F466359

General Info

Members Datasets Scaffolds Average Seq Length
584 318 569 133

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11018146|Ga0157370_110181462
Length 153
Sequence VISNIDTARKECIVNTHQTPATTRGASNTPTATQQAPARSRYSDAALTPPVDVVEDSGGITLYADLPGVSREKLQLNVEADTLTIEAESALPSPEGLQSSHTEVGLARFRRVFTLSKELDTEQVSAEFAQGVLRLRIPKAQHAQPRRVEVKVG

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
3 2643221658 Variovorax sp. Root411 Isolate Unclassified
4 2643221672 Variovorax sp. Root434 Isolate Unclassified
5 2842677519 Variovorax sp. R-72495 Isolate Unclassified
6 2842747753 Variovorax sp. R-72060 Isolate Unclassified
7 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
8 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
9 2904456579 Variovorax sp. 2002 Isolate Unclassified
10 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
11 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
12 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
13 2929520902 Variovorax beijingensis 502 Isolate Unclassified
14 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
15 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
187 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
188 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
189 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
190 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
225 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
240 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
241 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
251 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
291 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
294 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 2.4
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.58
Nodule 0.51
Rhizoplane 2.4
Rhizosphere 76.71
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1045723 3300002987 Unclassified 618
2 JGI25151J46595_10001326 3300003187 Bacteria 17311
3 rootL2_10138106 3300003322 Bacteria 4710
4 rootL2_10189271 3300003322 Bacteria 4674
5 Ga0006562J51391_1181789 3300003578 Bacteria 2375
6 Ga0006562J51391_1181790 3300003578 Bacteria 2100
7 Ga0055537_1000241 3300003773 Bacteria 40227
8 Ga0055524_1000378 3300003775 Bacteria 38772
9 Ga0055536_1000488 3300003781 Bacteria 27544
10 Ga0055536_1006774 3300003781 Bacteria 5246
11 Ga0055536_1008209 3300003781 Bacteria 4530
12 Ga0055534_1000232 3300003784 Bacteria 40227
13 Ga0055534_1000516 3300003784 Bacteria 20853
14 Ga0055528_1000324 3300003790 Bacteria 40031
15 Ga0055528_1028323 3300003790 Bacteria 1548
16 Ga0055530_10005929 3300003791 Bacteria 5632
17 Ga0055540_1000174 3300003792 Bacteria 63200
18 Ga0055540_1001670 3300003792 Bacteria 12843
19 Ga0055531_10000217 3300003794 Bacteria 63200
20 Ga0065165_1157570 3300005262 Unclassified 526
21 Ga0065714_10002707 3300005288 Bacteria 31240
22 Ga0065704_10096167 3300005289 Bacteria 2455
23 Ga0065707_10200321 3300005295 Bacteria 1314
24 Ga0070658_10266738 3300005327 Bacteria 1455
25 Ga0070676_10143556 3300005328 Bacteria 1522
26 Ga0070676_11157617 3300005328 Unclassified 586
27 Ga0070690_100112696 3300005330 Bacteria 1817
28 Ga0070690_101035656 3300005330 Bacteria 648
29 Ga0070670_100000533 3300005331 Bacteria 30477
30 Ga0070670_100005607 3300005331 Bacteria 10592
31 Ga0070670_100027021 3300005331 Bacteria 4937
32 Ga0070670_100040589 3300005331 Bacteria 4000
33 Ga0068869_100000406 3300005334 Bacteria 23468
34 Ga0068869_100736068 3300005334 Bacteria 843
35 Ga0070680_101678104 3300005336 Unclassified 551
36 Ga0070682_100090713 3300005337 Bacteria 1999
37 Ga0068868_100049985 3300005338 Bacteria 3283
38 Ga0070660_100014671 3300005339 Bacteria 5652
39 Ga0070687_100013309 3300005343 Bacteria 3663
40 Ga0070687_100270753 3300005343 Bacteria 1064
41 Ga0070687_100588948 3300005343 Bacteria 762
42 Ga0070661_100007314 3300005344 Bacteria 7616
43 Ga0070661_100514904 3300005344 Bacteria 959
44 Ga0070668_100017834 3300005347 Bacteria 5325
45 Ga0070668_100122893 3300005347 Bacteria 2077
46 Ga0070668_100449778 3300005347 Bacteria 1107
47 Ga0070669_100001456 3300005353 Bacteria 17135
48 Ga0070669_100008569 3300005353 Bacteria 7299
49 Ga0070669_100012132 3300005353 Bacteria 6116
50 Ga0070669_100642606 3300005353 Bacteria 892
51 Ga0070675_100090529 3300005354 Bacteria 2562
52 Ga0070675_100273330 3300005354 Bacteria 1483
53 Ga0070675_101282440 3300005354 Bacteria 675
54 Ga0070675_101380628 3300005354 Bacteria 649
55 Ga0070671_100043399 3300005355 Bacteria 3736
56 Ga0070671_100380539 3300005355 Bacteria 1206
57 Ga0070671_101481368 3300005355 Bacteria 600
58 Ga0070674_100463617 3300005356 Bacteria 1048
59 Ga0070674_100598455 3300005356 Bacteria 931
60 Ga0070673_100042478 3300005364 Bacteria 3506
61 Ga0070673_100061654 3300005364 Bacteria 2976
62 Ga0070673_100182935 3300005364 Bacteria 1795
63 Ga0070688_100202753 3300005365 Bacteria 1389
64 Ga0070688_100599656 3300005365 Bacteria 843
65 Ga0070659_100023938 3300005366 Bacteria 4678
66 Ga0070659_100614658 3300005366 Bacteria 935
67 Ga0070667_100003620 3300005367 Bacteria 13151
68 Ga0070667_100299802 3300005367 Bacteria 1447
69 Ga0070667_100386876 3300005367 Bacteria 1271
70 Ga0070667_100498353 3300005367 Bacteria 1116
71 Ga0070667_100538971 3300005367 Unclassified 1072
72 Ga0070667_101325974 3300005367 Bacteria 674
73 Ga0070713_100189900 3300005436 Bacteria 1850
74 Ga0070710_10074023 3300005437 Bacteria 1971
75 Ga0070701_10499957 3300005438 Unclassified 789
76 Ga0070711_100132902 3300005439 Unclassified 1856
77 Ga0070663_101459400 3300005455 Bacteria 607
78 Ga0070663_101784200 3300005455 Unclassified 551
79 Ga0070678_100078238 3300005456 Bacteria 2498
80 Ga0070678_100353695 3300005456 Bacteria 1264
81 Ga0070678_100605245 3300005456 Unclassified 979
82 Ga0070678_100720898 3300005456 Bacteria 900
83 Ga0070678_101480722 3300005456 Bacteria 635
84 Ga0070678_102118239 3300005456 Bacteria 533
85 Ga0070662_100005367 3300005457 Bacteria 8185
86 Ga0070662_100021484 3300005457 Bacteria 4407
87 Ga0070662_100056358 3300005457 Bacteria 2853
88 Ga0068867_100001139 3300005459 Bacteria 18170
89 Ga0068867_100050990 3300005459 Bacteria 3051
90 Ga0068867_100097127 3300005459 Bacteria 2244
91 Ga0068867_100214525 3300005459 Bacteria 1548
92 Ga0068867_101004027 3300005459 Bacteria 757
93 Ga0070679_100434553 3300005530 Unclassified 1258
94 Ga0068853_100210244 3300005539 Bacteria 1773
95 Ga0070672_100000122 3300005543 Bacteria 40112
96 Ga0070672_100030513 3300005543 Bacteria 4051
97 Ga0070672_100229513 3300005543 Bacteria 1559
98 Ga0070686_100205867 3300005544 Bacteria 1413
99 Ga0070695_101391885 3300005545 Unclassified 581
100 Ga0070696_100026951 3300005546 Bacteria 3912
101 Ga0070693_100560166 3300005547 Bacteria 819
102 Ga0070665_100253106 3300005548 Bacteria 1762
103 Ga0070665_100440486 3300005548 Unclassified 1312
104 Ga0070664_100035103 3300005564 Bacteria 4209
105 Ga0070664_100116728 3300005564 Bacteria 2334
106 Ga0070664_100281049 3300005564 Bacteria 1501
107 Ga0070664_100507554 3300005564 Bacteria 1112
108 Ga0068857_100126615 3300005577 Bacteria 2302
109 Ga0068857_100550082 3300005577 Bacteria 1087
110 Ga0068854_100260546 3300005578 Bacteria 1388
111 Ga0070702_100291566 3300005615 Bacteria 1125
112 Ga0068852_102088355 3300005616 Bacteria 588
113 Ga0068859_100040426 3300005617 Bacteria 4681
114 Ga0068859_100394718 3300005617 Bacteria 1479
115 Ga0068859_100744884 3300005617 Bacteria 1069
116 Ga0068859_100994660 3300005617 Unclassified 921
117 Ga0068864_100002029 3300005618 Bacteria 16706
118 Ga0068864_100004785 3300005618 Bacteria 11095
119 Ga0068864_100079774 3300005618 Bacteria 2867
120 Ga0068864_100084323 3300005618 Bacteria 2792
121 Ga0068864_100690169 3300005618 Bacteria 997
122 Ga0068864_101486276 3300005618 Bacteria 680
123 Ga0068866_10015561 3300005718 Bacteria 3381
124 Ga0068861_100012836 3300005719 Bacteria 5852
125 Ga0068861_100926217 3300005719 Bacteria 827
126 Ga0068851_10316999 3300005834 Bacteria 900
127 Ga0068870_10057499 3300005840 Bacteria 2079
128 Ga0068870_10638615 3300005840 Bacteria 728
129 Ga0068870_11043444 3300005840 Bacteria 585
130 Ga0068863_100003307 3300005841 Bacteria 15912
131 Ga0068863_100004930 3300005841 Bacteria 13156
132 Ga0068863_100029728 3300005841 Bacteria 5217
133 Ga0068863_100053951 3300005841 Bacteria 3809
134 Ga0068863_100073543 3300005841 Bacteria 3234
135 Ga0068863_100270775 3300005841 Unclassified 1644
136 Ga0068863_100309115 3300005841 Bacteria 1534
137 Ga0068863_100329851 3300005841 Bacteria 1483
138 Ga0068863_101053259 3300005841 Bacteria 817
139 Ga0068858_100054415 3300005842 Bacteria 3700
140 Ga0068858_100076543 3300005842 Bacteria 3107
141 Ga0068858_100263234 3300005842 Bacteria 1640
142 Ga0068860_100083518 3300005843 Bacteria 3038
143 Ga0068860_100144703 3300005843 Bacteria 2286
144 Ga0068860_100167807 3300005843 Unclassified 2119
145 Ga0068860_100265386 3300005843 Bacteria 1674
146 Ga0068860_100284706 3300005843 Bacteria 1616
147 Ga0068862_100170718 3300005844 Bacteria 1947
148 Ga0068862_100343501 3300005844 Unclassified 1383
149 Ga0068862_100803332 3300005844 Bacteria 919
150 Ga0068862_100865241 3300005844 Bacteria 887
151 Ga0068862_101025205 3300005844 Bacteria 817
152 Ga0075365_10019767 3300006038 Bacteria 4164
153 Ga0075365_10585502 3300006038 Bacteria 789
154 Ga0075368_10242961 3300006042 Bacteria 768
155 Ga0075363_100017059 3300006048 Bacteria 3595
156 Ga0075363_100134273 3300006048 Bacteria 1390
157 Ga0075363_100634715 3300006048 Bacteria 642
158 Ga0075364_10001534 3300006051 Bacteria 12593
159 Ga0075364_10946292 3300006051 Bacteria 586
160 Ga0075432_10015262 3300006058 Bacteria 2619
161 Ga0075432_10016068 3300006058 Bacteria 2556
162 Ga0075362_10005878 3300006177 Bacteria 4528
163 Ga0075362_10018060 3300006177 Bacteria 2914
164 Ga0075362_10160366 3300006177 Bacteria 1083
165 Ga0075362_10197358 3300006177 Bacteria 979
166 Ga0075362_10632702 3300006177 Bacteria 555
167 Ga0075367_10086305 3300006178 Bacteria 1905
168 Ga0075367_10208094 3300006178 Bacteria 1223
169 Ga0075367_10656534 3300006178 Bacteria 667
170 Ga0075369_10031713 3300006186 Bacteria 2232
171 Ga0075369_10199921 3300006186 Bacteria 922
172 Ga0075366_10008816 3300006195 Bacteria 5618
173 Ga0075366_10146196 3300006195 Bacteria 1430
174 Ga0075366_10391574 3300006195 Bacteria 855
175 Ga0075366_10474018 3300006195 Bacteria 773
176 Ga0097621_100072734 3300006237 Bacteria 2844
177 Ga0097621_100320284 3300006237 Bacteria 1373
178 Ga0075370_10000574 3300006353 Bacteria 14126
179 Ga0075370_10006076 3300006353 Bacteria 6051
180 Ga0075370_10044981 3300006353 Bacteria 2496
181 Ga0068871_100067773 3300006358 Bacteria 2929
182 Ga0068871_100295055 3300006358 Bacteria 1422
183 Ga0068871_100495812 3300006358 Bacteria 1100
184 Ga0068871_100776759 3300006358 Bacteria 882
185 Ga0075431_100974927 3300006847 Bacteria 815
186 Ga0075434_100230568 3300006871 Bacteria 1871
187 Ga0068865_100044739 3300006881 Bacteria 3032
188 Ga0068865_100114582 3300006881 Bacteria 1994
189 Ga0068865_101146802 3300006881 Unclassified 686
190 Ga0097620_100040424 3300006931 Bacteria 4681
191 Ga0097620_100394728 3300006931 Bacteria 1479
192 Ga0097620_100744885 3300006931 Bacteria 1069
193 Ga0097620_100994421 3300006931 Unclassified 921
194 Ga0099826_10007477 3300006948 Bacteria 8062
195 Ga0099826_10081533 3300006948 Bacteria 2013
196 Ga0105251_10075188 3300009011 Bacteria 1569
197 Ga0105244_10000473 3300009036 Bacteria 36586
198 Ga0105240_10752336 3300009093 Bacteria 1059
199 Ga0105245_11622759 3300009098 Bacteria 698
200 Ga0105247_10105670 3300009101 Bacteria 1805
201 Ga0105243_10017643 3300009148 Bacteria 5398
202 Ga0105241_10821638 3300009174 Unclassified 857
203 Ga0105248_10045430 3300009177 Bacteria 4926
204 Ga0105248_10421215 3300009177 Bacteria 1504
205 Ga0105237_10938300 3300009545 Bacteria 872
206 Ga0105238_10166661 3300009551 Bacteria 2179
207 Ga0105249_10938226 3300009553 Bacteria 933
208 Ga0105249_11852762 3300009553 Bacteria 676
209 Ga0105239_10127965 3300010375 Bacteria 2824
210 Ga0105239_10931854 3300010375 Bacteria 997
211 Ga0157373_10044079 3300013100 Bacteria 3185
212 Ga0157370_11018146 3300013104 Bacteria 749
213 Ga0157374_10133865 3300013296 Bacteria 2401
214 Ga0157374_11513265 3300013296 Bacteria 694
215 Ga0157378_10049080 3300013297 Bacteria 3755
216 Ga0157378_10075997 3300013297 Bacteria 3025
217 Ga0157378_11044904 3300013297 Unclassified 852
218 Ga0157378_12609901 3300013297 Bacteria 558
219 Ga0163162_10186921 3300013306 Bacteria 2199
220 Ga0163162_10195652 3300013306 Bacteria 2150
221 Ga0163162_10829743 3300013306 Bacteria 1040
222 Ga0157375_10023821 3300013308 Bacteria 5656
223 Ga0157375_10033632 3300013308 Bacteria 4874
224 Ga0157375_10172419 3300013308 Bacteria 2311
225 Ga0157375_10211196 3300013308 Bacteria 2098
226 Ga0157375_12719727 3300013308 Bacteria 592
227 Ga0163163_10014439 3300014325 Bacteria 7260
228 Ga0163163_10028813 3300014325 Bacteria 5337
229 Ga0163163_11258405 3300014325 Bacteria 802
230 Ga0157380_10032686 3300014326 Bacteria 4005
231 Ga0182008_10000374 3300014497 Bacteria 34622
232 Ga0182008_10000675 3300014497 Bacteria 24682
233 Ga0182008_10002559 3300014497 Bacteria 11328
234 Ga0182008_10019529 3300014497 Bacteria 3497
235 Ga0182008_10048929 3300014497 Bacteria 2099
236 Ga0182008_10113869 3300014497 Bacteria 1341
237 Ga0157379_10000458 3300014968 Bacteria 33058
238 Ga0157379_11539449 3300014968 Bacteria 648
239 Ga0157376_10056473 3300014969 Bacteria 3280
240 Ga0157376_10175160 3300014969 Bacteria 1956
241 Ga0157376_10234995 3300014969 Bacteria 1705
242 Ga0157376_10669715 3300014969 Bacteria 1040
243 Ga0157376_11099282 3300014969 Bacteria 821
244 Ga0182006_1010239 3300015261 Bacteria 4177
245 Ga0182006_1026985 3300015261 Bacteria 2347
246 Ga0182006_1094806 3300015261 Bacteria 1068
247 Ga0182006_1254925 3300015261 Bacteria 576
248 Ga0182007_10000192 3300015262 Bacteria 41119
249 Ga0182007_10000630 3300015262 Bacteria 20540
250 Ga0182007_10085958 3300015262 Bacteria 1033
251 Ga0182005_1032295 3300015265 Bacteria 1425
252 Ga0183362_10002 3300015683 Bacteria 1432711
253 Ga0163161_10019186 3300017792 Bacteria 4795
254 Ga0163161_10084397 3300017792 Bacteria 2342
255 Ga0224712_10062083 3300022467 Bacteria 1492
256 Ga0209565_1000269 3300025263 Bacteria 52870
257 Ga0209565_1016792 3300025263 Bacteria 1620
258 Ga0209673_1000640 3300025273 Bacteria 52870
259 Ga0209673_1004228 3300025273 Bacteria 7816
260 Ga0209130_1001875 3300025284 Bacteria 11986
261 Ga0209675_1000252 3300025291 Bacteria 52870
262 Ga0209675_1001009 3300025291 Bacteria 17677
263 Ga0209675_1011408 3300025291 Bacteria 2948
264 Ga0209676_1000152 3300025292 Bacteria 166700
265 Ga0209676_1001899 3300025292 Bacteria 17035
266 Ga0209676_1075433 3300025292 Bacteria 786
267 Ga0209676_1101651 3300025292 Bacteria 611
268 Ga0209025_1000973 3300025294 Bacteria 42929
269 Ga0209025_1006234 3300025294 Bacteria 9344
270 Ga0209025_1026745 3300025294 Bacteria 2885
271 Ga0209050_1000210 3300025298 Bacteria 129834
272 Ga0209050_1005555 3300025298 Bacteria 7857
273 Ga0209256_1000092 3300025299 Bacteria 210547
274 Ga0209051_1000074 3300025303 Bacteria 208667
275 Ga0209051_1000397 3300025303 Bacteria 60597
276 Ga0209051_1004338 3300025303 Bacteria 8797
277 Ga0209051_1121512 3300025303 Bacteria 662
278 Ga0209257_1000072 3300025304 Bacteria 332791
279 Ga0209257_1012460 3300025304 Bacteria 3924
280 Ga0207697_10105967 3300025315 Bacteria 1201
281 Ga0207655_1003447 3300025728 Bacteria 11763
282 Ga0207688_10495819 3300025901 Bacteria 764
283 Ga0207645_10139830 3300025907 Bacteria 1577
284 Ga0207645_10185669 3300025907 Bacteria 1365
285 Ga0207643_10106404 3300025908 Bacteria 1649
286 Ga0207643_10846655 3300025908 Unclassified 593
287 Ga0207671_10965514 3300025914 Bacteria 672
288 Ga0207662_10484563 3300025918 Bacteria 850
289 Ga0207662_10619647 3300025918 Bacteria 754
290 Ga0207657_10016643 3300025919 Bacteria 7084
291 Ga0207649_10003885 3300025920 Bacteria 8150
292 Ga0207652_10452266 3300025921 Unclassified 1158
293 Ga0207681_10006381 3300025923 Bacteria 7240
294 Ga0207681_10018212 3300025923 Bacteria 4423
295 Ga0207694_10178499 3300025924 Bacteria 1721
296 Ga0207650_10004071 3300025925 Bacteria 9992
297 Ga0207650_10036909 3300025925 Bacteria 3557
298 Ga0207650_10065500 3300025925 Bacteria 2723
299 Ga0207650_10304063 3300025925 Bacteria 1303
300 Ga0207650_11236665 3300025925 Bacteria 636
301 Ga0207659_10408638 3300025926 Bacteria 1137
302 Ga0207659_10680902 3300025926 Bacteria 880
303 Ga0207687_11493552 3300025927 Bacteria 580
304 Ga0207644_10029426 3300025931 Bacteria 3811
305 Ga0207690_10010241 3300025932 Bacteria 5567
306 Ga0207690_10715639 3300025932 Bacteria 824
307 Ga0207706_10012799 3300025933 Bacteria 7634
308 Ga0207686_10846617 3300025934 Bacteria 735
309 Ga0207709_10000793 3300025935 Bacteria 24654
310 Ga0207704_10099725 3300025938 Bacteria 1933
311 Ga0207704_10409435 3300025938 Bacteria 1072
312 Ga0207691_10001269 3300025940 Bacteria 25255
313 Ga0207691_10242089 3300025940 Bacteria 1559
314 Ga0207711_10028427 3300025941 Bacteria 4705
315 Ga0207711_10400307 3300025941 Bacteria 1276
316 Ga0207711_10809168 3300025941 Unclassified 873
317 Ga0207689_10211384 3300025942 Bacteria 1603
318 Ga0207689_10360279 3300025942 Bacteria 1209
319 Ga0207689_10994590 3300025942 Bacteria 707
320 Ga0207679_10002279 3300025945 Bacteria 11836
321 Ga0207679_10388559 3300025945 Bacteria 1225
322 Ga0207679_10814964 3300025945 Bacteria 851
323 Ga0207651_10016089 3300025960 Bacteria 4369
324 Ga0207651_10030527 3300025960 Bacteria 3433
325 Ga0207651_10494912 3300025960 Bacteria 1056
326 Ga0207668_10002175 3300025972 Bacteria 11442
327 Ga0207668_10215271 3300025972 Bacteria 1539
328 Ga0207668_10238781 3300025972 Bacteria 1469
329 Ga0207658_10026500 3300025986 Bacteria 4064
330 Ga0207658_10029174 3300025986 Bacteria 3893
331 Ga0207658_10291038 3300025986 Bacteria 1404
332 Ga0207677_10045500 3300026023 Bacteria 2931
333 Ga0207639_10432561 3300026041 Bacteria 1192
334 Ga0207678_10329572 3300026067 Bacteria 1314
335 Ga0207708_10481969 3300026075 Bacteria 1037
336 Ga0207641_10005203 3300026088 Bacteria 11123
337 Ga0207641_10103199 3300026088 Bacteria 2515
338 Ga0207641_10571363 3300026088 Unclassified 1104
339 Ga0207641_10747187 3300026088 Bacteria 965
340 Ga0207641_10953351 3300026088 Unclassified 853
341 Ga0207641_11029959 3300026088 Bacteria 820
342 Ga0207648_10011353 3300026089 Bacteria 8398
343 Ga0207648_10154622 3300026089 Bacteria 2024
344 Ga0207648_10224129 3300026089 Bacteria 1671
345 Ga0207648_11168374 3300026089 Bacteria 723
346 Ga0207676_10002773 3300026095 Bacteria 12461
347 Ga0207676_10067022 3300026095 Bacteria 2866
348 Ga0207676_10521367 3300026095 Bacteria 1131
349 Ga0207675_101286864 3300026118 Bacteria 752
350 Ga0207675_101667957 3300026118 Bacteria 657
351 Ga0207683_10035169 3300026121 Bacteria 4357
352 Ga0207683_10577310 3300026121 Bacteria 1040
353 Ga0207683_10821804 3300026121 Bacteria 863
354 Ga0207683_10973805 3300026121 Unclassified 788
355 Ga0207698_10930496 3300026142 Bacteria 877
356 Ga0209973_1007964 3300027252 Bacteria 1197
357 Ga0209983_1008978 3300027665 Bacteria 2043
358 Ga0209282_1004503 3300027666 Bacteria 8406
359 Ga0209813_10117890 3300027866 Bacteria 921
360 Ga0207428_10142336 3300027907 Bacteria 1829
361 Ga0268266_10009652 3300028379 Bacteria 8487
362 Ga0268265_10112944 3300028380 Bacteria 2222
363 Ga0268265_10159718 3300028380 Bacteria 1913
364 Ga0268264_10045905 3300028381 Bacteria 3628
365 Ga0268264_10160046 3300028381 Bacteria 2027
366 Ga0268264_10261451 3300028381 Unclassified 1612
367 Ga0268264_10278590 3300028381 Bacteria 1565
368 Ga0268264_11510152 3300028381 Unclassified 682
369 Ga0316177_1064101 3300030731 Bacteria 1286
370 Ga0316176_1095815 3300030732 Bacteria 7945
371 Ga0314311_1187413 3300030733 Bacteria 4069
372 Ga0316179_1108004 3300030734 Bacteria 2296
373 Ga0316178_1073154 3300030735 Bacteria 8992
374 Ga0316180_1106339 3300030736 Bacteria 1394
375 Ga0316183_1037632 3300030742 Bacteria 7342
376 Ga0316183_1071558 3300030742 Bacteria 4635
377 Ga0316181_1032171 3300030744 Bacteria 4225
378 Ga0316181_1196510 3300030744 Bacteria 863
379 Ga0316182_1397043 3300030745 Bacteria 3744
380 Ga0265332_10009346 3300031238 Bacteria 4379
381 Ga0307513_10292932 3300031456 Bacteria 1398
382 Ga0307408_100006090 3300031548 Bacteria 8020
383 Ga0307408_100237352 3300031548 Bacteria 1496
384 Ga0307408_100299510 3300031548 Bacteria 1346
385 Ga0307408_101357582 3300031548 Bacteria 668
386 Ga0265313_10066529 3300031595 Bacteria 1670
387 Ga0307514_10002271 3300031649 Bacteria 20395
388 Ga0307514_10030669 3300031649 Bacteria 4315
389 Ga0316575_10156966 3300031665 Bacteria 940
390 Ga0316579_10000031 3300031691 Bacteria 32051
391 Ga0316579_10022550 3300031691 Unclassified 2816
392 Ga0316578_10009234 3300031728 Bacteria 5063
393 Ga0307516_10000497 3300031730 Bacteria 52295
394 Ga0307405_10185802 3300031731 Bacteria 1496
395 Ga0307405_10402858 3300031731 Bacteria 1071
396 Ga0307405_10581436 3300031731 Bacteria 911
397 Ga0307405_10608725 3300031731 Bacteria 892
398 Ga0307405_11156511 3300031731 Bacteria 667
399 Ga0316577_10050834 3300031733 Bacteria 2314
400 Ga0307413_10256059 3300031824 Bacteria 1302
401 Ga0307406_10017287 3300031901 Bacteria 4199
402 Ga0307406_10145519 3300031901 Bacteria 1683
403 Ga0307407_10123187 3300031903 Bacteria 1647
404 Ga0307412_10099584 3300031911 Bacteria 2053
405 Ga0307412_10215434 3300031911 Bacteria 1468
406 Ga0307412_10296651 3300031911 Bacteria 1276
407 Ga0307412_10444558 3300031911 Bacteria 1066
408 Ga0307412_11556679 3300031911 Bacteria 602
409 Ga0307412_11780004 3300031911 Bacteria 566
410 Ga0307412_12048322 3300031911 Bacteria 530
411 Ga0307409_100290249 3300031995 Bacteria 1517
412 Ga0307416_100215494 3300032002 Bacteria 1836
413 Ga0307416_101811752 3300032002 Bacteria 714
414 Ga0307414_10482449 3300032004 Bacteria 1093
415 Ga0307414_10715744 3300032004 Bacteria 907
416 Ga0307414_11276756 3300032004 Bacteria 681
417 Ga0307411_10279208 3300032005 Bacteria 1328
418 Ga0307411_10559543 3300032005 Bacteria 977
419 Ga0307411_10598671 3300032005 Bacteria 947
420 Ga0307415_100226450 3300032126 Bacteria 1503
421 Ga0316583_10009548 3300032133 Bacteria 3494
422 Ga0316583_10034495 3300032133 Bacteria 1795
423 Ga0316583_10281273 3300032133 Unclassified 576
424 Ga0316593_10026821 3300032168 Bacteria 1844
425 Ga0316593_10028851 3300032168 Bacteria 1791
426 Ga0316593_10047561 3300032168 Bacteria 1443
427 Ga0316593_10124615 3300032168 Unclassified 927
428 Ga0316574_0056355 3300035398 Bacteria 2459
429 Ga0316582_0002941 3300036647 Bacteria 8195
430 Ga0316582_0092144 3300036647 Bacteria 1996
431 Ga0316584_0023830 3300036712 Bacteria 4472
432 Ga0316584_0413979 3300036712 Bacteria 958
433 Ga0395899_0219850 3300037312 Bacteria 1316
434 Ga0395899_0228049 3300037312 Bacteria 1287
435 Ga0395900_0023607 3300037418 Bacteria 6292
436 Ga0395905_0000455 3300037471 Bacteria 57161
437 Ga0395905_0014027 3300037471 Bacteria 7662
438 Ga0395905_0029176 3300037471 Bacteria 5199
439 Ga0316581_0010445 3300037588 Bacteria 2574
440 Ga0395901_0605522 3300038443 Bacteria 1104
441 Ga0439436_0103098 3300041404 Bacteria 795
442 Ga0439461_0025782 3300041410 Bacteria 1196
443 Ga0439466_0025115 3300041411 Bacteria 2082
444 Ga0439465_0050740 3300041413 Bacteria 1358
445 Ga0439465_0071484 3300041413 Bacteria 1163
446 Ga0451791_0231617 3300041451 Bacteria 945
447 Ga0451793_1676247 3300041452 Bacteria 898
448 Ga0451797_0485924 3300041453 Bacteria 742
449 Ga0451795_1550194 3300041456 Bacteria 793
450 Ga0451802_0805532 3300041460 Bacteria 1132
451 Ga0451802_1837356 3300041460 Bacteria 576
452 Ga0451807_0023713 3300041486 Bacteria 3638
453 Ga0451843_0193779 3300041509 Bacteria 569
454 Ga0439431_0149367 3300041997 Bacteria 663
455 Ga0439437_038609 3300042000 Bacteria 615
456 Ga0439442_024383 3300042002 Bacteria 1258
457 Ga0439445_0073181 3300042004 Bacteria 950
458 Ga0450919_006111 3300042121 Bacteria 1431
459 Ga0450923_011732 3300042125 Bacteria 1582
460 Ga0450890_039348 3300042127 Bacteria 695
461 Ga0450894_006032 3300042131 Bacteria 1567
462 Ga0450896_063960 3300042133 Bacteria 602
463 Ga0450906_003616 3300042145 Bacteria 3302
464 Ga0450910_003638 3300042147 Bacteria 2053
465 Ga0439446_0010182 3300042156 Bacteria 2530
466 Ga0439446_0026896 3300042156 Bacteria 1650
467 Ga0439446_0084780 3300042156 Bacteria 985
468 Ga0450908_030040 3300042184 Bacteria 944
469 Ga0439434_0001996 3300042435 Bacteria 5901
470 Ga0439434_0107969 3300042435 Bacteria 900
471 Ga0439444_0197363 3300042437 Bacteria 506
472 Ga0450918_000965 3300042531 Bacteria 5995
473 Ga0450893_0017575 3300042532 Bacteria 1215
474 Ga0450893_0136812 3300042532 Bacteria 520
475 Ga0451577_0121026 3300042876 Bacteria 2344
476 Ga0451577_1039927 3300042876 Bacteria 734
477 Ga0466969_0052549 3300044656 Bacteria 2002
478 Ga0466972_0000073 3300044658 Bacteria 96438
479 Ga0466972_0321334 3300044658 Bacteria 723
480 Ga0453683_0389715 3300044673 Unclassified 897
481 Ga0466965_0025588 3300044683 Bacteria 2857
482 Ga0466966_0090907 3300044684 Bacteria 1895
483 Ga0466961_0239704 3300044693 Bacteria 1115
484 Ga0466961_0455503 3300044693 Bacteria 774
485 Ga0466964_0043257 3300044706 Bacteria 1826
486 Ga0453684_0000163 3300044712 Bacteria 296196
487 Ga0453684_0031445 3300044712 Bacteria 7460
488 Ga0466971_0031657 3300044719 Bacteria 2369
489 Ga0466960_0075337 3300044901 Bacteria 1688
490 Ga0466959_0037184 3300045049 Bacteria 3597
491 Ga0466959_0100718 3300045049 Bacteria 2068
492 Ga0451576_0010764 3300045051 Bacteria 10469
493 Ga0451576_0101670 3300045051 Bacteria 2989
494 Ga0451576_0483065 3300045051 Bacteria 1301
495 Ga0495650_0017971 3300046471 Bacteria 3529
496 Ga0495643_0026684 3300046522 Bacteria 3255
497 Ga0495642_0008464 3300046528 Bacteria 3936
498 Ga0495654_0154246 3300046530 Bacteria 1013
499 Ga0495597_0083934 3300046542 Bacteria 1359
500 Ga0495625_0000012 3300046660 Bacteria 363006
501 Ga0495687_017881 3300047443 Bacteria 3520
502 Ga0495687_034200 3300047443 Bacteria 2298
503 Ga0496102_0165509 3300048905 Bacteria 2081
504 Ga0496103_0283746 3300048906 Bacteria 1065
505 Ga0496112_0073060 3300048915 Bacteria 3391
506 Ga0496113_1050740 3300048916 Bacteria 640
507 Ga0496113_1448588 3300048916 Bacteria 531
508 Ga0496114_0001657 3300048917 Bacteria 16887
509 Ga0496114_1500718 3300048917 Bacteria 562
510 Ga0496116_0014631 3300048919 Bacteria 6253
511 Ga0496117_0022808 3300048920 Bacteria 5013
512 Ga0496118_0006217 3300048921 Bacteria 13211
513 Ga0496121_0002968 3300048924 Bacteria 24705
514 Ga0496121_0249340 3300048924 Bacteria 1232
515 Ga0496122_0000039 3300048925 Bacteria 295352
516 Ga0496123_0000026 3300048926 Bacteria 318040
517 Ga0496124_0032772 3300048927 Bacteria 4582
518 Ga0496124_0306117 3300048927 Bacteria 1145
519 Ga0496125_0058334 3300048928 Bacteria 3119
520 Ga0496125_0114347 3300048928 Bacteria 1944
521 Ga0501037_0649407 3300049573 Unclassified 705
522 Ga0501038_0202790 3300049574 Bacteria 1591
523 Ga0501039_0359806 3300049575 Bacteria 1143
524 Ga0501043_0465413 3300049579 Unclassified 948
525 Ga0501046_0757373 3300049580 Bacteria 682
526 Ga0501249_001839 3300049679 Bacteria 4321
527 Ga0501221_038092 3300049704 Bacteria 1038
528 Ga0501225_0009489 3300049705 Bacteria 2768
529 Ga0501262_000042 3300049759 Bacteria 16776
530 Ga0501269_006202 3300049766 Bacteria 1440
531 Ga0501035_0019463 3300049822 Bacteria 6242
532 Ga0501044_0020301 3300049823 Bacteria 7091
533 nmdc:mga03683_150667_c1 3300050489 Bacteria 1049
534 nmdc:mga03683_229473_c1 3300050489 Bacteria 858
535 nmdc:mga03683_270092_c1 3300050489 Bacteria 793
536 nmdc:mga03683_348860_c1 3300050489 Bacteria 700
537 nmdc:mga03683_667476_c1 3300050489 Bacteria 513
538 nmdc:mga03n38_198939_c1 3300050490 Bacteria 1036
539 nmdc:mga03n38_54842_c1 3300050490 Bacteria 1793
540 nmdc:mga00v17_5334_c1 3300050491 Bacteria 6771
541 nmdc:mga0yw44_251023_c1 3300050492 Bacteria 1177
542 nmdc:mga0yw44_86079_c1 3300050492 Bacteria 1979
543 nmdc:mga0k408_302159_c1 3300050493 Bacteria 955
544 nmdc:mga0k408_34685_c1 3300050493 Bacteria 770
545 nmdc:mga0k408_418613_c1 3300050493 Bacteria 797
546 nmdc:mga06z11_143642_c1 3300050494 Bacteria 1351
547 nmdc:mga04h51_138621_c1 3300050495 Bacteria 921
548 nmdc:mga07m45_145905_c1 3300050496 Bacteria 1372
549 nmdc:mga07m45_154243_c1 3300050496 Bacteria 1332
550 nmdc:mga07m45_159_c1 3300050496 Bacteria 27066
551 nmdc:mga07m45_88067_c1 3300050496 Bacteria 1777
552 nmdc:mga0n895_229076_c1 3300050512 Bacteria 1886
553 nmdc:mga0sz30_81306_c1 3300050516 Bacteria 1402
554 Ga0500646_0065757 3300053090 Bacteria 1077
555 Ga0500658_0489332 3300053134 Bacteria 558
556 Ga0500616_0068248 3300053153 Bacteria 1822
557 Ga0500616_0191940 3300053153 Bacteria 911
558 Ga0500627_0225180 3300053158 Bacteria 836
559 Ga0590071_011503 3300059421 Bacteria 2070
560 Ga0590075_048819 3300059424 Bacteria 1085
561 Ga0587077_009298 3300059493 Bacteria 1488
562 Ga0587082_080726 3300059504 Bacteria 677
563 Ga0587090_006132 3300059510 Bacteria 1533
564 Ga0587090_010198 3300059510 Bacteria 1299
565 Ga0587128_007279 3300059630 Bacteria 1392
566 Ga0587128_012315 3300059630 Bacteria 1186
567 Ga0587075_007701 3300059644 Bacteria 1359
568 Ga0466962_0062261 3300061719 Bacteria 1781
569 Ga0466962_0183128 3300061719 Bacteria 1021

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300022467 Ga0224712_10062083 Ga0224712_100620832 117
2 3300030731 Ga0316177_1064101 Ga0316177_10641012 118
3 3300030742 Ga0316183_1071558 Ga0316183_10715585 118
4 3300030744 Ga0316181_1196510 Ga0316181_11965101 118
5 3300005330 Ga0070690_100112696 Ga0070690_1001126962 119
6 3300005331 Ga0070670_100000533 Ga0070670_10000053318 119
7 3300005334 Ga0068869_100000406 Ga0068869_10000040611 119
8 3300005338 Ga0068868_100049985 Ga0068868_1000499852 119
9 3300005343 Ga0070687_100013309 Ga0070687_1000133094 119
10 3300005353 Ga0070669_100008569 Ga0070669_1000085696 119
11 3300005354 Ga0070675_100273330 Ga0070675_1002733303 119
12 3300005355 Ga0070671_100380539 Ga0070671_1003805392 119
13 3300005356 Ga0070674_100598455 Ga0070674_1005984551 119
14 3300005364 Ga0070673_100061654 Ga0070673_1000616544 119
15 3300005367 Ga0070667_100003620 Ga0070667_10000362012 119
16 3300005438 Ga0070701_10499957 Ga0070701_104999572 119
17 3300005455 Ga0070663_101784200 Ga0070663_1017842001 119
18 3300005456 Ga0070678_101480722 Ga0070678_1014807221 119
19 3300005457 Ga0070662_100056358 Ga0070662_1000563583 119
20 3300005459 Ga0068867_100001139 Ga0068867_1000011394 119
21 3300005543 Ga0070672_100030513 Ga0070672_1000305133 119
22 3300005545 Ga0070695_101391885 Ga0070695_1013918851 119
23 3300005564 Ga0070664_100116728 Ga0070664_1001167283 119
24 3300005577 Ga0068857_100126615 Ga0068857_1001266153 119
25 3300005617 Ga0068859_100040426 Ga0068859_1000404266 119
26 3300005618 Ga0068864_100004785 Ga0068864_10000478512 119
27 3300005719 Ga0068861_100012836 Ga0068861_1000128365 119
28 3300005834 Ga0068851_10316999 Ga0068851_103169992 119
29 3300005840 Ga0068870_10057499 Ga0068870_100574992 119
30 3300005841 Ga0068863_100003307 Ga0068863_10000330713 119
31 3300005842 Ga0068858_100054415 Ga0068858_1000544154 119
32 3300005843 Ga0068860_100265386 Ga0068860_1002653863 119
33 3300006358 Ga0068871_100495812 Ga0068871_1004958122 119
34 3300006881 Ga0068865_100114582 Ga0068865_1001145822 119
35 3300006931 Ga0097620_100040424 Ga0097620_1000404246 119
36 3300009101 Ga0105247_10105670 Ga0105247_101056703 119
37 3300009174 Ga0105241_10821638 Ga0105241_108216381 119
38 3300009177 Ga0105248_10045430 Ga0105248_100454304 119
39 3300010375 Ga0105239_10931854 Ga0105239_109318542 119
40 3300013297 Ga0157378_10049080 Ga0157378_100490804 119
41 3300013306 Ga0163162_10186921 Ga0163162_101869213 119
42 3300013308 Ga0157375_10033632 Ga0157375_100336325 119
43 3300014968 Ga0157379_10000458 Ga0157379_1000045811 119
44 3300014969 Ga0157376_10234995 Ga0157376_102349953 119
45 3300003322 rootL2_10189271 rootL2_101892713 121
46 3300005367 Ga0070667_100538971 Ga0070667_1005389712 121
47 3300005456 Ga0070678_100605245 Ga0070678_1006052452 121
48 3300005841 Ga0068863_100270775 Ga0068863_1002707752 121
49 3300006871 Ga0075434_100230568 Ga0075434_1002305683 121
50 3300009011 Ga0105251_10075188 Ga0105251_100751883 121
51 3300013296 Ga0157374_10133865 Ga0157374_101338652 121
52 3300013308 Ga0157375_12719727 Ga0157375_127197272 121
53 3300014325 Ga0163163_10014439 Ga0163163_100144397 121
54 3300014325 Ga0163163_10028813 Ga0163163_100288134 121
55 3300025941 Ga0207711_10809168 Ga0207711_108091682 121
56 3300025945 Ga0207679_10388559 Ga0207679_103885592 121
57 3300025986 Ga0207658_10026500 Ga0207658_100265003 121
58 3300026088 Ga0207641_10571363 Ga0207641_105713632 121
59 3300026121 Ga0207683_10973805 Ga0207683_109738052 121
60 3300028381 Ga0268264_10261451 Ga0268264_102614513 121
61 3300050512 nmdc:mga0n895_229076_c1 nmdc:mga0n895_229076_c1_1074_1487 121
62 3300005459 Ga0068867_100214525 Ga0068867_1002145253 122
63 3300006847 Ga0075431_100974927 Ga0075431_1009749272 122
64 3300026089 Ga0207648_10224129 Ga0207648_102241293 122
65 3300032133 Ga0316583_10281273 Ga0316583_102812731 122
66 3300044656 Ga0466969_0052549 Ga0466969_0052549_181_555 122
67 3300044683 Ga0466965_0025588 Ga0466965_0025588_1200_1574 122
68 3300044684 Ga0466966_0090907 Ga0466966_0090907_1260_1634 122
69 3300044693 Ga0466961_0239704 Ga0466961_0239704_489_863 122
70 3300045049 Ga0466959_0100718 Ga0466959_0100718_1208_1582 122
71 3300049580 Ga0501046_0757373 Ga0501046_0757373_11_397 122
72 3300059504 Ga0587082_080726 Ga0587082_080726_279_662 122
73 3300059510 Ga0587090_010198 Ga0587090_010198_569_952 122
74 3300059630 Ga0587128_012315 Ga0587128_012315_497_880 122
75 3300059644 Ga0587075_007701 Ga0587075_007701_495_878 122
76 3300061719 Ga0466962_0062261 Ga0466962_0062261_954_1328 122
77 3300005328 Ga0070676_11157617 Ga0070676_111576171 123
78 3300005330 Ga0070690_101035656 Ga0070690_1010356562 123
79 3300005354 Ga0070675_101380628 Ga0070675_1013806282 123
80 3300005365 Ga0070688_100202753 Ga0070688_1002027532 123
81 3300005367 Ga0070667_100386876 Ga0070667_1003868763 123
82 3300005456 Ga0070678_100353695 Ga0070678_1003536952 123
83 3300005459 Ga0068867_100050990 Ga0068867_1000509902 123
84 3300005544 Ga0070686_100205867 Ga0070686_1002058672 123
85 3300005615 Ga0070702_100291566 Ga0070702_1002915662 123
86 3300005617 Ga0068859_100994660 Ga0068859_1009946602 123
87 3300005618 Ga0068864_100690169 Ga0068864_1006901692 123
88 3300005718 Ga0068866_10015561 Ga0068866_100155611 123
89 3300005841 Ga0068863_100053951 Ga0068863_1000539512 123
90 3300005841 Ga0068863_100329851 Ga0068863_1003298512 123
91 3300005841 Ga0068863_101053259 Ga0068863_1010532592 123
92 3300005842 Ga0068858_100076543 Ga0068858_1000765432 123
93 3300005842 Ga0068858_100263234 Ga0068858_1002632342 123
94 3300005843 Ga0068860_100144703 Ga0068860_1001447032 123
95 3300005843 Ga0068860_100167807 Ga0068860_1001678073 123
96 3300005844 Ga0068862_100343501 Ga0068862_1003435012 123
97 3300006237 Ga0097621_100072734 Ga0097621_1000727342 123
98 3300006358 Ga0068871_100776759 Ga0068871_1007767592 123
99 3300006881 Ga0068865_101146802 Ga0068865_1011468022 123
100 3300006931 Ga0097620_100994421 Ga0097620_1009944212 123
101 3300009553 Ga0105249_10938226 Ga0105249_109382262 123
102 3300013297 Ga0157378_10075997 Ga0157378_100759975 123
103 3300013308 Ga0157375_10023821 Ga0157375_100238215 123
104 3300014326 Ga0157380_10032686 Ga0157380_100326862 123
105 3300014969 Ga0157376_11099282 Ga0157376_110992822 123
106 3300025938 Ga0207704_10409435 Ga0207704_104094352 123
107 3300025986 Ga0207658_10291038 Ga0207658_102910383 123
108 3300026041 Ga0207639_10432561 Ga0207639_104325613 123
109 3300026088 Ga0207641_10747187 Ga0207641_107471872 123
110 3300026088 Ga0207641_10953351 Ga0207641_109533512 123
111 3300026089 Ga0207648_10011353 Ga0207648_1001135310 123
112 3300026121 Ga0207683_10821804 Ga0207683_108218042 123
113 3300028381 Ga0268264_10045905 Ga0268264_100459052 123
114 3300028381 Ga0268264_11510152 Ga0268264_115101522 123
115 3300044658 Ga0466972_0000073 Ga0466972_0000073_25542_25919 123
116 3300048917 Ga0496114_1500718 Ga0496114_1500718_175_552 123
117 iso_pu_bacteria 2881927736 2881930594 123
118 3300005295 Ga0065707_10200321 Ga0065707_102003213 124
119 3300005331 Ga0070670_100027021 Ga0070670_1000270217 124
120 3300005331 Ga0070670_100040589 Ga0070670_1000405893 124
121 3300005336 Ga0070680_101678104 Ga0070680_1016781041 124
122 3300005343 Ga0070687_100588948 Ga0070687_1005889482 124
123 3300005344 Ga0070661_100514904 Ga0070661_1005149042 124
124 3300005347 Ga0070668_100017834 Ga0070668_1000178343 124
125 3300005353 Ga0070669_100012132 Ga0070669_1000121323 124
126 3300005354 Ga0070675_100090529 Ga0070675_1000905293 124
127 3300005355 Ga0070671_100043399 Ga0070671_1000433993 124
128 3300005356 Ga0070674_100463617 Ga0070674_1004636172 124
129 3300005364 Ga0070673_100042478 Ga0070673_1000424782 124
130 3300005364 Ga0070673_100182935 Ga0070673_1001829353 124
131 3300005367 Ga0070667_100299802 Ga0070667_1002998021 124
132 3300005367 Ga0070667_100498353 Ga0070667_1004983531 124
133 3300005436 Ga0070713_100189900 Ga0070713_1001899001 124
134 3300005437 Ga0070710_10074023 Ga0070710_100740231 124
135 3300005439 Ga0070711_100132902 Ga0070711_1001329022 124
136 3300005456 Ga0070678_100720898 Ga0070678_1007208982 124
137 3300005457 Ga0070662_100021484 Ga0070662_1000214841 124
138 3300005459 Ga0068867_101004027 Ga0068867_1010040271 124
139 3300005530 Ga0070679_100434553 Ga0070679_1004345532 124
140 3300005543 Ga0070672_100000122 Ga0070672_1000001225 124
141 3300005543 Ga0070672_100229513 Ga0070672_1002295133 124
142 3300005546 Ga0070696_100026951 Ga0070696_1000269513 124
143 3300005548 Ga0070665_100253106 Ga0070665_1002531062 124
144 3300005564 Ga0070664_100507554 Ga0070664_1005075542 124
145 3300005617 Ga0068859_100744884 Ga0068859_1007448842 124
146 3300005618 Ga0068864_100084323 Ga0068864_1000843233 124
147 3300005840 Ga0068870_10638615 Ga0068870_106386152 124
148 3300005840 Ga0068870_11043444 Ga0068870_110434442 124
149 3300005841 Ga0068863_100029728 Ga0068863_1000297284 124
150 3300005841 Ga0068863_100073543 Ga0068863_1000735432 124
151 3300005841 Ga0068863_100309115 Ga0068863_1003091152 124
152 3300005843 Ga0068860_100083518 Ga0068860_1000835182 124
153 3300005844 Ga0068862_100170718 Ga0068862_1001707182 124
154 3300005844 Ga0068862_100803332 Ga0068862_1008033322 124
155 3300005844 Ga0068862_101025205 Ga0068862_1010252052 124
156 3300006177 Ga0075362_10197358 Ga0075362_101973582 124
157 3300006358 Ga0068871_100295055 Ga0068871_1002950552 124
158 3300006881 Ga0068865_100044739 Ga0068865_1000447393 124
159 3300006931 Ga0097620_100744885 Ga0097620_1007448852 124
160 3300009093 Ga0105240_10752336 Ga0105240_107523362 124
161 3300009177 Ga0105248_10421215 Ga0105248_104212152 124
162 3300010375 Ga0105239_10127965 Ga0105239_101279655 124
163 3300013297 Ga0157378_12609901 Ga0157378_126099012 124
164 3300013306 Ga0163162_10829743 Ga0163162_108297432 124
165 3300013308 Ga0157375_10172419 Ga0157375_101724192 124
166 3300013308 Ga0157375_10211196 Ga0157375_102111964 124
167 3300014325 Ga0163163_11258405 Ga0163163_112584052 124
168 3300014968 Ga0157379_11539449 Ga0157379_115394491 124
169 3300014969 Ga0157376_10175160 Ga0157376_101751603 124
170 3300014969 Ga0157376_10669715 Ga0157376_106697151 124
171 3300017792 Ga0163161_10084397 Ga0163161_100843972 124
172 3300025315 Ga0207697_10105967 Ga0207697_101059672 124
173 3300025907 Ga0207645_10185669 Ga0207645_101856692 124
174 3300025908 Ga0207643_10106404 Ga0207643_101064043 124
175 3300025908 Ga0207643_10846655 Ga0207643_108466552 124
176 3300025918 Ga0207662_10484563 Ga0207662_104845632 124
177 3300025921 Ga0207652_10452266 Ga0207652_104522662 124
178 3300025923 Ga0207681_10018212 Ga0207681_100182123 124
179 3300025925 Ga0207650_10036909 Ga0207650_100369092 124
180 3300025925 Ga0207650_10065500 Ga0207650_100655002 124
181 3300025925 Ga0207650_10304063 Ga0207650_103040632 124
182 3300025926 Ga0207659_10408638 Ga0207659_104086382 124
183 3300025931 Ga0207644_10029426 Ga0207644_100294262 124
184 3300025938 Ga0207704_10099725 Ga0207704_100997251 124
185 3300025940 Ga0207691_10001269 Ga0207691_100012696 124
186 3300025940 Ga0207691_10242089 Ga0207691_102420892 124
187 3300025941 Ga0207711_10028427 Ga0207711_100284273 124
188 3300025941 Ga0207711_10400307 Ga0207711_104003072 124
189 3300025942 Ga0207689_10211384 Ga0207689_102113842 124
190 3300025945 Ga0207679_10814964 Ga0207679_108149642 124
191 3300025960 Ga0207651_10016089 Ga0207651_100160894 124
192 3300025960 Ga0207651_10030527 Ga0207651_100305272 124
193 3300025972 Ga0207668_10002175 Ga0207668_100021754 124
194 3300025972 Ga0207668_10215271 Ga0207668_102152712 124
195 3300025986 Ga0207658_10029174 Ga0207658_100291743 124
196 3300026023 Ga0207677_10045500 Ga0207677_100455002 124
197 3300026075 Ga0207708_10481969 Ga0207708_104819692 124
198 3300026088 Ga0207641_10103199 Ga0207641_101031993 124
199 3300026088 Ga0207641_11029959 Ga0207641_110299591 124
200 3300026089 Ga0207648_11168374 Ga0207648_111683741 124
201 3300026095 Ga0207676_10067022 Ga0207676_100670222 124
202 3300026118 Ga0207675_101667957 Ga0207675_1016679571 124
203 3300026121 Ga0207683_10577310 Ga0207683_105773102 124
204 3300028380 Ga0268265_10112944 Ga0268265_101129442 124
205 3300028380 Ga0268265_10159718 Ga0268265_101597182 124
206 3300028381 Ga0268264_10160046 Ga0268264_101600462 124
207 3300031238 Ga0265332_10009346 Ga0265332_100093464 124
208 3300031595 Ga0265313_10066529 Ga0265313_100665292 124
209 3300031665 Ga0316575_10156966 Ga0316575_101569662 124
210 3300031691 Ga0316579_10000031 Ga0316579_100000313 124
211 3300031691 Ga0316579_10022550 Ga0316579_100225504 124
212 3300031728 Ga0316578_10009234 Ga0316578_100092342 124
213 3300031730 Ga0307516_10000497 Ga0307516_1000049740 124
214 3300031733 Ga0316577_10050834 Ga0316577_100508344 124
215 3300032133 Ga0316583_10009548 Ga0316583_100095484 124
216 3300032133 Ga0316583_10034495 Ga0316583_100344952 124
217 3300032168 Ga0316593_10026821 Ga0316593_100268213 124
218 3300032168 Ga0316593_10028851 Ga0316593_100288512 124
219 3300032168 Ga0316593_10047561 Ga0316593_100475612 124
220 3300035398 Ga0316574_0056355 Ga0316574_0056355_789_1169 124
221 3300036647 Ga0316582_0002941 Ga0316582_0002941_6510_6893 124
222 3300036647 Ga0316582_0092144 Ga0316582_0092144_882_1265 124
223 3300036712 Ga0316584_0023830 Ga0316584_0023830_3238_3621 124
224 3300036712 Ga0316584_0413979 Ga0316584_0413979_303_686 124
225 3300037312 Ga0395899_0219850 Ga0395899_0219850_167_550 124
226 3300037312 Ga0395899_0228049 Ga0395899_0228049_132_515 124
227 3300037418 Ga0395900_0023607 Ga0395900_0023607_3712_4095 124
228 3300037471 Ga0395905_0014027 Ga0395905_0014027_3845_4228 124
229 3300037588 Ga0316581_0010445 Ga0316581_0010445_777_1160 124
230 3300038443 Ga0395901_0605522 Ga0395901_0605522_593_976 124
231 3300041460 Ga0451802_0805532 Ga0451802_0805532_681_1061 124
232 3300041486 Ga0451807_0023713 Ga0451807_0023713_285_665 124
233 3300041509 Ga0451843_0193779 Ga0451843_0193779_68_448 124
234 3300042437 Ga0439444_0197363 Ga0439444_0197363_47_427 124
235 3300042876 Ga0451577_0121026 Ga0451577_0121026_1902_2282 124
236 3300042876 Ga0451577_1039927 Ga0451577_1039927_338_718 124
237 3300044673 Ga0453683_0389715 Ga0453683_0389715_306_686 124
238 3300044712 Ga0453684_0000163 Ga0453684_0000163_30421_30801 124
239 3300044712 Ga0453684_0031445 Ga0453684_0031445_457_837 124
240 3300045051 Ga0451576_0010764 Ga0451576_0010764_2463_2843 124
241 3300045051 Ga0451576_0101670 Ga0451576_0101670_721_1101 124
242 3300045051 Ga0451576_0483065 Ga0451576_0483065_623_1006 124
243 3300046528 Ga0495642_0008464 Ga0495642_0008464_481_936 124
244 3300049575 Ga0501039_0359806 Ga0501039_0359806_628_1008 124
245 3300050489 nmdc:mga03683_229473_c1 nmdc:mga03683_229473_c1_159_539 124
246 3300050489 nmdc:mga03683_270092_c1 nmdc:mga03683_270092_c1_56_445 124
247 3300053134 Ga0500658_0489332 Ga0500658_0489332_112_492 124
248 3300053158 Ga0500627_0225180 Ga0500627_0225180_409_807 124
249 3300005331 Ga0070670_100005607 Ga0070670_1000056075 125
250 3300005337 Ga0070682_100090713 Ga0070682_1000907132 125
251 3300005339 Ga0070660_100014671 Ga0070660_1000146718 125
252 3300005343 Ga0070687_100270753 Ga0070687_1002707531 125
253 3300005344 Ga0070661_100007314 Ga0070661_1000073146 125
254 3300005347 Ga0070668_100122893 Ga0070668_1001228932 125
255 3300005353 Ga0070669_100642606 Ga0070669_1006426061 125
256 3300005354 Ga0070675_101282440 Ga0070675_1012824401 125
257 3300005365 Ga0070688_100599656 Ga0070688_1005996562 125
258 3300005366 Ga0070659_100023938 Ga0070659_1000239386 125
259 3300005367 Ga0070667_101325974 Ga0070667_1013259741 125
260 3300005455 Ga0070663_101459400 Ga0070663_1014594002 125
261 3300005456 Ga0070678_102118239 Ga0070678_1021182391 125
262 3300005548 Ga0070665_100440486 Ga0070665_1004404861 125
263 3300005564 Ga0070664_100035103 Ga0070664_1000351032 125
264 3300005564 Ga0070664_100281049 Ga0070664_1002810493 125
265 3300005617 Ga0068859_100394718 Ga0068859_1003947183 125
266 3300005618 Ga0068864_100002029 Ga0068864_1000020296 125
267 3300005618 Ga0068864_100079774 Ga0068864_1000797742 125
268 3300005719 Ga0068861_100926217 Ga0068861_1009262172 125
269 3300005841 Ga0068863_100004930 Ga0068863_1000049308 125
270 3300005843 Ga0068860_100284706 Ga0068860_1002847063 125
271 3300005844 Ga0068862_100865241 Ga0068862_1008652412 125
272 3300006931 Ga0097620_100394728 Ga0097620_1003947281 125
273 3300009098 Ga0105245_11622759 Ga0105245_116227592 125
274 3300009553 Ga0105249_11852762 Ga0105249_118527621 125
275 3300013296 Ga0157374_11513265 Ga0157374_115132652 125
276 3300013297 Ga0157378_11044904 Ga0157378_110449041 125
277 3300013306 Ga0163162_10195652 Ga0163162_101956522 125
278 3300025901 Ga0207688_10495819 Ga0207688_104958192 125
279 3300025918 Ga0207662_10619647 Ga0207662_106196472 125
280 3300025919 Ga0207657_10016643 Ga0207657_100166434 125
281 3300025920 Ga0207649_10003885 Ga0207649_100038856 125
282 3300025925 Ga0207650_10004071 Ga0207650_100040713 125
283 3300025925 Ga0207650_11236665 Ga0207650_112366651 125
284 3300025926 Ga0207659_10680902 Ga0207659_106809022 125
285 3300025932 Ga0207690_10010241 Ga0207690_100102412 125
286 3300025945 Ga0207679_10002279 Ga0207679_100022796 125
287 3300025960 Ga0207651_10494912 Ga0207651_104949122 125
288 3300025972 Ga0207668_10238781 Ga0207668_102387811 125
289 3300026067 Ga0207678_10329572 Ga0207678_103295722 125
290 3300026088 Ga0207641_10005203 Ga0207641_100052034 125
291 3300026095 Ga0207676_10002773 Ga0207676_100027737 125
292 3300026095 Ga0207676_10521367 Ga0207676_105213672 125
293 3300026118 Ga0207675_101286864 Ga0207675_1012868642 125
294 3300028381 Ga0268264_10278590 Ga0268264_102785902 125
295 3300037471 Ga0395905_0000455 Ga0395905_0000455_21274_21660 125
296 3300041410 Ga0439461_0025782 Ga0439461_0025782_621_1001 125
297 3300041413 Ga0439465_0050740 Ga0439465_0050740_841_1221 125
298 3300042131 Ga0450894_006032 Ga0450894_006032_1016_1396 125
299 3300042156 Ga0439446_0010182 Ga0439446_0010182_855_1235 125
300 3300042435 Ga0439434_0107969 Ga0439434_0107969_234_614 125
301 3300042532 Ga0450893_0136812 Ga0450893_0136812_23_403 125
302 3300044658 Ga0466972_0321334 Ga0466972_0321334_40_423 125
303 3300044693 Ga0466961_0455503 Ga0466961_0455503_243_626 125
304 3300044706 Ga0466964_0043257 Ga0466964_0043257_741_1124 125
305 3300044719 Ga0466971_0031657 Ga0466971_0031657_204_587 125
306 3300044901 Ga0466960_0075337 Ga0466960_0075337_207_590 125
307 3300045049 Ga0466959_0037184 Ga0466959_0037184_1285_1668 125
308 3300048915 Ga0496112_0073060 Ga0496112_0073060_1468_1881 125
309 3300048916 Ga0496113_1448588 Ga0496113_1448588_30_443 125
310 3300049573 Ga0501037_0649407 Ga0501037_0649407_176_559 125
311 3300049574 Ga0501038_0202790 Ga0501038_0202790_283_666 125
312 3300049579 Ga0501043_0465413 Ga0501043_0465413_250_633 125
313 3300049822 Ga0501035_0019463 Ga0501035_0019463_5274_5657 125
314 3300049823 Ga0501044_0020301 Ga0501044_0020301_6469_6852 125
315 3300059421 Ga0590071_011503 Ga0590071_011503_414_800 125
316 3300059424 Ga0590075_048819 Ga0590075_048819_674_1060 125
317 3300059493 Ga0587077_009298 Ga0587077_009298_548_931 125
318 3300059510 Ga0587090_006132 Ga0587090_006132_592_975 125
319 3300059630 Ga0587128_007279 Ga0587128_007279_557_940 125
320 3300061719 Ga0466962_0183128 Ga0466962_0183128_154_537 125
321 iso_pu_bacteria 2842677519 2842678446 125
322 iso_pu_bacteria 2919462493 2919465128 125
323 iso_pu_bacteria 2643221628 2644162526 126
324 3300042000 Ga0439437_038609 Ga0439437_038609_18_410 127
325 3300046522 Ga0495643_0026684 Ga0495643_0026684_878_1336 127
326 3300046542 Ga0495597_0083934 Ga0495597_0083934_305_763 127
327 3300047443 Ga0495687_034200 Ga0495687_034200_597_1055 127
328 iso_pu_bacteria 2513020051 2513229022 127
329 iso_pu_bacteria 2643221658 2644329090 127
330 iso_pu_bacteria 2643221672 2644401817 127
331 3300027665 Ga0209983_1008978 Ga0209983_10089782 128
332 3300031548 Ga0307408_101357582 Ga0307408_1013575822 128
333 3300031911 Ga0307412_11780004 Ga0307412_117800042 128
334 iso_pu_bacteria 2945972063 2945977841 128
335 3300015261 Ga0182006_1026985 Ga0182006_10269854 129
336 3300015683 Ga0183362_10002 Ga0183362_10002503 129
337 3300027252 Ga0209973_1007964 Ga0209973_10079641 129
338 3300030732 Ga0316176_1095815 Ga0316176_10958157 129
339 3300030734 Ga0316179_1108004 Ga0316179_11080043 129
340 3300030735 Ga0316178_1073154 Ga0316178_10731547 129
341 3300030736 Ga0316180_1106339 Ga0316180_11063393 129
342 3300030742 Ga0316183_1037632 Ga0316183_10376326 129
343 3300030744 Ga0316181_1032171 Ga0316181_10321715 129
344 3300031548 Ga0307408_100237352 Ga0307408_1002373523 129
345 3300031731 Ga0307405_10581436 Ga0307405_105814361 129
346 3300031731 Ga0307405_10608725 Ga0307405_106087252 129
347 3300031824 Ga0307413_10256059 Ga0307413_102560591 129
348 3300031901 Ga0307406_10145519 Ga0307406_101455192 129
349 3300031911 Ga0307412_10099584 Ga0307412_100995844 129
350 3300031911 Ga0307412_10215434 Ga0307412_102154343 129
351 3300032002 Ga0307416_100215494 Ga0307416_1002154943 129
352 3300032004 Ga0307414_11276756 Ga0307414_112767561 129
353 3300037471 Ga0395905_0029176 Ga0395905_0029176_90_587 129
354 3300041997 Ga0439431_0149367 Ga0439431_0149367_109_522 129
355 3300048924 Ga0496121_0002968 Ga0496121_0002968_16876_17271 129
356 3300048928 Ga0496125_0114347 Ga0496125_0114347_832_1257 129
357 3300049679 Ga0501249_001839 Ga0501249_001839_647_1051 129
358 3300049704 Ga0501221_038092 Ga0501221_038092_33_437 129
359 3300049705 Ga0501225_0009489 Ga0501225_0009489_2163_2567 129
360 3300049759 Ga0501262_000042 Ga0501262_000042_2669_3073 129
361 3300049766 Ga0501269_006202 Ga0501269_006202_820_1224 129
362 iso_pu_bacteria 2929520902 2929525208 129
363 3300003773 Ga0055537_1000241 Ga0055537_10002417 130
364 3300003775 Ga0055524_1000378 Ga0055524_100037825 130
365 3300003781 Ga0055536_1000488 Ga0055536_10004886 130
366 3300003784 Ga0055534_1000232 Ga0055534_100023228 130
367 3300003790 Ga0055528_1000324 Ga0055528_100032428 130
368 3300003790 Ga0055528_1028323 Ga0055528_10283233 130
369 3300003791 Ga0055530_10005929 Ga0055530_100059293 130
370 3300003792 Ga0055540_1000174 Ga0055540_100017414 130
371 3300003794 Ga0055531_10000217 Ga0055531_1000021743 130
372 3300005288 Ga0065714_10002707 Ga0065714_100027077 130
373 3300005327 Ga0070658_10266738 Ga0070658_102667382 130
374 3300005334 Ga0068869_100736068 Ga0068869_1007360682 130
375 3300005366 Ga0070659_100614658 Ga0070659_1006146581 130
376 3300005457 Ga0070662_100005367 Ga0070662_1000053674 130
377 3300005459 Ga0068867_100097127 Ga0068867_1000971273 130
378 3300005539 Ga0068853_100210244 Ga0068853_1002102442 130
379 3300005577 Ga0068857_100550082 Ga0068857_1005500822 130
380 3300005578 Ga0068854_100260546 Ga0068854_1002605462 130
381 3300006038 Ga0075365_10019767 Ga0075365_100197674 130
382 3300006042 Ga0075368_10242961 Ga0075368_102429612 130
383 3300006048 Ga0075363_100017059 Ga0075363_1000170594 130
384 3300006048 Ga0075363_100634715 Ga0075363_1006347152 130
385 3300006051 Ga0075364_10001534 Ga0075364_100015344 130
386 3300006058 Ga0075432_10015262 Ga0075432_100152621 130
387 3300006058 Ga0075432_10016068 Ga0075432_100160682 130
388 3300006177 Ga0075362_10005878 Ga0075362_100058784 130
389 3300006177 Ga0075362_10018060 Ga0075362_100180604 130
390 3300006177 Ga0075362_10160366 Ga0075362_101603661 130
391 3300006177 Ga0075362_10632702 Ga0075362_106327021 130
392 3300006178 Ga0075367_10086305 Ga0075367_100863052 130
393 3300006178 Ga0075367_10208094 Ga0075367_102080943 130
394 3300006178 Ga0075367_10656534 Ga0075367_106565342 130
395 3300006195 Ga0075366_10008816 Ga0075366_100088164 130
396 3300006195 Ga0075366_10146196 Ga0075366_101461963 130
397 3300006195 Ga0075366_10391574 Ga0075366_103915741 130
398 3300006195 Ga0075366_10474018 Ga0075366_104740182 130
399 3300006237 Ga0097621_100320284 Ga0097621_1003202843 130
400 3300006353 Ga0075370_10000574 Ga0075370_100005746 130
401 3300006353 Ga0075370_10006076 Ga0075370_100060763 130
402 3300006353 Ga0075370_10044981 Ga0075370_100449813 130
403 3300006358 Ga0068871_100067773 Ga0068871_1000677734 130
404 3300006948 Ga0099826_10007477 Ga0099826_100074775 130
405 3300006948 Ga0099826_10081533 Ga0099826_100815333 130
406 3300009036 Ga0105244_10000473 Ga0105244_1000047315 130
407 3300009148 Ga0105243_10017643 Ga0105243_100176437 130
408 3300009545 Ga0105237_10938300 Ga0105237_109383002 130
409 3300009551 Ga0105238_10166661 Ga0105238_101666612 130
410 3300013100 Ga0157373_10044079 Ga0157373_100440793 130
411 3300014497 Ga0182008_10002559 Ga0182008_100025597 130
412 3300014969 Ga0157376_10056473 Ga0157376_100564732 130
413 3300015261 Ga0182006_1010239 Ga0182006_10102394 130
414 3300015262 Ga0182007_10000630 Ga0182007_100006304 130
415 3300017792 Ga0163161_10019186 Ga0163161_100191865 130
416 3300025263 Ga0209565_1000269 Ga0209565_100026911 130
417 3300025263 Ga0209565_1016792 Ga0209565_10167922 130
418 3300025273 Ga0209673_1000640 Ga0209673_100064011 130
419 3300025273 Ga0209673_1004228 Ga0209673_10042286 130
420 3300025291 Ga0209675_1000252 Ga0209675_100025211 130
421 3300025291 Ga0209675_1011408 Ga0209675_10114084 130
422 3300025292 Ga0209676_1000152 Ga0209676_100015245 130
423 3300025292 Ga0209676_1101651 Ga0209676_11016511 130
424 3300025294 Ga0209025_1006234 Ga0209025_10062344 130
425 3300025298 Ga0209050_1000210 Ga0209050_1000210121 130
426 3300025299 Ga0209256_1000092 Ga0209256_1000092175 130
427 3300025303 Ga0209051_1000074 Ga0209051_1000074120 130
428 3300025303 Ga0209051_1121512 Ga0209051_11215122 130
429 3300025304 Ga0209257_1000072 Ga0209257_1000072121 130
430 3300025728 Ga0207655_1003447 Ga0207655_10034473 130
431 3300025914 Ga0207671_10965514 Ga0207671_109655141 130
432 3300025924 Ga0207694_10178499 Ga0207694_101784992 130
433 3300025927 Ga0207687_11493552 Ga0207687_114935521 130
434 3300025932 Ga0207690_10715639 Ga0207690_107156392 130
435 3300025933 Ga0207706_10012799 Ga0207706_100127992 130
436 3300025934 Ga0207686_10846617 Ga0207686_108466171 130
437 3300025935 Ga0207709_10000793 Ga0207709_1000079322 130
438 3300025942 Ga0207689_10360279 Ga0207689_103602792 130
439 3300025942 Ga0207689_10994590 Ga0207689_109945902 130
440 3300026089 Ga0207648_10154622 Ga0207648_101546223 130
441 3300027666 Ga0209282_1004503 Ga0209282_10045037 130
442 3300027907 Ga0207428_10142336 Ga0207428_101423361 130
443 3300030733 Ga0314311_1187413 Ga0314311_11874135 130
444 3300031731 Ga0307405_10402858 Ga0307405_104028582 130
445 3300031903 Ga0307407_10123187 Ga0307407_101231873 130
446 3300031911 Ga0307412_10444558 Ga0307412_104445581 130
447 3300031911 Ga0307412_11556679 Ga0307412_115566792 130
448 3300031995 Ga0307409_100290249 Ga0307409_1002902492 130
449 3300032002 Ga0307416_101811752 Ga0307416_1018117522 130
450 3300032004 Ga0307414_10482449 Ga0307414_104824492 130
451 3300032004 Ga0307414_10715744 Ga0307414_107157442 130
452 3300032005 Ga0307411_10279208 Ga0307411_102792082 130
453 3300032005 Ga0307411_10598671 Ga0307411_105986712 130
454 3300032126 Ga0307415_100226450 Ga0307415_1002264502 130
455 3300032168 Ga0316593_10124615 Ga0316593_101246151 130
456 3300041404 Ga0439436_0103098 Ga0439436_0103098_104_517 130
457 3300041411 Ga0439466_0025115 Ga0439466_0025115_752_1165 130
458 3300041413 Ga0439465_0071484 Ga0439465_0071484_114_527 130
459 3300041451 Ga0451791_0231617 Ga0451791_0231617_100_561 130
460 3300041452 Ga0451793_1676247 Ga0451793_1676247_149_610 130
461 3300042002 Ga0439442_024383 Ga0439442_024383_710_1123 130
462 3300042004 Ga0439445_0073181 Ga0439445_0073181_210_623 130
463 3300042121 Ga0450919_006111 Ga0450919_006111_492_905 130
464 3300042125 Ga0450923_011732 Ga0450923_011732_717_1130 130
465 3300042127 Ga0450890_039348 Ga0450890_039348_24_437 130
466 3300042133 Ga0450896_063960 Ga0450896_063960_124_537 130
467 3300042145 Ga0450906_003616 Ga0450906_003616_1731_2144 130
468 3300042147 Ga0450910_003638 Ga0450910_003638_1261_1674 130
469 3300042156 Ga0439446_0026896 Ga0439446_0026896_647_1060 130
470 3300042184 Ga0450908_030040 Ga0450908_030040_340_753 130
471 3300042435 Ga0439434_0001996 Ga0439434_0001996_3544_3957 130
472 3300042531 Ga0450918_000965 Ga0450918_000965_5483_5896 130
473 3300042532 Ga0450893_0017575 Ga0450893_0017575_73_486 130
474 3300046471 Ga0495650_0017971 Ga0495650_0017971_437_865 130
475 3300046660 Ga0495625_0000012 Ga0495625_0000012_174708_175121 130
476 3300047443 Ga0495687_017881 Ga0495687_017881_649_1146 130
477 3300048905 Ga0496102_0165509 Ga0496102_0165509_1257_1664 130
478 3300048906 Ga0496103_0283746 Ga0496103_0283746_644_1051 130
479 3300048917 Ga0496114_0001657 Ga0496114_0001657_14838_15266 130
480 3300048919 Ga0496116_0014631 Ga0496116_0014631_147_554 130
481 3300048920 Ga0496117_0022808 Ga0496117_0022808_2531_2938 130
482 3300048921 Ga0496118_0006217 Ga0496118_0006217_9628_10035 130
483 3300048924 Ga0496121_0249340 Ga0496121_0249340_90_497 130
484 3300048927 Ga0496124_0306117 Ga0496124_0306117_447_854 130
485 3300048928 Ga0496125_0058334 Ga0496125_0058334_2226_2633 130
486 3300050489 nmdc:mga03683_150667_c1 nmdc:mga03683_150667_c1_461_865 130
487 3300050489 nmdc:mga03683_348860_c1 nmdc:mga03683_348860_c1_193_600 130
488 3300050489 nmdc:mga03683_667476_c1 nmdc:mga03683_667476_c1_64_471 130
489 3300050490 nmdc:mga03n38_54842_c1 nmdc:mga03n38_54842_c1_1121_1525 130
490 3300050491 nmdc:mga00v17_5334_c1 nmdc:mga00v17_5334_c1_2666_3073 130
491 3300050492 nmdc:mga0yw44_86079_c1 nmdc:mga0yw44_86079_c1_1392_1799 130
492 3300050493 nmdc:mga0k408_302159_c1 nmdc:mga0k408_302159_c1_87_494 130
493 3300050493 nmdc:mga0k408_34685_c1 nmdc:mga0k408_34685_c1_235_648 130
494 3300050493 nmdc:mga0k408_418613_c1 nmdc:mga0k408_418613_c1_378_782 130
495 3300050494 nmdc:mga06z11_143642_c1 nmdc:mga06z11_143642_c1_677_1084 130
496 3300050496 nmdc:mga07m45_145905_c1 nmdc:mga07m45_145905_c1_776_1183 130
497 3300050496 nmdc:mga07m45_159_c1 nmdc:mga07m45_159_c1_8190_8597 130
498 3300050496 nmdc:mga07m45_88067_c1 nmdc:mga07m45_88067_c1_479_883 130
499 iso_pu_bacteria 2842747753 2842750328 130
500 iso_pu_bacteria 2904449895 2904455000 130
501 iso_pu_bacteria 2904456579 2904457362 130
502 iso_pu_bacteria 2904541872 2904550059 130
503 iso_pu_bacteria 2929160207 2929166553 130
504 iso_pu_bacteria 2954767861 2954772796 130
505 3300003322 rootL2_10138106 rootL2_101381062 131
506 3300006186 Ga0075369_10199921 Ga0075369_101999212 131
507 3300027866 Ga0209813_10117890 Ga0209813_101178902 131
508 3300050495 nmdc:mga04h51_138621_c1 nmdc:mga04h51_138621_c1_253_660 131
509 3300014497 Ga0182008_10019529 Ga0182008_100195292 132
510 3300015261 Ga0182006_1254925 Ga0182006_12549252 132
511 3300015262 Ga0182007_10000192 Ga0182007_1000019240 132
512 3300026142 Ga0207698_10930496 Ga0207698_109304962 132
513 3300031649 Ga0307514_10030669 Ga0307514_100306695 132
514 3300031731 Ga0307405_10185802 Ga0307405_101858022 132
515 3300031901 Ga0307406_10017287 Ga0307406_100172873 132
516 3300031911 Ga0307412_10296651 Ga0307412_102966512 132
517 3300003187 JGI25151J46595_10001326 JGI25151J46595_100013265 133
518 3300005328 Ga0070676_10143556 Ga0070676_101435563 133
519 3300005347 Ga0070668_100449778 Ga0070668_1004497782 133
520 3300005355 Ga0070671_101481368 Ga0070671_1014813682 133
521 3300005456 Ga0070678_100078238 Ga0070678_1000782383 133
522 3300005616 Ga0068852_102088355 Ga0068852_1020883552 133
523 3300005618 Ga0068864_101486276 Ga0068864_1014862762 133
524 3300006048 Ga0075363_100134273 Ga0075363_1001342732 133
525 3300006186 Ga0075369_10031713 Ga0075369_100317134 133
526 3300014497 Ga0182008_10000374 Ga0182008_100003745 133
527 3300025294 Ga0209025_1000973 Ga0209025_100097317 133
528 3300025907 Ga0207645_10139830 Ga0207645_101398302 133
529 3300026121 Ga0207683_10035169 Ga0207683_100351693 133
530 3300028379 Ga0268266_10009652 Ga0268266_100096525 133
531 3300031456 Ga0307513_10292932 Ga0307513_102929322 133
532 3300031548 Ga0307408_100006090 Ga0307408_1000060907 133
533 3300031548 Ga0307408_100299510 Ga0307408_1002995102 133
534 3300031731 Ga0307405_11156511 Ga0307405_111565112 133
535 3300031911 Ga0307412_12048322 Ga0307412_120483221 133
536 3300032005 Ga0307411_10559543 Ga0307411_105595432 133
537 3300041460 Ga0451802_1837356 Ga0451802_1837356_88_546 133
538 3300050490 nmdc:mga03n38_198939_c1 nmdc:mga03n38_198939_c1_425_862 133
539 3300050516 nmdc:mga0sz30_81306_c1 nmdc:mga0sz30_81306_c1_652_1089 133
540 3300053153 Ga0500616_0068248 Ga0500616_0068248_15_422 133
541 3300053153 Ga0500616_0191940 Ga0500616_0191940_454_861 133
542 3300003578 Ga0006562J51391_1181789 Ga0006562J51391_11817893 134
543 3300003578 Ga0006562J51391_1181790 Ga0006562J51391_11817903 134
544 3300003792 Ga0055540_1001670 Ga0055540_10016707 134
545 3300005289 Ga0065704_10096167 Ga0065704_100961675 134
546 3300005353 Ga0070669_100001456 Ga0070669_1000014567 134
547 3300005547 Ga0070693_100560166 Ga0070693_1005601661 134
548 3300006038 Ga0075365_10585502 Ga0075365_105855021 134
549 3300006051 Ga0075364_10946292 Ga0075364_109462921 134
550 3300013104 Ga0157370_11018146 Ga0157370_110181462 134
551 3300014497 Ga0182008_10000675 Ga0182008_100006757 134
552 3300014497 Ga0182008_10048929 Ga0182008_100489293 134
553 3300014497 Ga0182008_10113869 Ga0182008_101138692 134
554 3300015261 Ga0182006_1094806 Ga0182006_10948062 134
555 3300015262 Ga0182007_10085958 Ga0182007_100859582 134
556 3300015265 Ga0182005_1032295 Ga0182005_10322952 134
557 3300025292 Ga0209676_1075433 Ga0209676_10754332 134
558 3300025303 Ga0209051_1000397 Ga0209051_10003977 134
559 3300025923 Ga0207681_10006381 Ga0207681_100063813 134
560 3300030745 Ga0316182_1397043 Ga0316182_13970435 134
561 3300031649 Ga0307514_10002271 Ga0307514_1000227110 134
562 3300041453 Ga0451797_0485924 Ga0451797_0485924_169_588 134
563 3300041456 Ga0451795_1550194 Ga0451795_1550194_74_535 134
564 3300046530 Ga0495654_0154246 Ga0495654_0154246_148_609 134
565 3300048916 Ga0496113_1050740 Ga0496113_1050740_100_561 134
566 3300048925 Ga0496122_0000039 Ga0496122_0000039_57991_58452 134
567 3300048926 Ga0496123_0000026 Ga0496123_0000026_58087_58548 134
568 3300048927 Ga0496124_0032772 Ga0496124_0032772_1985_2446 134
569 3300050492 nmdc:mga0yw44_251023_c1 nmdc:mga0yw44_251023_c1_35_496 134
570 3300050496 nmdc:mga07m45_154243_c1 nmdc:mga07m45_154243_c1_102_542 134
571 3300053090 Ga0500646_0065757 Ga0500646_0065757_240_701 134
572 3300042156 Ga0439446_0084780 Ga0439446_0084780_254_673 135
573 3300002987 JGI25159J45721_1045723 JGI25159J45721_10457231 137
574 3300003781 Ga0055536_1006774 Ga0055536_10067747 137
575 3300003781 Ga0055536_1008209 Ga0055536_10082094 137
576 3300003784 Ga0055534_1000516 Ga0055534_100051615 137
577 3300005262 Ga0065165_1157570 Ga0065165_11575701 137
578 3300025284 Ga0209130_1001875 Ga0209130_100187511 137
579 3300025291 Ga0209675_1001009 Ga0209675_10010094 137
580 3300025292 Ga0209676_1001899 Ga0209676_100189916 137
581 3300025294 Ga0209025_1026745 Ga0209025_10267452 137
582 3300025298 Ga0209050_1005555 Ga0209050_100555512 137
583 3300025303 Ga0209051_1004338 Ga0209051_10043389 137
584 3300025304 Ga0209257_1012460 Ga0209257_10124603 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

57

137

0.96

PF00011

HSP20

Hsp20/alpha crystallin family

52

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n3e-assembly1.cif.gz_B zebrafish alphaa crystallin 0.855 32 123
2cg9-assembly1.cif.gz_Y crystal structure of an hsp90-sba1 closed chaperone complex 0.8523 30 122
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8442 30 121
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8413 30 120
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8351 32 121
ID Description Score Start End Superfamily
af_A0A0R0GKS6_4_99_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8902 31 115 2.60.40.790
af_F4HWW7_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8738 31 121 2.60.40.790
af_I1MKZ4_1_104_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8629 31 121 2.60.40.790
af_F1QZY5_45_141_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8613 31 123 2.60.40.790
2cg9Y01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8523 30 122 2.60.40.790
ID Description Score Start End GO Terms
AF-D5BZM4-F1-model_v4 Heat shock protein Hsp20 0.8633 22 135
AF-C4ANX2-F1-model_v4 deleted 0.8531 34 135
AF-A0A3A4R451-F1-model_v4 Hsp20/alpha crystallin family protein 0.8493 30 136
AF-A0A7Y4RBM7-F1-model_v4 Hsp20/alpha crystallin family protein 0.8486 30 135
AF-A0A7C6DJZ5-F1-model_v4 Hsp20/alpha crystallin family protein 0.8389 31 133

Feature Viewer

pLDDT pTM Quality
77.11 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map