088139_110_742 | 201 |
| 155 | 3300049571 | Ga0501034_0218421 | Ga0501034_0218421_258_881 | 201 |
| 156 | 3300049579 | Ga0501043_0114767 | Ga0501043_0114767_923_1546 | 201 |
| 157 | 3300049580 | Ga0501046_0203828 | Ga0501046_0203828_739_1362 | 201 |
| 158 | 3300049581 | Ga0501047_0636394 | Ga0501047_0636394_151_774 | 201 |
| 159 | 3300049822 | Ga0501035_0061886 | Ga0501035_0061886_1985_2608 | 201 |
| 160 | 3300050507 | nmdc:mga05p37_264278_c1 | nmdc:mga05p37_264278_c1_1151_1756 | 201 |
| 161 | 3300050508 | nmdc:mga09592_107619_c1 | nmdc:mga09592_107619_c1_364_969 | 201 |
| 162 | iso_pu_bacteria | 2513237141 | 2513889677 | 201 |
| 163 | 3300007265 | Ga0099794_10215355 | Ga0099794_102153552 | 202 |
| 164 | 3300010159 | Ga0099796_10105770 | Ga0099796_101057701 | 202 |
| 165 | 3300031616 | Ga0307508_10133194 | Ga0307508_101331942 | 202 |
| 166 | 3300031730 | Ga0307516_10108177 | Ga0307516_101081772 | 202 |
| 167 | 3300035170 | Ga0373943_0000900 | Ga0373943_0000900_456_1082 | 202 |
| 168 | 3300035692 | Ga0373935_0040906 | Ga0373935_0040906_1958_2584 | 202 |
| 169 | 3300035695 | Ga0373927_0001032 | Ga0373927_0001032_11865_12491 | 202 |
| 170 | 3300036401 | Ga0373937_0412531 | Ga0373937_0412531_519_1145 | 202 |
| 171 | 3300037068 | Ga0373925_0002484 | Ga0373925_0002484_13722_14348 | 202 |
| 172 | 3300039437 | Ga0436365_1885487 | Ga0436365_1885487_393_1013 | 202 |
| 173 | 3300039447 | Ga0436361_0146597 | Ga0436361_0146597_1484_2146 | 202 |
| 174 | 3300039450 | Ga0436363_1500653 | Ga0436363_1500653_3549_4169 | 202 |
| 175 | 3300041460 | Ga0451802_2184100 | Ga0451802_2184100_81_701 | 202 |
| 176 | 3300044684 | Ga0466966_0053238 | Ga0466966_0053238_855_1505 | 202 |
| 177 | 3300044765 | Ga0466970_0124029 | Ga0466970_0124029_350_1000 | 202 |
| 178 | 3300045049 | Ga0466959_0172154 | Ga0466959_0172154_349_999 | 202 |
| 179 | 3300046454 | Ga0495592_0176371 | Ga0495592_0176371_596_1222 | 202 |
| 180 | 3300046455 | Ga0495603_0000209 | Ga0495603_0000209_20633_21259 | 202 |
| 181 | 3300046459 | Ga0495629_0015792 | Ga0495629_0015792_526_1152 | 202 |
| 182 | 3300046461 | Ga0495641_0010107 | Ga0495641_0010107_2615_3241 | 202 |
| 183 | 3300046472 | Ga0495580_0001676 | Ga0495580_0001676_16546_17172 | 202 |
| 184 | 3300046473 | Ga0495582_0000152 | Ga0495582_0000152_8656_9282 | 202 |
| 185 | 3300046475 | Ga0495639_0000087 | Ga0495639_0000087_18170_18796 | 202 |
| 186 | 3300046476 | Ga0495662_0001427 | Ga0495662_0001427_8636_9262 | 202 |
| 187 | 3300046477 | Ga0495664_0019809 | Ga0495664_0019809_2760_3386 | 202 |
| 188 | 3300046499 | Ga0495594_0000129 | Ga0495594_0000129_8960_9586 | 202 |
| 189 | 3300046516 | Ga0495628_0193730 | Ga0495628_0193730_316_942 | 202 |
| 190 | 3300046526 | Ga0495666_0114509 | Ga0495666_0114509_556_1182 | 202 |
| 191 | 3300046531 | Ga0495665_0000124 | Ga0495665_0000124_25028_25654 | 202 |
| 192 | 3300046533 | Ga0495640_0035595 | Ga0495640_0035595_393_1019 | 202 |
| 193 | 3300046557 | Ga0495622_0011173 | Ga0495622_0011173_2255_2881 | 202 |
| 194 | 3300046642 | Ga0495634_0000599 | Ga0495634_0000599_25339_25965 | 202 |
| 195 | 3300046663 | Ga0495635_0003181 | Ga0495635_0003181_489_1115 | 202 |
| 196 | 3300046674 | Ga0495588_0001335 | Ga0495588_0001335_630_1256 | 202 |
| 197 | 3300046680 | Ga0495646_0062195 | Ga0495646_0062195_548_1174 | 202 |
| 198 | 3300046681 | Ga0495647_0002338 | Ga0495647_0002338_2380_3006 | 202 |
| 199 | 3300046683 | Ga0495658_0001819 | Ga0495658_0001819_455_1081 | 202 |
| 200 | 3300046689 | Ga0495613_0016955 | Ga0495613_0016955_4265_4891 | 202 |
| 201 | 3300046690 | Ga0495624_0001738 | Ga0495624_0001738_7368_7994 | 202 |
| 202 | 3300047315 | Ga0495581_0000176 | Ga0495581_0000176_27310_27936 | 202 |
| 203 | 3300047319 | Ga0495674_0002170 | Ga0495674_0002170_8633_9259 | 202 |
| 204 | 3300047321 | Ga0495676_0058409 | Ga0495676_0058409_199_825 | 202 |
| 205 | 3300047469 | Ga0495673_0029388 | Ga0495673_0029388_1508_2134 | 202 |
| 206 | 3300047471 | Ga0495684_0022619 | Ga0495684_0022619_3739_4365 | 202 |
| 207 | 3300047673 | Ga0495593_0000022 | Ga0495593_0000022_43813_44439 | 202 |
| 208 | 3300048089 | Ga0495614_0018413 | Ga0495614_0018413_959_1585 | 202 |
| 209 | 3300048905 | Ga0496102_0115880 | Ga0496102_0115880_1594_2229 | 202 |
| 210 | 3300049571 | Ga0501034_0869956 | Ga0501034_0869956_76_723 | 202 |
| 211 | 3300049578 | Ga0501042_0161160 | Ga0501042_0161160_253_891 | 202 |
| 212 | 3300049581 | Ga0501047_0111971 | Ga0501047_0111971_1423_2070 | 202 |
| 213 | 3300049586 | Ga0501070_0565484 | Ga0501070_0565484_80_727 | 202 |
| 214 | 3300049587 | Ga0501071_0124924 | Ga0501071_0124924_1016_1654 | 202 |
| 215 | 3300049742 | Ga0501080_0197228 | Ga0501080_0197228_865_1503 | 202 |
| 216 | 3300049822 | Ga0501035_0386273 | Ga0501035_0386273_106_753 | 202 |
| 217 | 3300049823 | Ga0501044_0840446 | Ga0501044_0840446_107_754 | 202 |
| 218 | 3300053080 | Ga0500635_0012936 | Ga0500635_0012936_725_1345 | 202 |
| 219 | 3300053102 | Ga0500554_001458 | Ga0500554_001458_1440_2060 | 202 |
| 220 | 3300053150 | Ga0500603_000677 | Ga0500603_000677_5065_5685 | 202 |
| 221 | 3300053178 | Ga0500637_0004706 | Ga0500637_0004706_3392_4012 | 202 |
| 222 | iso_pu_bacteria | 2602042107 | 2603859894 | 202 |
| 223 | iso_pu_bacteria | 2893066018 | 2893071115 | 202 |
| 224 | iso_pu_bacteria | 2903748898 | 2903754263 | 202 |
| 225 | iso_pu_bacteria | 2919073203 | 2919078773 | 202 |
| 226 | iso_pu_bacteria | 8019565922 | 8019570746 | 202 |
| 227 | 3300005334 | Ga0068869_100054805 | Ga0068869_1000548052 | 203 |
| 228 | 3300005844 | Ga0068862_100116716 | Ga0068862_1001167161 | 203 |
| 229 | 3300006871 | Ga0075434_100221546 | Ga0075434_1002215462 | 203 |
| 230 | 3300009094 | Ga0111539_10245086 | Ga0111539_102450862 | 203 |
| 231 | 3300025909 | Ga0207705_10056172 | Ga0207705_100561724 | 203 |
| 232 | 3300026041 | Ga0207639_10114912 | Ga0207639_101149121 | 203 |
| 233 | 3300048915 | Ga0496112_0165616 | Ga0496112_0165616_1285_1941 | 203 |
| 234 | 3300049572 | Ga0501036_0004067 | Ga0501036_0004067_37_648 | 203 |
| 235 | 3300049573 | Ga0501037_0377047 | Ga0501037_0377047_47_658 | 203 |
| 236 | 3300049587 | Ga0501071_0443240 | Ga0501071_0443240_11_622 | 203 |
| 237 | 3300050512 | nmdc:mga0n895_409198_c1 | nmdc:mga0n895_409198_c1_104_745 | 203 |
| 238 | 3300050513 | nmdc:mga0rr50_163933_c1 | nmdc:mga0rr50_163933_c1_452_1087 | 203 |
| 239 | 3300005337 | Ga0070682_100035583 | Ga0070682_1000355832 | 204 |
| 240 | 3300005458 | Ga0070681_10013957 | Ga0070681_100139573 | 204 |
| 241 | 3300005530 | Ga0070679_100307530 | Ga0070679_1003075302 | 204 |
| 242 | 3300005547 | Ga0070693_100281143 | Ga0070693_1002811431 | 204 |
| 243 | 3300005578 | Ga0068854_100246891 | Ga0068854_1002468911 | 204 |
| 244 | 3300010375 | Ga0105239_10181230 | Ga0105239_101812302 | 204 |
| 245 | 3300013104 | Ga0157370_10167808 | Ga0157370_101678082 | 204 |
| 246 | 3300013307 | Ga0157372_10967436 | Ga0157372_109674361 | 204 |
| 247 | 3300025912 | Ga0207707_10000462 | Ga0207707_100004623 | 204 |
| 248 | 3300025917 | Ga0207660_10082320 | Ga0207660_100823202 | 204 |
| 249 | 3300025921 | Ga0207652_10341456 | Ga0207652_103414561 | 204 |
| 250 | 3300025981 | Ga0207640_10116379 | Ga0207640_101163793 | 204 |
| 251 | 3300039438 | Ga0436360_0832736 | Ga0436360_0832736_537_1181 | 204 |
| 252 | 3300039447 | Ga0436361_0523452 | Ga0436361_0523452_710_1354 | 204 |
| 253 | 3300039453 | Ga0436362_0733513 | Ga0436362_0733513_2171_2815 | 204 |
| 254 | 3300049575 | Ga0501039_0035535 | Ga0501039_0035535_2691_3320 | 204 |
| 255 | 3300049587 | Ga0501071_0075720 | Ga0501071_0075720_910_1539 | 204 |
| 256 | 3300049590 | Ga0501074_0039509 | Ga0501074_0039509_2223_2852 | 204 |
| 257 | 3300049592 | Ga0501076_0089520 | Ga0501076_0089520_1103_1732 | 204 |
| 258 | 3300054114 | Ga0501084_0056089 | Ga0501084_0056089_2172_2801 | 204 |
| 259 | 3300060353 | Ga0501082_0438604 | Ga0501082_0438604_115_729 | 204 |
| 260 | iso_pu_bacteria | 2857524615 | 2857524886 | 204 |
| 261 | 3300005336 | Ga0070680_100215092 | Ga0070680_1002150922 | 205 |
| 262 | 3300005364 | Ga0070673_100145775 | Ga0070673_1001457752 | 205 |
| 263 | 3300005456 | Ga0070678_100264233 | Ga0070678_1002642332 | 205 |
| 264 | 3300005458 | Ga0070681_10215011 | Ga0070681_102150112 | 205 |
| 265 | 3300005530 | Ga0070679_100224122 | Ga0070679_1002241221 | 205 |
| 266 | 3300005548 | Ga0070665_100473803 | Ga0070665_1004738031 | 205 |
| 267 | 3300005578 | Ga0068854_100594510 | Ga0068854_1005945101 | 205 |
| 268 | 3300005840 | Ga0068870_10049642 | Ga0068870_100496423 | 205 |
| 269 | 3300006048 | Ga0075363_100253832 | Ga0075363_1002538322 | 205 |
| 270 | 3300013297 | Ga0157378_10148390 | Ga0157378_101483901 | 205 |
| 271 | 3300014325 | Ga0163163_11423370 | Ga0163163_114233701 | 205 |
| 272 | 3300025912 | Ga0207707_10091864 | Ga0207707_100918642 | 205 |
| 273 | 3300025921 | Ga0207652_10051300 | Ga0207652_100513004 | 205 |
| 274 | 3300026121 | Ga0207683_10055123 | Ga0207683_100551233 | 205 |
| 275 | 3300035724 | Ga0373933_0119571 | Ga0373933_0119571_523_1203 | 205 |
| 276 | 3300035725 | Ga0373947_0494742 | Ga0373947_0494742_22_684 | 205 |
| 277 | 3300041413 | Ga0439465_0012566 | Ga0439465_0012566_715_1353 | 205 |
| 278 | 3300046477 | Ga0495664_0172643 | Ga0495664_0172643_79_780 | 205 |
| 279 | 3300046678 | Ga0495599_0348234 | Ga0495599_0348234_31_708 | 205 |
| 280 | 3300047470 | Ga0495681_0050989 | Ga0495681_0050989_903_1547 | 205 |
| 281 | 3300050491 | nmdc:mga00v17_308311_c1 | nmdc:mga00v17_308311_c1_373_1005 | 205 |
| 282 | 3300053078 | Ga0495612_0010804 | Ga0495612_0010804_638_1315 | 205 |
| 283 | 3300053102 | Ga0500554_070425 | Ga0500554_070425_332_952 | 205 |
| 284 | 3300053130 | Ga0500642_0000168 | Ga0500642_0000168_22658_23299 | 205 |
| 285 | 3300005329 | Ga0070683_100042499 | Ga0070683_1000424992 | 206 |
| 286 | 3300005336 | Ga0070680_100415362 | Ga0070680_1004153621 | 206 |
| 287 | 3300005535 | Ga0070684_100008771 | Ga0070684_1000087715 | 206 |
| 288 | 3300005539 | Ga0068853_100615616 | Ga0068853_1006156161 | 206 |
| 289 | 3300005563 | Ga0068855_100184228 | Ga0068855_1001842282 | 206 |
| 290 | 3300005616 | Ga0068852_100002678 | Ga0068852_10000267810 | 206 |
| 291 | 3300006175 | Ga0070712_100081372 | Ga0070712_1000813723 | 206 |
| 292 | 3300009093 | Ga0105240_10211364 | Ga0105240_102113641 | 206 |
| 293 | 3300009545 | Ga0105237_10317932 | Ga0105237_103179322 | 206 |
| 294 | 3300013105 | Ga0157369_10002191 | Ga0157369_1000219119 | 206 |
| 295 | 3300013105 | Ga0157369_10015878 | Ga0157369_100158782 | 206 |
| 296 | 3300020069 | Ga0197907_11260994 | Ga0197907_112609942 | 206 |
| 297 | 3300025913 | Ga0207695_10074920 | Ga0207695_100749203 | 206 |
| 298 | 3300025913 | Ga0207695_10167645 | Ga0207695_101676453 | 206 |
| 299 | 3300025932 | Ga0207690_10124712 | Ga0207690_101247122 | 206 |
| 300 | 3300025944 | Ga0207661_10032714 | Ga0207661_100327142 | 206 |
| 301 | 3300025949 | Ga0207667_10338931 | Ga0207667_103389313 | 206 |
| 302 | 3300025981 | Ga0207640_10182136 | Ga0207640_101821362 | 206 |
| 303 | 3300037418 | Ga0395900_0052916 | Ga0395900_0052916_2904_3563 | 206 |
| 304 | 3300037466 | Ga0395898_0028926 | Ga0395898_0028926_74_733 | 206 |
| 305 | 3300038443 | Ga0395901_1004492 | Ga0395901_1004492_135_794 | 206 |
| 306 | 3300048916 | Ga0496113_0705248 | Ga0496113_0705248_41_724 | 206 |
| 307 | 3300048918 | Ga0496115_0183314 | Ga0496115_0183314_223_888 | 206 |
| 308 | 3300053078 | Ga0495612_0058223 | Ga0495612_0058223_67_735 | 206 |
| 309 | 3300005336 | Ga0070680_100111891 | Ga0070680_1001118912 | 207 |
| 310 | 3300005341 | Ga0070691_10283925 | Ga0070691_102839251 | 207 |
| 311 | 3300005436 | Ga0070713_100084736 | Ga0070713_1000847364 | 207 |
| 312 | 3300005437 | Ga0070710_10184661 | Ga0070710_101846612 | 207 |
| 313 | 3300005445 | Ga0070708_100218520 | Ga0070708_1002185202 | 207 |
| 314 | 3300005458 | Ga0070681_10113314 | Ga0070681_101133143 | 207 |
| 315 | 3300005535 | Ga0070684_100012842 | Ga0070684_1000128426 | 207 |
| 316 | 3300005840 | Ga0068870_10315406 | Ga0068870_103154061 | 207 |
| 317 | 3300006028 | Ga0070717_10126640 | Ga0070717_101266402 | 207 |
| 318 | 3300006175 | Ga0070712_100127596 | Ga0070712_1001275961 | 207 |
| 319 | 3300006175 | Ga0070712_100218246 | Ga0070712_1002182462 | 207 |
| 320 | 3300007265 | Ga0099794_10072905 | Ga0099794_100729052 | 207 |
| 321 | 3300007265 | Ga0099794_10133328 | Ga0099794_101333281 | 207 |
| 322 | 3300009093 | Ga0105240_10052104 | Ga0105240_100521042 | 207 |
| 323 | 3300009545 | Ga0105237_10045695 | Ga0105237_100456954 | 207 |
| 324 | 3300009545 | Ga0105237_10077319 | Ga0105237_100773195 | 207 |
| 325 | 3300009551 | Ga0105238_10325954 | Ga0105238_103259544 | 207 |
| 326 | 3300010159 | Ga0099796_10014229 | Ga0099796_100142294 | 207 |
| 327 | 3300010375 | Ga0105239_10206174 | Ga0105239_102061742 | 207 |
| 328 | 3300013104 | Ga0157370_10056758 | Ga0157370_100567583 | 207 |
| 329 | 3300013105 | Ga0157369_10116560 | Ga0157369_101165601 | 207 |
| 330 | 3300013105 | Ga0157369_10169842 | Ga0157369_101698424 | 207 |
| 331 | 3300013306 | Ga0163162_10247733 | Ga0163162_102477332 | 207 |
| 332 | 3300013307 | Ga0157372_10531674 | Ga0157372_105316742 | 207 |
| 333 | 3300020082 | Ga0206353_10616236 | Ga0206353_106162362 | 207 |
| 334 | 3300025321 | Ga0207656_10071332 | Ga0207656_100713322 | 207 |
| 335 | 3300025898 | Ga0207692_10036157 | Ga0207692_100361572 | 207 |
| 336 | 3300025912 | Ga0207707_10132662 | Ga0207707_101326622 | 207 |
| 337 | 3300025915 | Ga0207693_10063168 | Ga0207693_100631682 | 207 |
| 338 | 3300025917 | Ga0207660_10348180 | Ga0207660_103481802 | 207 |
| 339 | 3300025928 | Ga0207700_10285425 | Ga0207700_102854252 | 207 |
| 340 | 3300025928 | Ga0207700_10534829 | Ga0207700_105348292 | 207 |
| 341 | 3300025939 | Ga0207665_10047252 | Ga0207665_100472522 | 207 |
| 342 | 3300025944 | Ga0207661_10082676 | Ga0207661_100826762 | 207 |
| 343 | 3300025972 | Ga0207668_10065517 | Ga0207668_100655174 | 207 |
| 344 | 3300026041 | Ga0207639_10584406 | Ga0207639_105844061 | 207 |
| 345 | 3300026067 | Ga0207678_10410095 | Ga0207678_104100951 | 207 |
| 346 | 3300026089 | Ga0207648_10674754 | Ga0207648_106747541 | 207 |
| 347 | 3300026116 | Ga0207674_10036112 | Ga0207674_100361124 | 207 |
| 348 | 3300027671 | Ga0209588_1014130 | Ga0209588_10141303 | 207 |
| 349 | 3300027671 | Ga0209588_1027125 | Ga0209588_10271251 | 207 |
| 350 | 3300028379 | Ga0268266_10672765 | Ga0268266_106727652 | 207 |
| 351 | 3300035691 | Ga0373931_0204867 | Ga0373931_0204867_399_1061 | 207 |
| 352 | 3300035695 | Ga0373927_0111791 | Ga0373927_0111791_107_763 | 207 |
| 353 | 3300035724 | Ga0373933_0000151 | Ga0373933_0000151_13061_13711 | 207 |
| 354 | 3300035725 | Ga0373947_0008149 | Ga0373947_0008149_18_689 | 207 |
| 355 | 3300037068 | Ga0373925_0059809 | Ga0373925_0059809_2028_2699 | 207 |
| 356 | 3300039437 | Ga0436365_1918864 | Ga0436365_1918864_34_696 | 207 |
| 357 | 3300044735 | Ga0466968_0117353 | Ga0466968_0117353_500_1171 | 207 |
| 358 | 3300044765 | Ga0466970_0217143 | Ga0466970_0217143_251_922 | 207 |
| 359 | 3300045049 | Ga0466959_0094752 | Ga0466959_0094752_114_785 | 207 |
| 360 | 3300046472 | Ga0495580_0083904 | Ga0495580_0083904_56_727 | 207 |
| 361 | 3300046473 | Ga0495582_0162888 | Ga0495582_0162888_477_1133 | 207 |
| 362 | 3300046506 | Ga0495583_0097667 | Ga0495583_0097667_421_1077 | 207 |
| 363 | 3300046515 | Ga0495620_0006184 | Ga0495620_0006184_2386_3042 | 207 |
| 364 | 3300046518 | Ga0495631_0056289 | Ga0495631_0056289_861_1517 | 207 |
| 365 | 3300046530 | Ga0495654_0015913 | Ga0495654_0015913_1391_2113 | 207 |
| 366 | 3300046535 | Ga0495586_0108137 | Ga0495586_0108137_621_1277 | 207 |
| 367 | 3300046660 | Ga0495625_0059313 | Ga0495625_0059313_1285_2007 | 207 |
| 368 | 3300046665 | Ga0495661_0042963 | Ga0495661_0042963_367_1023 | 207 |
| 369 | 3300046678 | Ga0495599_0114418 | Ga0495599_0114418_904_1584 | 207 |
| 370 | 3300047315 | Ga0495581_0188450 | Ga0495581_0188450_478_1128 | 207 |
| 371 | 3300047321 | Ga0495676_0111203 | Ga0495676_0111203_128_799 | 207 |
| 372 | 3300047469 | Ga0495673_0074267 | Ga0495673_0074267_59_715 | 207 |
| 373 | 3300048088 | Ga0495602_0559201 | Ga0495602_0559201_21_704 | 207 |
| 374 | 3300048903 | Ga0496100_0030038 | Ga0496100_0030038_742_1398 | 207 |
| 375 | 3300048905 | Ga0496102_0501551 | Ga0496102_0501551_82_738 | 207 |
| 376 | 3300048907 | Ga0496104_0205471 | Ga0496104_0205471_835_1497 | 207 |
| 377 | 3300048908 | Ga0496105_0249278 | Ga0496105_0249278_37_699 | 207 |
| 378 | 3300048911 | Ga0496108_0065578 | Ga0496108_0065578_2050_2712 | 207 |
| 379 | 3300048912 | Ga0496109_0121916 | Ga0496109_0121916_755_1417 | 207 |
| 380 | 3300048913 | Ga0496110_0108028 | Ga0496110_0108028_1082_1744 | 207 |
| 381 | 3300048914 | Ga0496111_0081019 | Ga0496111_0081019_64_726 | 207 |
| 382 | 3300048916 | Ga0496113_0441427 | Ga0496113_0441427_76_738 | 207 |
| 383 | 3300048918 | Ga0496115_0020855 | Ga0496115_0020855_1670_2326 | 207 |
| 384 | 3300048918 | Ga0496115_0058690 | Ga0496115_0058690_1984_2646 | 207 |
| 385 | 3300048918 | Ga0496115_0338343 | Ga0496115_0338343_471_1133 | 207 |
| 386 | 3300048929 | Ga0496126_0039346 | Ga0496126_0039346_187_909 | 207 |
| 387 | 3300048929 | Ga0496126_0048968 | Ga0496126_0048968_2950_3672 | 207 |
| 388 | 3300050491 | nmdc:mga00v17_188691_c1 | nmdc:mga00v17_188691_c1_170_826 | 207 |
| 389 | 3300053077 | Ga0495601_0090081 | Ga0495601_0090081_433_1089 | 207 |
| 390 | 3300053078 | Ga0495612_0053536 | Ga0495612_0053536_90_746 | 207 |
| 391 | 3300053087 | Ga0500643_023038 | Ga0500643_023038_73_729 | 207 |
| 392 | 3300053089 | Ga0500581_061902 | Ga0500581_061902_688_1344 | 207 |
| 393 | 3300053093 | Ga0500651_0129139 | Ga0500651_0129139_266_922 | 207 |
| 394 | 3300053094 | Ga0500566_0092485 | Ga0500566_0092485_386_1030 | 207 |
| 395 | 3300053098 | Ga0500650_0004718 | Ga0500650_0004718_3110_3832 | 207 |
| 396 | 3300053102 | Ga0500554_005479 | Ga0500554_005479_717_1361 | 207 |
| 397 | 3300053103 | Ga0500555_017026 | Ga0500555_017026_866_1522 | 207 |
| 398 | 3300053104 | Ga0500556_0022186 | Ga0500556_0022186_443_1114 | 207 |
| 399 | 3300053119 | Ga0500595_009636 | Ga0500595_009636_1702_2346 | 207 |
| 400 | 3300053139 | Ga0500568_0006518 | Ga0500568_0006518_2087_2809 | 207 |
| 401 | 3300053139 | Ga0500568_0030601 | Ga0500568_0030601_98_769 | 207 |
| 402 | 3300053142 | Ga0500577_0126740 | Ga0500577_0126740_363_1019 | 207 |
| 403 | 3300053151 | Ga0500604_0001390 | Ga0500604_0001390_5652_6374 | 207 |
| 404 | 3300053151 | Ga0500604_0015377 | Ga0500604_0015377_574_1230 | 207 |
| 405 | 3300053161 | Ga0500634_0102149 | Ga0500634_0102149_516_1172 | 207 |
| 406 | 3300053162 | Ga0500638_010285 | Ga0500638_010285_2142_2786 | 207 |
| 407 | 3300053178 | Ga0500637_0000490 | Ga0500637_0000490_6138_6782 | 207 |
| 408 | 3300053730 | Ga0500645_016532 | Ga0500645_016532_351_1073 | 207 |
| 409 | 3300055283 | Ga0500661_000389 | Ga0500661_000389_2988_3632 | 207 |
| 410 | 3300061719 | Ga0466962_0103541 | Ga0466962_0103541_425_1096 | 207 |
| 411 | 3300005334 | Ga0068869_100201984 | Ga0068869_1002019842 | 208 |
| 412 | 3300005347 | Ga0070668_100145089 | Ga0070668_1001450892 | 208 |
| 413 | 3300005353 | Ga0070669_100398383 | Ga0070669_1003983831 | 208 |
| 414 | 3300005366 | Ga0070659_100073710 | Ga0070659_1000737103 | 208 |
| 415 | 3300005367 | Ga0070667_100425816 | Ga0070667_1004258162 | 208 |
| 416 | 3300005438 | Ga0070701_10035734 | Ga0070701_100357343 | 208 |
| 417 | 3300005455 | Ga0070663_100032781 | Ga0070663_1000327811 | 208 |
| 418 | 3300005468 | Ga0070707_100158450 | Ga0070707_1001584502 | 208 |
| 419 | 3300005471 | Ga0070698_100198507 | Ga0070698_1001985073 | 208 |
| 420 | 3300005536 | Ga0070697_100281107 | Ga0070697_1002811072 | 208 |
| 421 | 3300005539 | Ga0068853_100438728 | Ga0068853_1004387282 | 208 |
| 422 | 3300005549 | Ga0070704_100275192 | Ga0070704_1002751922 | 208 |
| 423 | 3300005843 | Ga0068860_100363885 | Ga0068860_1003638852 | 208 |
| 424 | 3300005844 | Ga0068862_100495862 | Ga0068862_1004958622 | 208 |
| 425 | 3300006038 | Ga0075365_10506249 | Ga0075365_105062492 | 208 |
| 426 | 3300006051 | Ga0075364_10151053 | Ga0075364_101510533 | 208 |
| 427 | 3300006178 | Ga0075367_10294992 | Ga0075367_102949922 | 208 |
| 428 | 3300006195 | Ga0075366_10086754 | Ga0075366_100867542 | 208 |
| 429 | 3300006195 | Ga0075366_10193094 | Ga0075366_101930943 | 208 |
| 430 | 3300009098 | Ga0105245_10093478 | Ga0105245_100934783 | 208 |
| 431 | 3300009148 | Ga0105243_10223074 | Ga0105243_102230743 | 208 |
| 432 | 3300009553 | Ga0105249_10066739 | Ga0105249_100667392 | 208 |
| 433 | 3300011119 | Ga0105246_10173671 | Ga0105246_101736712 | 208 |
| 434 | 3300013297 | Ga0157378_10292405 | Ga0157378_102924051 | 208 |
| 435 | 3300014326 | Ga0157380_10149349 | Ga0157380_101493493 | 208 |
| 436 | 3300014968 | Ga0157379_10287109 | Ga0157379_102871092 | 208 |
| 437 | 3300014969 | Ga0157376_10615567 | Ga0157376_106155671 | 208 |
| 438 | 3300025910 | Ga0207684_10652324 | Ga0207684_106523242 | 208 |
| 439 | 3300025922 | Ga0207646_10144882 | Ga0207646_101448822 | 208 |
| 440 | 3300025923 | Ga0207681_10530317 | Ga0207681_105303171 | 208 |
| 441 | 3300025926 | Ga0207659_10434925 | Ga0207659_104349252 | 208 |
| 442 | 3300025932 | Ga0207690_10115276 | Ga0207690_101152762 | 208 |
| 443 | 3300025934 | Ga0207686_10056263 | Ga0207686_100562633 | 208 |
| 444 | 3300025937 | Ga0207669_10109796 | Ga0207669_101097961 | 208 |
| 445 | 3300025942 | Ga0207689_10116568 | Ga0207689_101165682 | 208 |
| 446 | 3300026035 | Ga0207703_10174393 | Ga0207703_101743932 | 208 |
| 447 | 3300026075 | Ga0207708_10092879 | Ga0207708_100928793 | 208 |
| 448 | 3300026142 | Ga0207698_10206465 | Ga0207698_102064652 | 208 |
| 449 | 3300027866 | Ga0209813_10100709 | Ga0209813_101007092 | 208 |
| 450 | 3300032126 | Ga0307415_100434622 | Ga0307415_1004346221 | 208 |
| 451 | 3300035242 | Ga0373962_0104587 | Ga0373962_0104587_140_799 | 208 |
| 452 | 3300037471 | Ga0395905_0101770 | Ga0395905_0101770_509_1168 | 208 |
| 453 | 3300046476 | Ga0495662_0103242 | Ga0495662_0103242_175_822 | 208 |
| 454 | 3300046520 | Ga0495637_0078848 | Ga0495637_0078848_526_1185 | 208 |
| 455 | 3300046538 | Ga0495609_0134590 | Ga0495609_0134590_379_1038 | 208 |
| 456 | 3300046664 | Ga0495659_0093847 | Ga0495659_0093847_248_907 | 208 |
| 457 | 3300046665 | Ga0495661_0354334 | Ga0495661_0354334_26_685 | 208 |
| 458 | 3300047445 | Ga0495677_0081325 | Ga0495677_0081325_345_1004 | 208 |
| 459 | 3300048903 | Ga0496100_0059107 | Ga0496100_0059107_1195_1854 | 208 |
| 460 | 3300048905 | Ga0496102_0057015 | Ga0496102_0057015_1269_1928 | 208 |
| 461 | 3300048909 | Ga0496106_0229436 | Ga0496106_0229436_192_851 | 208 |
| 462 | 3300048917 | Ga0496114_0137864 | Ga0496114_0137864_1051_1710 | 208 |
| 463 | 3300050489 | nmdc:mga03683_223836_c1 | nmdc:mga03683_223836_c1_89_721 | 208 |
| 464 | 3300050491 | nmdc:mga00v17_246253_c1 | nmdc:mga00v17_246253_c1_109_741 | 208 |
| 465 | 3300050492 | nmdc:mga0yw44_194022_c1 | nmdc:mga0yw44_194022_c1_469_1101 | 208 |
| 466 | 3300050493 | nmdc:mga0k408_190461_c1 | nmdc:mga0k408_190461_c1_473_1105 | 208 |
| 467 | 3300050494 | nmdc:mga06z11_350470_c1 | nmdc:mga06z11_350470_c1_80_712 | 208 |
| 468 | 3300053177 | Ga0500636_0045778 | Ga0500636_0045778_737_1396 | 208 |
| 469 | 3300005983 | Ga0081540_1009395 | Ga0081540_10093956 | 209 |
| 470 | 3300025906 | Ga0207699_10006907 | Ga0207699_100069072 | 209 |
| 471 | 3300031247 | Ga0265340_10005476 | Ga0265340_100054762 | 209 |
| 472 | 3300031250 | Ga0265331_10074711 | Ga0265331_100747112 | 209 |
| 473 | 3300031344 | Ga0265316_10080407 | Ga0265316_100804072 | 209 |
| 474 | 3300032002 | Ga0307416_100744881 | Ga0307416_1007448811 | 209 |
| 475 | 3300035083 | Ga0373926_0016830 | Ga0373926_0016830_892_1641 | 209 |
| 476 | 3300035111 | Ga0373923_0124249 | Ga0373923_0124249_72_821 | 209 |
| 477 | 3300035116 | Ga0373945_0011722 | Ga0373945_0011722_2005_2754 | 209 |
| 478 | 3300035117 | Ga0373953_0112435 | Ga0373953_0112435_344_1012 | 209 |
| 479 | 3300035170 | Ga0373943_0211025 | Ga0373943_0211025_213_962 | 209 |
| 480 | 3300035171 | Ga0373946_0172612 | Ga0373946_0172612_175_924 | 209 |
| 481 | 3300035410 | Ga0373924_0234490 | Ga0373924_0234490_96_764 | 209 |
| 482 | 3300035692 | Ga0373935_0143711 | Ga0373935_0143711_26_775 | 209 |
| 483 | 3300035695 | Ga0373927_0040850 | Ga0373927_0040850_2149_2898 | 209 |
| 484 | 3300035724 | Ga0373933_0016412 | Ga0373933_0016412_96_845 | 209 |
| 485 | 3300036401 | Ga0373937_0131817 | Ga0373937_0131817_1248_1997 | 209 |
| 486 | 3300037068 | Ga0373925_0177652 | Ga0373925_0177652_317_1066 | 209 |
| 487 | 3300046459 | Ga0495629_0220309 | Ga0495629_0220309_608_1276 | 209 |
| 488 | 3300046463 | Ga0495653_0183879 | Ga0495653_0183879_273_1022 | 209 |
| 489 | 3300046472 | Ga0495580_0029809 | Ga0495580_0029809_196_945 | 209 |
| 490 | 3300046473 | Ga0495582_0009705 | Ga0495582_0009705_1846_2595 | 209 |
| 491 | 3300046475 | Ga0495639_0135693 | Ga0495639_0135693_100_849 | 209 |
| 492 | 3300046477 | Ga0495664_0156304 | Ga0495664_0156304_486_1235 | 209 |
| 493 | 3300046514 | Ga0495618_0010020 | Ga0495618_0010020_4739_5488 | 209 |
| 494 | 3300046517 | Ga0495630_0050670 | Ga0495630_0050670_1760_2509 | 209 |
| 495 | 3300046559 | Ga0495667_0213438 | Ga0495667_0213438_469_1218 | 209 |
| 496 | 3300046642 | Ga0495634_0097914 | Ga0495634_0097914_204_872 | 209 |
| 497 | 3300046679 | Ga0495623_0150269 | Ga0495623_0150269_148_816 | 209 |
| 498 | 3300046683 | Ga0495658_0005829 | Ga0495658_0005829_15_764 | 209 |
| 499 | 3300046689 | Ga0495613_0442568 | Ga0495613_0442568_26_775 | 209 |
| 500 | 3300046690 | Ga0495624_0064956 | Ga0495624_0064956_113_862 | 209 |
| 501 | 3300047315 | Ga0495581_0032467 | Ga0495581_0032467_2170_2919 | 209 |
| 502 | 3300047317 | Ga0495604_0217005 | Ga0495604_0217005_621_1289 | 209 |
| 503 | 3300047319 | Ga0495674_0057538 | Ga0495674_0057538_232_981 | 209 |
| 504 | 3300047321 | Ga0495676_0418533 | Ga0495676_0418533_38_787 | 209 |
| 505 | 3300048089 | Ga0495614_0058031 | Ga0495614_0058031_613_1362 | 209 |
| 506 | 3300003659 | JGI25404J52841_10001478 | JGI25404J52841_100014783 | 210 |
| 507 | 3300005937 | Ga0081455_10012458 | Ga0081455_100124584 | 210 |
| 508 | 3300005937 | Ga0081455_10024496 | Ga0081455_100244961 | 210 |
| 509 | 3300005937 | Ga0081455_10273521 | Ga0081455_102735212 | 210 |
| 510 | 3300005983 | Ga0081540_1004361 | Ga0081540_10043618 | 210 |
| 511 | 3300005983 | Ga0081540_1004490 | Ga0081540_10044906 | 210 |
| 512 | 3300005983 | Ga0081540_1016522 | Ga0081540_10165223 | 210 |
| 513 | 3300005983 | Ga0081540_1064466 | Ga0081540_10644662 | 210 |
| 514 | 3300005983 | Ga0081540_1080972 | Ga0081540_10809722 | 210 |
| 515 | 3300013102 | Ga0157371_10057862 | Ga0157371_100578624 | 210 |
| 516 | 3300025915 | Ga0207693_10104230 | Ga0207693_101042301 | 210 |
| 517 | 3300026041 | Ga0207639_10339961 | Ga0207639_103399612 | 210 |
| 518 | 3300026067 | Ga0207678_10494265 | Ga0207678_104942652 | 210 |
| 519 | 3300046462 | Ga0495651_0060038 | Ga0495651_0060038_94_732 | 210 |
| 520 | 3300049568 | Ga0501031_0048554 | Ga0501031_0048554_600_1271 | 210 |
| 521 | 3300049568 | Ga0501031_0350826 | Ga0501031_0350826_246_914 | 210 |
| 522 | 3300049569 | Ga0501032_0002335 | Ga0501032_0002335_2305_2976 | 210 |
| 523 | 3300049569 | Ga0501032_0106256 | Ga0501032_0106256_1126_1794 | 210 |
| 524 | 3300049569 | Ga0501032_0166864 | Ga0501032_0166864_620_1288 | 210 |
| 525 | 3300049569 | Ga0501032_0403833 | Ga0501032_0403833_187_855 | 210 |
| 526 | 3300049570 | Ga0501033_0000116 | Ga0501033_0000116_50132_50803 | 210 |
| 527 | 3300049570 | Ga0501033_0000291 | Ga0501033_0000291_3226_3894 | 210 |
| 528 | 3300049570 | Ga0501033_0374945 | Ga0501033_0374945_256_924 | 210 |
| 529 | 3300049570 | Ga0501033_0504719 | Ga0501033_0504719_91_759 | 210 |
| 530 | 3300049571 | Ga0501034_0000108 | Ga0501034_0000108_73909_74580 | 210 |
| 531 | 3300049571 | Ga0501034_0070423 | Ga0501034_0070423_317_985 | 210 |
| 532 | 3300049571 | Ga0501034_0315696 | Ga0501034_0315696_809_1477 | 210 |
| 533 | 3300049572 | Ga0501036_0000065 | Ga0501036_0000065_62120_62791 | 210 |
| 534 | 3300049573 | Ga0501037_0000507 | Ga0501037_0000507_4612_5283 | 210 |
| 535 | 3300049573 | Ga0501037_0008451 | Ga0501037_0008451_812_1480 | 210 |
| 536 | 3300049573 | Ga0501037_0054997 | Ga0501037_0054997_849_1517 | 210 |
| 537 | 3300049574 | Ga0501038_0006379 | Ga0501038_0006379_1603_2271 | 210 |
| 538 | 3300049574 | Ga0501038_0042047 | Ga0501038_0042047_2996_3664 | 210 |
| 539 | 3300049575 | Ga0501039_0000523 | Ga0501039_0000523_11335_12006 | 210 |
| 540 | 3300049575 | Ga0501039_0042661 | Ga0501039_0042661_271_939 | 210 |
| 541 | 3300049575 | Ga0501039_0056308 | Ga0501039_0056308_1037_1705 | 210 |
| 542 | 3300049579 | Ga0501043_0000226 | Ga0501043_0000226_43370_44041 | 210 |
| 543 | 3300049579 | Ga0501043_0001380 | Ga0501043_0001380_14538_15206 | 210 |
| 544 | 3300049579 | Ga0501043_0252981 | Ga0501043_0252981_417_1085 | 210 |
| 545 | 3300049579 | Ga0501043_0522477 | Ga0501043_0522477_145_813 | 210 |
| 546 | 3300049580 | Ga0501046_0198703 | Ga0501046_0198703_289_957 | 210 |
| 547 | 3300049581 | Ga0501047_0000325 | Ga0501047_0000325_47290_47961 | 210 |
| 548 | 3300049581 | Ga0501047_0014996 | Ga0501047_0014996_1163_1831 | 210 |
| 549 | 3300049581 | Ga0501047_0328062 | Ga0501047_0328062_424_1092 | 210 |
| 550 | 3300049582 | Ga0501048_0000202 | Ga0501048_0000202_22668_23339 | 210 |
| 551 | 3300049583 | Ga0501067_0000193 | Ga0501067_0000193_17164_17835 | 210 |
| 552 | 3300049583 | Ga0501067_0004861 | Ga0501067_0004861_2901_3569 | 210 |
| 553 | 3300049584 | Ga0501068_0025864 | Ga0501068_0025864_2056_2727 | 210 |
| 554 | 3300049584 | Ga0501068_0121956 | Ga0501068_0121956_416_1084 | 210 |
| 555 | 3300049584 | Ga0501068_0170644 | Ga0501068_0170644_79_747 | 210 |
| 556 | 3300049585 | Ga0501069_0001648 | Ga0501069_0001648_7610_8281 | 210 |
| 557 | 3300049586 | Ga0501070_0089234 | Ga0501070_0089234_1035_1703 | 210 |
| 558 | 3300049586 | Ga0501070_0110625 | Ga0501070_0110625_1181_1852 | 210 |
| 559 | 3300049586 | Ga0501070_0467095 | Ga0501070_0467095_174_842 | 210 |
| 560 | 3300049588 | Ga0501072_0001162 | Ga0501072_0001162_3226_3897 | 210 |
| 561 | 3300049588 | Ga0501072_0051653 | Ga0501072_0051653_1098_1766 | 210 |
| 562 | 3300049589 | Ga0501073_0000373 | Ga0501073_0000373_6244_6915 | 210 |
| 563 | 3300049590 | Ga0501074_0000409 | Ga0501074_0000409_1770_2441 | 210 |
| 564 | 3300049592 | Ga0501076_0225551 | Ga0501076_0225551_426_1097 | 210 |
| 565 | 3300049741 | Ga0501079_0016590 | Ga0501079_0016590_2256_2927 | 210 |
| 566 | 3300049741 | Ga0501079_0034431 | Ga0501079_0034431_2527_3195 | 210 |
| 567 | 3300049742 | Ga0501080_0116701 | Ga0501080_0116701_1298_1966 | 210 |
| 568 | 3300049742 | Ga0501080_0591588 | Ga0501080_0591588_60_728 | 210 |
| 569 | 3300049744 | Ga0501083_0000915 | Ga0501083_0000915_7602_8273 | 210 |
| 570 | 3300049744 | Ga0501083_0152777 | Ga0501083_0152777_49_717 | 210 |
| 571 | 3300049822 | Ga0501035_0000079 | Ga0501035_0000079_72691_73362 | 210 |
| 572 | 3300049822 | Ga0501035_0104376 | Ga0501035_0104376_1460_2128 | 210 |
| 573 | 3300049823 | Ga0501044_0000085 | Ga0501044_0000085_47004_47675 | 210 |
| 574 | 3300049824 | Ga0501045_0028832 | Ga0501045_0028832_984_1652 | 210 |
| 575 | 3300049824 | Ga0501045_0283525 | Ga0501045_0283525_107_775 | 210 |
| 576 | 3300054114 | Ga0501084_0048225 | Ga0501084_0048225_2196_2867 | 210 |
| 577 | 3300054114 | Ga0501084_0357871 | Ga0501084_0357871_314_982 | 210 |
| 578 | 3300060353 | Ga0501082_0003006 | Ga0501082_0003006_3363_4034 | 210 |
| 579 | 3300060353 | Ga0501082_0045208 | Ga0501082_0045208_2464_3132 | 210 |
| 580 | 3300005434 | Ga0070709_10000403 | Ga0070709_1000040312 | 211 |
| 581 | 3300005435 | Ga0070714_100006308 | Ga0070714_1000063086 | 211 |
| 582 | 3300005436 | Ga0070713_100023753 | Ga0070713_1000237532 | 211 |
| 583 | 3300005437 | Ga0070710_10002450 | Ga0070710_100024502 | 211 |
| 584 | 3300005439 | Ga0070711_100066299 | Ga0070711_1000662993 | 211 |
| 585 | 3300006173 | Ga0070716_100011253 | Ga0070716_1000112535 | 211 |
| 586 | 3300021377 | Ga0213874_10049892 | Ga0213874_100498922 | 211 |
| 587 | 3300025906 | Ga0207699_10000347 | Ga0207699_1000034711 | 211 |
| 588 | 3300025915 | Ga0207693_10042368 | Ga0207693_100423684 | 211 |
| 589 | 3300025916 | Ga0207663_10085080 | Ga0207663_100850802 | 211 |
| 590 | 3300025928 | Ga0207700_10255501 | Ga0207700_102555011 | 211 |
| 591 | 3300025929 | Ga0207664_10033776 | Ga0207664_100337764 | 211 |
| 592 | 3300025939 | Ga0207665_10005942 | Ga0207665_100059422 | 211 |
| 593 | 3300028381 | Ga0268264_10176646 | Ga0268264_101766462 | 211 |
| 594 | 3300039437 | Ga0436365_0651557 | Ga0436365_0651557_3986_4654 | 211 |
| 595 | 3300039450 | Ga0436363_1116540 | Ga0436363_1116540_329_997 | 211 |
| 596 | 3300046477 | Ga0495664_0253499 | Ga0495664_0253499_324_992 | 211 |
| 597 | 3300046675 | Ga0495657_0263851 | Ga0495657_0263851_291_959 | 211 |
| 598 | 3300046679 | Ga0495623_0077317 | Ga0495623_0077317_1221_1889 | 211 |
| 599 | 3300005983 | Ga0081540_1000078 | Ga0081540_100007859 | 212 |
| 600 | 3300003203 | JGI25406J46586_10000053 | JGI25406J46586_1000005350 | 213 |
| 601 | 3300005985 | Ga0081539_10000471 | Ga0081539_1000047153 | 213 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hb2-assembly1.cif.gz_B | crystal structure of crm1-ran-ranbp1 | 0.5125 | 154 | 189 |
| 2ebh-assembly1.cif.gz_X | crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin | 0.5098 | 142 | 210 |
| 2ebf-assembly1.cif.gz_X | crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin | 0.4997 | 142 | 210 |
| 2ec5-assembly1.cif.gz_A | crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin | 0.497 | 143 | 209 |
| 7eez-assembly1.cif.gz_A | crystal structure of maize shh2 sawadee domain | 0.4756 | 156 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZMS4_259_380_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.5512 | 155 | 205 | 2.30.29.30 |
| af_A0A2R8Q0B2_15_124_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.526 | 154 | 189 | 2.30.29.30 |
| af_Q4CUP5_32_156_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.519 | 148 | 196 | 2.30.29.30 |
| af_Q10MW8_9_177_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.517 | 154 | 206 | 2.30.29.30 |
| af_A0A1D6M2N3_13_163_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.5168 | 154 | 206 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257KSU1-F1-model_v4 | Uncharacterized protein | 0.938 | 33 | 213 |
|
| AF-A0A431MBU3-F1-model_v4 | Uncharacterized protein | 0.9355 | 29 | 213 |
|
| AF-A0A1M6PYZ1-F1-model_v4 | Transglutaminase-like domain-containing protein | 0.9338 | 27 | 213 |
|
| AF-A0A257KSU1-F1-model_v4 | Uncharacterized protein | 0.933 | 33 | 213 |
|
| AF-A0A1M6PYZ1-F1-model_v4 | Transglutaminase-like domain-containing protein | 0.9243 | 27 | 213 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar