F466359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 318 | 569 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_11018146|Ga0157370_110181462 |
| Length | 153 |
| Sequence | VISNIDTARKECIVNTHQTPATTRGASNTPTATQQAPARSRYSDAALTPPVDVVEDSGGITLYADLPGVSREKLQLNVEADTLTIEAESALPSPEGLQSSHTEVGLARFRRVFTLSKELDTEQVSAEFAQGVLRLRIPKAQHAQPRRVEVKVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 3 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 4 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 5 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 6 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 7 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 8 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 9 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 10 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 11 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 12 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 13 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 14 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 15 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 16 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 186 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 187 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 188 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 189 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 190 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 191 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 192 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 193 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 199 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 200 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 225 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 226 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 227 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 228 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 240 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 241 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 242 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 243 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 244 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 245 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 250 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 251 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 292 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 302 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 308 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 312 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 313 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.03 |
| Metatranscriptomes | 2.4 |
| Isolates | 2.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.58 |
| Nodule | 0.51 |
| Rhizoplane | 2.4 |
| Rhizosphere | 76.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1045723 | 3300002987 | Unclassified | 618 |
| 2 | JGI25151J46595_10001326 | 3300003187 | Bacteria | 17311 |
| 3 | rootL2_10138106 | 3300003322 | Bacteria | 4710 |
| 4 | rootL2_10189271 | 3300003322 | Bacteria | 4674 |
| 5 | Ga0006562J51391_1181789 | 3300003578 | Bacteria | 2375 |
| 6 | Ga0006562J51391_1181790 | 3300003578 | Bacteria | 2100 |
| 7 | Ga0055537_1000241 | 3300003773 | Bacteria | 40227 |
| 8 | Ga0055524_1000378 | 3300003775 | Bacteria | 38772 |
| 9 | Ga0055536_1000488 | 3300003781 | Bacteria | 27544 |
| 10 | Ga0055536_1006774 | 3300003781 | Bacteria | 5246 |
| 11 | Ga0055536_1008209 | 3300003781 | Bacteria | 4530 |
| 12 | Ga0055534_1000232 | 3300003784 | Bacteria | 40227 |
| 13 | Ga0055534_1000516 | 3300003784 | Bacteria | 20853 |
| 14 | Ga0055528_1000324 | 3300003790 | Bacteria | 40031 |
| 15 | Ga0055528_1028323 | 3300003790 | Bacteria | 1548 |
| 16 | Ga0055530_10005929 | 3300003791 | Bacteria | 5632 |
| 17 | Ga0055540_1000174 | 3300003792 | Bacteria | 63200 |
| 18 | Ga0055540_1001670 | 3300003792 | Bacteria | 12843 |
| 19 | Ga0055531_10000217 | 3300003794 | Bacteria | 63200 |
| 20 | Ga0065165_1157570 | 3300005262 | Unclassified | 526 |
| 21 | Ga0065714_10002707 | 3300005288 | Bacteria | 31240 |
| 22 | Ga0065704_10096167 | 3300005289 | Bacteria | 2455 |
| 23 | Ga0065707_10200321 | 3300005295 | Bacteria | 1314 |
| 24 | Ga0070658_10266738 | 3300005327 | Bacteria | 1455 |
| 25 | Ga0070676_10143556 | 3300005328 | Bacteria | 1522 |
| 26 | Ga0070676_11157617 | 3300005328 | Unclassified | 586 |
| 27 | Ga0070690_100112696 | 3300005330 | Bacteria | 1817 |
| 28 | Ga0070690_101035656 | 3300005330 | Bacteria | 648 |
| 29 | Ga0070670_100000533 | 3300005331 | Bacteria | 30477 |
| 30 | Ga0070670_100005607 | 3300005331 | Bacteria | 10592 |
| 31 | Ga0070670_100027021 | 3300005331 | Bacteria | 4937 |
| 32 | Ga0070670_100040589 | 3300005331 | Bacteria | 4000 |
| 33 | Ga0068869_100000406 | 3300005334 | Bacteria | 23468 |
| 34 | Ga0068869_100736068 | 3300005334 | Bacteria | 843 |
| 35 | Ga0070680_101678104 | 3300005336 | Unclassified | 551 |
| 36 | Ga0070682_100090713 | 3300005337 | Bacteria | 1999 |
| 37 | Ga0068868_100049985 | 3300005338 | Bacteria | 3283 |
| 38 | Ga0070660_100014671 | 3300005339 | Bacteria | 5652 |
| 39 | Ga0070687_100013309 | 3300005343 | Bacteria | 3663 |
| 40 | Ga0070687_100270753 | 3300005343 | Bacteria | 1064 |
| 41 | Ga0070687_100588948 | 3300005343 | Bacteria | 762 |
| 42 | Ga0070661_100007314 | 3300005344 | Bacteria | 7616 |
| 43 | Ga0070661_100514904 | 3300005344 | Bacteria | 959 |
| 44 | Ga0070668_100017834 | 3300005347 | Bacteria | 5325 |
| 45 | Ga0070668_100122893 | 3300005347 | Bacteria | 2077 |
| 46 | Ga0070668_100449778 | 3300005347 | Bacteria | 1107 |
| 47 | Ga0070669_100001456 | 3300005353 | Bacteria | 17135 |
| 48 | Ga0070669_100008569 | 3300005353 | Bacteria | 7299 |
| 49 | Ga0070669_100012132 | 3300005353 | Bacteria | 6116 |
| 50 | Ga0070669_100642606 | 3300005353 | Bacteria | 892 |
| 51 | Ga0070675_100090529 | 3300005354 | Bacteria | 2562 |
| 52 | Ga0070675_100273330 | 3300005354 | Bacteria | 1483 |
| 53 | Ga0070675_101282440 | 3300005354 | Bacteria | 675 |
| 54 | Ga0070675_101380628 | 3300005354 | Bacteria | 649 |
| 55 | Ga0070671_100043399 | 3300005355 | Bacteria | 3736 |
| 56 | Ga0070671_100380539 | 3300005355 | Bacteria | 1206 |
| 57 | Ga0070671_101481368 | 3300005355 | Bacteria | 600 |
| 58 | Ga0070674_100463617 | 3300005356 | Bacteria | 1048 |
| 59 | Ga0070674_100598455 | 3300005356 | Bacteria | 931 |
| 60 | Ga0070673_100042478 | 3300005364 | Bacteria | 3506 |
| 61 | Ga0070673_100061654 | 3300005364 | Bacteria | 2976 |
| 62 | Ga0070673_100182935 | 3300005364 | Bacteria | 1795 |
| 63 | Ga0070688_100202753 | 3300005365 | Bacteria | 1389 |
| 64 | Ga0070688_100599656 | 3300005365 | Bacteria | 843 |
| 65 | Ga0070659_100023938 | 3300005366 | Bacteria | 4678 |
| 66 | Ga0070659_100614658 | 3300005366 | Bacteria | 935 |
| 67 | Ga0070667_100003620 | 3300005367 | Bacteria | 13151 |
| 68 | Ga0070667_100299802 | 3300005367 | Bacteria | 1447 |
| 69 | Ga0070667_100386876 | 3300005367 | Bacteria | 1271 |
| 70 | Ga0070667_100498353 | 3300005367 | Bacteria | 1116 |
| 71 | Ga0070667_100538971 | 3300005367 | Unclassified | 1072 |
| 72 | Ga0070667_101325974 | 3300005367 | Bacteria | 674 |
| 73 | Ga0070713_100189900 | 3300005436 | Bacteria | 1850 |
| 74 | Ga0070710_10074023 | 3300005437 | Bacteria | 1971 |
| 75 | Ga0070701_10499957 | 3300005438 | Unclassified | 789 |
| 76 | Ga0070711_100132902 | 3300005439 | Unclassified | 1856 |
| 77 | Ga0070663_101459400 | 3300005455 | Bacteria | 607 |
| 78 | Ga0070663_101784200 | 3300005455 | Unclassified | 551 |
| 79 | Ga0070678_100078238 | 3300005456 | Bacteria | 2498 |
| 80 | Ga0070678_100353695 | 3300005456 | Bacteria | 1264 |
| 81 | Ga0070678_100605245 | 3300005456 | Unclassified | 979 |
| 82 | Ga0070678_100720898 | 3300005456 | Bacteria | 900 |
| 83 | Ga0070678_101480722 | 3300005456 | Bacteria | 635 |
| 84 | Ga0070678_102118239 | 3300005456 | Bacteria | 533 |
| 85 | Ga0070662_100005367 | 3300005457 | Bacteria | 8185 |
| 86 | Ga0070662_100021484 | 3300005457 | Bacteria | 4407 |
| 87 | Ga0070662_100056358 | 3300005457 | Bacteria | 2853 |
| 88 | Ga0068867_100001139 | 3300005459 | Bacteria | 18170 |
| 89 | Ga0068867_100050990 | 3300005459 | Bacteria | 3051 |
| 90 | Ga0068867_100097127 | 3300005459 | Bacteria | 2244 |
| 91 | Ga0068867_100214525 | 3300005459 | Bacteria | 1548 |
| 92 | Ga0068867_101004027 | 3300005459 | Bacteria | 757 |
| 93 | Ga0070679_100434553 | 3300005530 | Unclassified | 1258 |
| 94 | Ga0068853_100210244 | 3300005539 | Bacteria | 1773 |
| 95 | Ga0070672_100000122 | 3300005543 | Bacteria | 40112 |
| 96 | Ga0070672_100030513 | 3300005543 | Bacteria | 4051 |
| 97 | Ga0070672_100229513 | 3300005543 | Bacteria | 1559 |
| 98 | Ga0070686_100205867 | 3300005544 | Bacteria | 1413 |
| 99 | Ga0070695_101391885 | 3300005545 | Unclassified | 581 |
| 100 | Ga0070696_100026951 | 3300005546 | Bacteria | 3912 |
| 101 | Ga0070693_100560166 | 3300005547 | Bacteria | 819 |
| 102 | Ga0070665_100253106 | 3300005548 | Bacteria | 1762 |
| 103 | Ga0070665_100440486 | 3300005548 | Unclassified | 1312 |
| 104 | Ga0070664_100035103 | 3300005564 | Bacteria | 4209 |
| 105 | Ga0070664_100116728 | 3300005564 | Bacteria | 2334 |
| 106 | Ga0070664_100281049 | 3300005564 | Bacteria | 1501 |
| 107 | Ga0070664_100507554 | 3300005564 | Bacteria | 1112 |
| 108 | Ga0068857_100126615 | 3300005577 | Bacteria | 2302 |
| 109 | Ga0068857_100550082 | 3300005577 | Bacteria | 1087 |
| 110 | Ga0068854_100260546 | 3300005578 | Bacteria | 1388 |
| 111 | Ga0070702_100291566 | 3300005615 | Bacteria | 1125 |
| 112 | Ga0068852_102088355 | 3300005616 | Bacteria | 588 |
| 113 | Ga0068859_100040426 | 3300005617 | Bacteria | 4681 |
| 114 | Ga0068859_100394718 | 3300005617 | Bacteria | 1479 |
| 115 | Ga0068859_100744884 | 3300005617 | Bacteria | 1069 |
| 116 | Ga0068859_100994660 | 3300005617 | Unclassified | 921 |
| 117 | Ga0068864_100002029 | 3300005618 | Bacteria | 16706 |
| 118 | Ga0068864_100004785 | 3300005618 | Bacteria | 11095 |
| 119 | Ga0068864_100079774 | 3300005618 | Bacteria | 2867 |
| 120 | Ga0068864_100084323 | 3300005618 | Bacteria | 2792 |
| 121 | Ga0068864_100690169 | 3300005618 | Bacteria | 997 |
| 122 | Ga0068864_101486276 | 3300005618 | Bacteria | 680 |
| 123 | Ga0068866_10015561 | 3300005718 | Bacteria | 3381 |
| 124 | Ga0068861_100012836 | 3300005719 | Bacteria | 5852 |
| 125 | Ga0068861_100926217 | 3300005719 | Bacteria | 827 |
| 126 | Ga0068851_10316999 | 3300005834 | Bacteria | 900 |
| 127 | Ga0068870_10057499 | 3300005840 | Bacteria | 2079 |
| 128 | Ga0068870_10638615 | 3300005840 | Bacteria | 728 |
| 129 | Ga0068870_11043444 | 3300005840 | Bacteria | 585 |
| 130 | Ga0068863_100003307 | 3300005841 | Bacteria | 15912 |
| 131 | Ga0068863_100004930 | 3300005841 | Bacteria | 13156 |
| 132 | Ga0068863_100029728 | 3300005841 | Bacteria | 5217 |
| 133 | Ga0068863_100053951 | 3300005841 | Bacteria | 3809 |
| 134 | Ga0068863_100073543 | 3300005841 | Bacteria | 3234 |
| 135 | Ga0068863_100270775 | 3300005841 | Unclassified | 1644 |
| 136 | Ga0068863_100309115 | 3300005841 | Bacteria | 1534 |
| 137 | Ga0068863_100329851 | 3300005841 | Bacteria | 1483 |
| 138 | Ga0068863_101053259 | 3300005841 | Bacteria | 817 |
| 139 | Ga0068858_100054415 | 3300005842 | Bacteria | 3700 |
| 140 | Ga0068858_100076543 | 3300005842 | Bacteria | 3107 |
| 141 | Ga0068858_100263234 | 3300005842 | Bacteria | 1640 |
| 142 | Ga0068860_100083518 | 3300005843 | Bacteria | 3038 |
| 143 | Ga0068860_100144703 | 3300005843 | Bacteria | 2286 |
| 144 | Ga0068860_100167807 | 3300005843 | Unclassified | 2119 |
| 145 | Ga0068860_100265386 | 3300005843 | Bacteria | 1674 |
| 146 | Ga0068860_100284706 | 3300005843 | Bacteria | 1616 |
| 147 | Ga0068862_100170718 | 3300005844 | Bacteria | 1947 |
| 148 | Ga0068862_100343501 | 3300005844 | Unclassified | 1383 |
| 149 | Ga0068862_100803332 | 3300005844 | Bacteria | 919 |
| 150 | Ga0068862_100865241 | 3300005844 | Bacteria | 887 |
| 151 | Ga0068862_101025205 | 3300005844 | Bacteria | 817 |
| 152 | Ga0075365_10019767 | 3300006038 | Bacteria | 4164 |
| 153 | Ga0075365_10585502 | 3300006038 | Bacteria | 789 |
| 154 | Ga0075368_10242961 | 3300006042 | Bacteria | 768 |
| 155 | Ga0075363_100017059 | 3300006048 | Bacteria | 3595 |
| 156 | Ga0075363_100134273 | 3300006048 | Bacteria | 1390 |
| 157 | Ga0075363_100634715 | 3300006048 | Bacteria | 642 |
| 158 | Ga0075364_10001534 | 3300006051 | Bacteria | 12593 |
| 159 | Ga0075364_10946292 | 3300006051 | Bacteria | 586 |
| 160 | Ga0075432_10015262 | 3300006058 | Bacteria | 2619 |
| 161 | Ga0075432_10016068 | 3300006058 | Bacteria | 2556 |
| 162 | Ga0075362_10005878 | 3300006177 | Bacteria | 4528 |
| 163 | Ga0075362_10018060 | 3300006177 | Bacteria | 2914 |
| 164 | Ga0075362_10160366 | 3300006177 | Bacteria | 1083 |
| 165 | Ga0075362_10197358 | 3300006177 | Bacteria | 979 |
| 166 | Ga0075362_10632702 | 3300006177 | Bacteria | 555 |
| 167 | Ga0075367_10086305 | 3300006178 | Bacteria | 1905 |
| 168 | Ga0075367_10208094 | 3300006178 | Bacteria | 1223 |
| 169 | Ga0075367_10656534 | 3300006178 | Bacteria | 667 |
| 170 | Ga0075369_10031713 | 3300006186 | Bacteria | 2232 |
| 171 | Ga0075369_10199921 | 3300006186 | Bacteria | 922 |
| 172 | Ga0075366_10008816 | 3300006195 | Bacteria | 5618 |
| 173 | Ga0075366_10146196 | 3300006195 | Bacteria | 1430 |
| 174 | Ga0075366_10391574 | 3300006195 | Bacteria | 855 |
| 175 | Ga0075366_10474018 | 3300006195 | Bacteria | 773 |
| 176 | Ga0097621_100072734 | 3300006237 | Bacteria | 2844 |
| 177 | Ga0097621_100320284 | 3300006237 | Bacteria | 1373 |
| 178 | Ga0075370_10000574 | 3300006353 | Bacteria | 14126 |
| 179 | Ga0075370_10006076 | 3300006353 | Bacteria | 6051 |
| 180 | Ga0075370_10044981 | 3300006353 | Bacteria | 2496 |
| 181 | Ga0068871_100067773 | 3300006358 | Bacteria | 2929 |
| 182 | Ga0068871_100295055 | 3300006358 | Bacteria | 1422 |
| 183 | Ga0068871_100495812 | 3300006358 | Bacteria | 1100 |
| 184 | Ga0068871_100776759 | 3300006358 | Bacteria | 882 |
| 185 | Ga0075431_100974927 | 3300006847 | Bacteria | 815 |
| 186 | Ga0075434_100230568 | 3300006871 | Bacteria | 1871 |
| 187 | Ga0068865_100044739 | 3300006881 | Bacteria | 3032 |
| 188 | Ga0068865_100114582 | 3300006881 | Bacteria | 1994 |
| 189 | Ga0068865_101146802 | 3300006881 | Unclassified | 686 |
| 190 | Ga0097620_100040424 | 3300006931 | Bacteria | 4681 |
| 191 | Ga0097620_100394728 | 3300006931 | Bacteria | 1479 |
| 192 | Ga0097620_100744885 | 3300006931 | Bacteria | 1069 |
| 193 | Ga0097620_100994421 | 3300006931 | Unclassified | 921 |
| 194 | Ga0099826_10007477 | 3300006948 | Bacteria | 8062 |
| 195 | Ga0099826_10081533 | 3300006948 | Bacteria | 2013 |
| 196 | Ga0105251_10075188 | 3300009011 | Bacteria | 1569 |
| 197 | Ga0105244_10000473 | 3300009036 | Bacteria | 36586 |
| 198 | Ga0105240_10752336 | 3300009093 | Bacteria | 1059 |
| 199 | Ga0105245_11622759 | 3300009098 | Bacteria | 698 |
| 200 | Ga0105247_10105670 | 3300009101 | Bacteria | 1805 |
| 201 | Ga0105243_10017643 | 3300009148 | Bacteria | 5398 |
| 202 | Ga0105241_10821638 | 3300009174 | Unclassified | 857 |
| 203 | Ga0105248_10045430 | 3300009177 | Bacteria | 4926 |
| 204 | Ga0105248_10421215 | 3300009177 | Bacteria | 1504 |
| 205 | Ga0105237_10938300 | 3300009545 | Bacteria | 872 |
| 206 | Ga0105238_10166661 | 3300009551 | Bacteria | 2179 |
| 207 | Ga0105249_10938226 | 3300009553 | Bacteria | 933 |
| 208 | Ga0105249_11852762 | 3300009553 | Bacteria | 676 |
| 209 | Ga0105239_10127965 | 3300010375 | Bacteria | 2824 |
| 210 | Ga0105239_10931854 | 3300010375 | Bacteria | 997 |
| 211 | Ga0157373_10044079 | 3300013100 | Bacteria | 3185 |
| 212 | Ga0157370_11018146 | 3300013104 | Bacteria | 749 |
| 213 | Ga0157374_10133865 | 3300013296 | Bacteria | 2401 |
| 214 | Ga0157374_11513265 | 3300013296 | Bacteria | 694 |
| 215 | Ga0157378_10049080 | 3300013297 | Bacteria | 3755 |
| 216 | Ga0157378_10075997 | 3300013297 | Bacteria | 3025 |
| 217 | Ga0157378_11044904 | 3300013297 | Unclassified | 852 |
| 218 | Ga0157378_12609901 | 3300013297 | Bacteria | 558 |
| 219 | Ga0163162_10186921 | 3300013306 | Bacteria | 2199 |
| 220 | Ga0163162_10195652 | 3300013306 | Bacteria | 2150 |
| 221 | Ga0163162_10829743 | 3300013306 | Bacteria | 1040 |
| 222 | Ga0157375_10023821 | 3300013308 | Bacteria | 5656 |
| 223 | Ga0157375_10033632 | 3300013308 | Bacteria | 4874 |
| 224 | Ga0157375_10172419 | 3300013308 | Bacteria | 2311 |
| 225 | Ga0157375_10211196 | 3300013308 | Bacteria | 2098 |
| 226 | Ga0157375_12719727 | 3300013308 | Bacteria | 592 |
| 227 | Ga0163163_10014439 | 3300014325 | Bacteria | 7260 |
| 228 | Ga0163163_10028813 | 3300014325 | Bacteria | 5337 |
| 229 | Ga0163163_11258405 | 3300014325 | Bacteria | 802 |
| 230 | Ga0157380_10032686 | 3300014326 | Bacteria | 4005 |
| 231 | Ga0182008_10000374 | 3300014497 | Bacteria | 34622 |
| 232 | Ga0182008_10000675 | 3300014497 | Bacteria | 24682 |
| 233 | Ga0182008_10002559 | 3300014497 | Bacteria | 11328 |
| 234 | Ga0182008_10019529 | 3300014497 | Bacteria | 3497 |
| 235 | Ga0182008_10048929 | 3300014497 | Bacteria | 2099 |
| 236 | Ga0182008_10113869 | 3300014497 | Bacteria | 1341 |
| 237 | Ga0157379_10000458 | 3300014968 | Bacteria | 33058 |
| 238 | Ga0157379_11539449 | 3300014968 | Bacteria | 648 |
| 239 | Ga0157376_10056473 | 3300014969 | Bacteria | 3280 |
| 240 | Ga0157376_10175160 | 3300014969 | Bacteria | 1956 |
| 241 | Ga0157376_10234995 | 3300014969 | Bacteria | 1705 |
| 242 | Ga0157376_10669715 | 3300014969 | Bacteria | 1040 |
| 243 | Ga0157376_11099282 | 3300014969 | Bacteria | 821 |
| 244 | Ga0182006_1010239 | 3300015261 | Bacteria | 4177 |
| 245 | Ga0182006_1026985 | 3300015261 | Bacteria | 2347 |
| 246 | Ga0182006_1094806 | 3300015261 | Bacteria | 1068 |
| 247 | Ga0182006_1254925 | 3300015261 | Bacteria | 576 |
| 248 | Ga0182007_10000192 | 3300015262 | Bacteria | 41119 |
| 249 | Ga0182007_10000630 | 3300015262 | Bacteria | 20540 |
| 250 | Ga0182007_10085958 | 3300015262 | Bacteria | 1033 |
| 251 | Ga0182005_1032295 | 3300015265 | Bacteria | 1425 |
| 252 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 253 | Ga0163161_10019186 | 3300017792 | Bacteria | 4795 |
| 254 | Ga0163161_10084397 | 3300017792 | Bacteria | 2342 |
| 255 | Ga0224712_10062083 | 3300022467 | Bacteria | 1492 |
| 256 | Ga0209565_1000269 | 3300025263 | Bacteria | 52870 |
| 257 | Ga0209565_1016792 | 3300025263 | Bacteria | 1620 |
| 258 | Ga0209673_1000640 | 3300025273 | Bacteria | 52870 |
| 259 | Ga0209673_1004228 | 3300025273 | Bacteria | 7816 |
| 260 | Ga0209130_1001875 | 3300025284 | Bacteria | 11986 |
| 261 | Ga0209675_1000252 | 3300025291 | Bacteria | 52870 |
| 262 | Ga0209675_1001009 | 3300025291 | Bacteria | 17677 |
| 263 | Ga0209675_1011408 | 3300025291 | Bacteria | 2948 |
| 264 | Ga0209676_1000152 | 3300025292 | Bacteria | 166700 |
| 265 | Ga0209676_1001899 | 3300025292 | Bacteria | 17035 |
| 266 | Ga0209676_1075433 | 3300025292 | Bacteria | 786 |
| 267 | Ga0209676_1101651 | 3300025292 | Bacteria | 611 |
| 268 | Ga0209025_1000973 | 3300025294 | Bacteria | 42929 |
| 269 | Ga0209025_1006234 | 3300025294 | Bacteria | 9344 |
| 270 | Ga0209025_1026745 | 3300025294 | Bacteria | 2885 |
| 271 | Ga0209050_1000210 | 3300025298 | Bacteria | 129834 |
| 272 | Ga0209050_1005555 | 3300025298 | Bacteria | 7857 |
| 273 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 274 | Ga0209051_1000074 | 3300025303 | Bacteria | 208667 |
| 275 | Ga0209051_1000397 | 3300025303 | Bacteria | 60597 |
| 276 | Ga0209051_1004338 | 3300025303 | Bacteria | 8797 |
| 277 | Ga0209051_1121512 | 3300025303 | Bacteria | 662 |
| 278 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 279 | Ga0209257_1012460 | 3300025304 | Bacteria | 3924 |
| 280 | Ga0207697_10105967 | 3300025315 | Bacteria | 1201 |
| 281 | Ga0207655_1003447 | 3300025728 | Bacteria | 11763 |
| 282 | Ga0207688_10495819 | 3300025901 | Bacteria | 764 |
| 283 | Ga0207645_10139830 | 3300025907 | Bacteria | 1577 |
| 284 | Ga0207645_10185669 | 3300025907 | Bacteria | 1365 |
| 285 | Ga0207643_10106404 | 3300025908 | Bacteria | 1649 |
| 286 | Ga0207643_10846655 | 3300025908 | Unclassified | 593 |
| 287 | Ga0207671_10965514 | 3300025914 | Bacteria | 672 |
| 288 | Ga0207662_10484563 | 3300025918 | Bacteria | 850 |
| 289 | Ga0207662_10619647 | 3300025918 | Bacteria | 754 |
| 290 | Ga0207657_10016643 | 3300025919 | Bacteria | 7084 |
| 291 | Ga0207649_10003885 | 3300025920 | Bacteria | 8150 |
| 292 | Ga0207652_10452266 | 3300025921 | Unclassified | 1158 |
| 293 | Ga0207681_10006381 | 3300025923 | Bacteria | 7240 |
| 294 | Ga0207681_10018212 | 3300025923 | Bacteria | 4423 |
| 295 | Ga0207694_10178499 | 3300025924 | Bacteria | 1721 |
| 296 | Ga0207650_10004071 | 3300025925 | Bacteria | 9992 |
| 297 | Ga0207650_10036909 | 3300025925 | Bacteria | 3557 |
| 298 | Ga0207650_10065500 | 3300025925 | Bacteria | 2723 |
| 299 | Ga0207650_10304063 | 3300025925 | Bacteria | 1303 |
| 300 | Ga0207650_11236665 | 3300025925 | Bacteria | 636 |
| 301 | Ga0207659_10408638 | 3300025926 | Bacteria | 1137 |
| 302 | Ga0207659_10680902 | 3300025926 | Bacteria | 880 |
| 303 | Ga0207687_11493552 | 3300025927 | Bacteria | 580 |
| 304 | Ga0207644_10029426 | 3300025931 | Bacteria | 3811 |
| 305 | Ga0207690_10010241 | 3300025932 | Bacteria | 5567 |
| 306 | Ga0207690_10715639 | 3300025932 | Bacteria | 824 |
| 307 | Ga0207706_10012799 | 3300025933 | Bacteria | 7634 |
| 308 | Ga0207686_10846617 | 3300025934 | Bacteria | 735 |
| 309 | Ga0207709_10000793 | 3300025935 | Bacteria | 24654 |
| 310 | Ga0207704_10099725 | 3300025938 | Bacteria | 1933 |
| 311 | Ga0207704_10409435 | 3300025938 | Bacteria | 1072 |
| 312 | Ga0207691_10001269 | 3300025940 | Bacteria | 25255 |
| 313 | Ga0207691_10242089 | 3300025940 | Bacteria | 1559 |
| 314 | Ga0207711_10028427 | 3300025941 | Bacteria | 4705 |
| 315 | Ga0207711_10400307 | 3300025941 | Bacteria | 1276 |
| 316 | Ga0207711_10809168 | 3300025941 | Unclassified | 873 |
| 317 | Ga0207689_10211384 | 3300025942 | Bacteria | 1603 |
| 318 | Ga0207689_10360279 | 3300025942 | Bacteria | 1209 |
| 319 | Ga0207689_10994590 | 3300025942 | Bacteria | 707 |
| 320 | Ga0207679_10002279 | 3300025945 | Bacteria | 11836 |
| 321 | Ga0207679_10388559 | 3300025945 | Bacteria | 1225 |
| 322 | Ga0207679_10814964 | 3300025945 | Bacteria | 851 |
| 323 | Ga0207651_10016089 | 3300025960 | Bacteria | 4369 |
| 324 | Ga0207651_10030527 | 3300025960 | Bacteria | 3433 |
| 325 | Ga0207651_10494912 | 3300025960 | Bacteria | 1056 |
| 326 | Ga0207668_10002175 | 3300025972 | Bacteria | 11442 |
| 327 | Ga0207668_10215271 | 3300025972 | Bacteria | 1539 |
| 328 | Ga0207668_10238781 | 3300025972 | Bacteria | 1469 |
| 329 | Ga0207658_10026500 | 3300025986 | Bacteria | 4064 |
| 330 | Ga0207658_10029174 | 3300025986 | Bacteria | 3893 |
| 331 | Ga0207658_10291038 | 3300025986 | Bacteria | 1404 |
| 332 | Ga0207677_10045500 | 3300026023 | Bacteria | 2931 |
| 333 | Ga0207639_10432561 | 3300026041 | Bacteria | 1192 |
| 334 | Ga0207678_10329572 | 3300026067 | Bacteria | 1314 |
| 335 | Ga0207708_10481969 | 3300026075 | Bacteria | 1037 |
| 336 | Ga0207641_10005203 | 3300026088 | Bacteria | 11123 |
| 337 | Ga0207641_10103199 | 3300026088 | Bacteria | 2515 |
| 338 | Ga0207641_10571363 | 3300026088 | Unclassified | 1104 |
| 339 | Ga0207641_10747187 | 3300026088 | Bacteria | 965 |
| 340 | Ga0207641_10953351 | 3300026088 | Unclassified | 853 |
| 341 | Ga0207641_11029959 | 3300026088 | Bacteria | 820 |
| 342 | Ga0207648_10011353 | 3300026089 | Bacteria | 8398 |
| 343 | Ga0207648_10154622 | 3300026089 | Bacteria | 2024 |
| 344 | Ga0207648_10224129 | 3300026089 | Bacteria | 1671 |
| 345 | Ga0207648_11168374 | 3300026089 | Bacteria | 723 |
| 346 | Ga0207676_10002773 | 3300026095 | Bacteria | 12461 |
| 347 | Ga0207676_10067022 | 3300026095 | Bacteria | 2866 |
| 348 | Ga0207676_10521367 | 3300026095 | Bacteria | 1131 |
| 349 | Ga0207675_101286864 | 3300026118 | Bacteria | 752 |
| 350 | Ga0207675_101667957 | 3300026118 | Bacteria | 657 |
| 351 | Ga0207683_10035169 | 3300026121 | Bacteria | 4357 |
| 352 | Ga0207683_10577310 | 3300026121 | Bacteria | 1040 |
| 353 | Ga0207683_10821804 | 3300026121 | Bacteria | 863 |
| 354 | Ga0207683_10973805 | 3300026121 | Unclassified | 788 |
| 355 | Ga0207698_10930496 | 3300026142 | Bacteria | 877 |
| 356 | Ga0209973_1007964 | 3300027252 | Bacteria | 1197 |
| 357 | Ga0209983_1008978 | 3300027665 | Bacteria | 2043 |
| 358 | Ga0209282_1004503 | 3300027666 | Bacteria | 8406 |
| 359 | Ga0209813_10117890 | 3300027866 | Bacteria | 921 |
| 360 | Ga0207428_10142336 | 3300027907 | Bacteria | 1829 |
| 361 | Ga0268266_10009652 | 3300028379 | Bacteria | 8487 |
| 362 | Ga0268265_10112944 | 3300028380 | Bacteria | 2222 |
| 363 | Ga0268265_10159718 | 3300028380 | Bacteria | 1913 |
| 364 | Ga0268264_10045905 | 3300028381 | Bacteria | 3628 |
| 365 | Ga0268264_10160046 | 3300028381 | Bacteria | 2027 |
| 366 | Ga0268264_10261451 | 3300028381 | Unclassified | 1612 |
| 367 | Ga0268264_10278590 | 3300028381 | Bacteria | 1565 |
| 368 | Ga0268264_11510152 | 3300028381 | Unclassified | 682 |
| 369 | Ga0316177_1064101 | 3300030731 | Bacteria | 1286 |
| 370 | Ga0316176_1095815 | 3300030732 | Bacteria | 7945 |
| 371 | Ga0314311_1187413 | 3300030733 | Bacteria | 4069 |
| 372 | Ga0316179_1108004 | 3300030734 | Bacteria | 2296 |
| 373 | Ga0316178_1073154 | 3300030735 | Bacteria | 8992 |
| 374 | Ga0316180_1106339 | 3300030736 | Bacteria | 1394 |
| 375 | Ga0316183_1037632 | 3300030742 | Bacteria | 7342 |
| 376 | Ga0316183_1071558 | 3300030742 | Bacteria | 4635 |
| 377 | Ga0316181_1032171 | 3300030744 | Bacteria | 4225 |
| 378 | Ga0316181_1196510 | 3300030744 | Bacteria | 863 |
| 379 | Ga0316182_1397043 | 3300030745 | Bacteria | 3744 |
| 380 | Ga0265332_10009346 | 3300031238 | Bacteria | 4379 |
| 381 | Ga0307513_10292932 | 3300031456 | Bacteria | 1398 |
| 382 | Ga0307408_100006090 | 3300031548 | Bacteria | 8020 |
| 383 | Ga0307408_100237352 | 3300031548 | Bacteria | 1496 |
| 384 | Ga0307408_100299510 | 3300031548 | Bacteria | 1346 |
| 385 | Ga0307408_101357582 | 3300031548 | Bacteria | 668 |
| 386 | Ga0265313_10066529 | 3300031595 | Bacteria | 1670 |
| 387 | Ga0307514_10002271 | 3300031649 | Bacteria | 20395 |
| 388 | Ga0307514_10030669 | 3300031649 | Bacteria | 4315 |
| 389 | Ga0316575_10156966 | 3300031665 | Bacteria | 940 |
| 390 | Ga0316579_10000031 | 3300031691 | Bacteria | 32051 |
| 391 | Ga0316579_10022550 | 3300031691 | Unclassified | 2816 |
| 392 | Ga0316578_10009234 | 3300031728 | Bacteria | 5063 |
| 393 | Ga0307516_10000497 | 3300031730 | Bacteria | 52295 |
| 394 | Ga0307405_10185802 | 3300031731 | Bacteria | 1496 |
| 395 | Ga0307405_10402858 | 3300031731 | Bacteria | 1071 |
| 396 | Ga0307405_10581436 | 3300031731 | Bacteria | 911 |
| 397 | Ga0307405_10608725 | 3300031731 | Bacteria | 892 |
| 398 | Ga0307405_11156511 | 3300031731 | Bacteria | 667 |
| 399 | Ga0316577_10050834 | 3300031733 | Bacteria | 2314 |
| 400 | Ga0307413_10256059 | 3300031824 | Bacteria | 1302 |
| 401 | Ga0307406_10017287 | 3300031901 | Bacteria | 4199 |
| 402 | Ga0307406_10145519 | 3300031901 | Bacteria | 1683 |
| 403 | Ga0307407_10123187 | 3300031903 | Bacteria | 1647 |
| 404 | Ga0307412_10099584 | 3300031911 | Bacteria | 2053 |
| 405 | Ga0307412_10215434 | 3300031911 | Bacteria | 1468 |
| 406 | Ga0307412_10296651 | 3300031911 | Bacteria | 1276 |
| 407 | Ga0307412_10444558 | 3300031911 | Bacteria | 1066 |
| 408 | Ga0307412_11556679 | 3300031911 | Bacteria | 602 |
| 409 | Ga0307412_11780004 | 3300031911 | Bacteria | 566 |
| 410 | Ga0307412_12048322 | 3300031911 | Bacteria | 530 |
| 411 | Ga0307409_100290249 | 3300031995 | Bacteria | 1517 |
| 412 | Ga0307416_100215494 | 3300032002 | Bacteria | 1836 |
| 413 | Ga0307416_101811752 | 3300032002 | Bacteria | 714 |
| 414 | Ga0307414_10482449 | 3300032004 | Bacteria | 1093 |
| 415 | Ga0307414_10715744 | 3300032004 | Bacteria | 907 |
| 416 | Ga0307414_11276756 | 3300032004 | Bacteria | 681 |
| 417 | Ga0307411_10279208 | 3300032005 | Bacteria | 1328 |
| 418 | Ga0307411_10559543 | 3300032005 | Bacteria | 977 |
| 419 | Ga0307411_10598671 | 3300032005 | Bacteria | 947 |
| 420 | Ga0307415_100226450 | 3300032126 | Bacteria | 1503 |
| 421 | Ga0316583_10009548 | 3300032133 | Bacteria | 3494 |
| 422 | Ga0316583_10034495 | 3300032133 | Bacteria | 1795 |
| 423 | Ga0316583_10281273 | 3300032133 | Unclassified | 576 |
| 424 | Ga0316593_10026821 | 3300032168 | Bacteria | 1844 |
| 425 | Ga0316593_10028851 | 3300032168 | Bacteria | 1791 |
| 426 | Ga0316593_10047561 | 3300032168 | Bacteria | 1443 |
| 427 | Ga0316593_10124615 | 3300032168 | Unclassified | 927 |
| 428 | Ga0316574_0056355 | 3300035398 | Bacteria | 2459 |
| 429 | Ga0316582_0002941 | 3300036647 | Bacteria | 8195 |
| 430 | Ga0316582_0092144 | 3300036647 | Bacteria | 1996 |
| 431 | Ga0316584_0023830 | 3300036712 | Bacteria | 4472 |
| 432 | Ga0316584_0413979 | 3300036712 | Bacteria | 958 |
| 433 | Ga0395899_0219850 | 3300037312 | Bacteria | 1316 |
| 434 | Ga0395899_0228049 | 3300037312 | Bacteria | 1287 |
| 435 | Ga0395900_0023607 | 3300037418 | Bacteria | 6292 |
| 436 | Ga0395905_0000455 | 3300037471 | Bacteria | 57161 |
| 437 | Ga0395905_0014027 | 3300037471 | Bacteria | 7662 |
| 438 | Ga0395905_0029176 | 3300037471 | Bacteria | 5199 |
| 439 | Ga0316581_0010445 | 3300037588 | Bacteria | 2574 |
| 440 | Ga0395901_0605522 | 3300038443 | Bacteria | 1104 |
| 441 | Ga0439436_0103098 | 3300041404 | Bacteria | 795 |
| 442 | Ga0439461_0025782 | 3300041410 | Bacteria | 1196 |
| 443 | Ga0439466_0025115 | 3300041411 | Bacteria | 2082 |
| 444 | Ga0439465_0050740 | 3300041413 | Bacteria | 1358 |
| 445 | Ga0439465_0071484 | 3300041413 | Bacteria | 1163 |
| 446 | Ga0451791_0231617 | 3300041451 | Bacteria | 945 |
| 447 | Ga0451793_1676247 | 3300041452 | Bacteria | 898 |
| 448 | Ga0451797_0485924 | 3300041453 | Bacteria | 742 |
| 449 | Ga0451795_1550194 | 3300041456 | Bacteria | 793 |
| 450 | Ga0451802_0805532 | 3300041460 | Bacteria | 1132 |
| 451 | Ga0451802_1837356 | 3300041460 | Bacteria | 576 |
| 452 | Ga0451807_0023713 | 3300041486 | Bacteria | 3638 |
| 453 | Ga0451843_0193779 | 3300041509 | Bacteria | 569 |
| 454 | Ga0439431_0149367 | 3300041997 | Bacteria | 663 |
| 455 | Ga0439437_038609 | 3300042000 | Bacteria | 615 |
| 456 | Ga0439442_024383 | 3300042002 | Bacteria | 1258 |
| 457 | Ga0439445_0073181 | 3300042004 | Bacteria | 950 |
| 458 | Ga0450919_006111 | 3300042121 | Bacteria | 1431 |
| 459 | Ga0450923_011732 | 3300042125 | Bacteria | 1582 |
| 460 | Ga0450890_039348 | 3300042127 | Bacteria | 695 |
| 461 | Ga0450894_006032 | 3300042131 | Bacteria | 1567 |
| 462 | Ga0450896_063960 | 3300042133 | Bacteria | 602 |
| 463 | Ga0450906_003616 | 3300042145 | Bacteria | 3302 |
| 464 | Ga0450910_003638 | 3300042147 | Bacteria | 2053 |
| 465 | Ga0439446_0010182 | 3300042156 | Bacteria | 2530 |
| 466 | Ga0439446_0026896 | 3300042156 | Bacteria | 1650 |
| 467 | Ga0439446_0084780 | 3300042156 | Bacteria | 985 |
| 468 | Ga0450908_030040 | 3300042184 | Bacteria | 944 |
| 469 | Ga0439434_0001996 | 3300042435 | Bacteria | 5901 |
| 470 | Ga0439434_0107969 | 3300042435 | Bacteria | 900 |
| 471 | Ga0439444_0197363 | 3300042437 | Bacteria | 506 |
| 472 | Ga0450918_000965 | 3300042531 | Bacteria | 5995 |
| 473 | Ga0450893_0017575 | 3300042532 | Bacteria | 1215 |
| 474 | Ga0450893_0136812 | 3300042532 | Bacteria | 520 |
| 475 | Ga0451577_0121026 | 3300042876 | Bacteria | 2344 |
| 476 | Ga0451577_1039927 | 3300042876 | Bacteria | 734 |
| 477 | Ga0466969_0052549 | 3300044656 | Bacteria | 2002 |
| 478 | Ga0466972_0000073 | 3300044658 | Bacteria | 96438 |
| 479 | Ga0466972_0321334 | 3300044658 | Bacteria | 723 |
| 480 | Ga0453683_0389715 | 3300044673 | Unclassified | 897 |
| 481 | Ga0466965_0025588 | 3300044683 | Bacteria | 2857 |
| 482 | Ga0466966_0090907 | 3300044684 | Bacteria | 1895 |
| 483 | Ga0466961_0239704 | 3300044693 | Bacteria | 1115 |
| 484 | Ga0466961_0455503 | 3300044693 | Bacteria | 774 |
| 485 | Ga0466964_0043257 | 3300044706 | Bacteria | 1826 |
| 486 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 487 | Ga0453684_0031445 | 3300044712 | Bacteria | 7460 |
| 488 | Ga0466971_0031657 | 3300044719 | Bacteria | 2369 |
| 489 | Ga0466960_0075337 | 3300044901 | Bacteria | 1688 |
| 490 | Ga0466959_0037184 | 3300045049 | Bacteria | 3597 |
| 491 | Ga0466959_0100718 | 3300045049 | Bacteria | 2068 |
| 492 | Ga0451576_0010764 | 3300045051 | Bacteria | 10469 |
| 493 | Ga0451576_0101670 | 3300045051 | Bacteria | 2989 |
| 494 | Ga0451576_0483065 | 3300045051 | Bacteria | 1301 |
| 495 | Ga0495650_0017971 | 3300046471 | Bacteria | 3529 |
| 496 | Ga0495643_0026684 | 3300046522 | Bacteria | 3255 |
| 497 | Ga0495642_0008464 | 3300046528 | Bacteria | 3936 |
| 498 | Ga0495654_0154246 | 3300046530 | Bacteria | 1013 |
| 499 | Ga0495597_0083934 | 3300046542 | Bacteria | 1359 |
| 500 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 501 | Ga0495687_017881 | 3300047443 | Bacteria | 3520 |
| 502 | Ga0495687_034200 | 3300047443 | Bacteria | 2298 |
| 503 | Ga0496102_0165509 | 3300048905 | Bacteria | 2081 |
| 504 | Ga0496103_0283746 | 3300048906 | Bacteria | 1065 |
| 505 | Ga0496112_0073060 | 3300048915 | Bacteria | 3391 |
| 506 | Ga0496113_1050740 | 3300048916 | Bacteria | 640 |
| 507 | Ga0496113_1448588 | 3300048916 | Bacteria | 531 |
| 508 | Ga0496114_0001657 | 3300048917 | Bacteria | 16887 |
| 509 | Ga0496114_1500718 | 3300048917 | Bacteria | 562 |
| 510 | Ga0496116_0014631 | 3300048919 | Bacteria | 6253 |
| 511 | Ga0496117_0022808 | 3300048920 | Bacteria | 5013 |
| 512 | Ga0496118_0006217 | 3300048921 | Bacteria | 13211 |
| 513 | Ga0496121_0002968 | 3300048924 | Bacteria | 24705 |
| 514 | Ga0496121_0249340 | 3300048924 | Bacteria | 1232 |
| 515 | Ga0496122_0000039 | 3300048925 | Bacteria | 295352 |
| 516 | Ga0496123_0000026 | 3300048926 | Bacteria | 318040 |
| 517 | Ga0496124_0032772 | 3300048927 | Bacteria | 4582 |
| 518 | Ga0496124_0306117 | 3300048927 | Bacteria | 1145 |
| 519 | Ga0496125_0058334 | 3300048928 | Bacteria | 3119 |
| 520 | Ga0496125_0114347 | 3300048928 | Bacteria | 1944 |
| 521 | Ga0501037_0649407 | 3300049573 | Unclassified | 705 |
| 522 | Ga0501038_0202790 | 3300049574 | Bacteria | 1591 |
| 523 | Ga0501039_0359806 | 3300049575 | Bacteria | 1143 |
| 524 | Ga0501043_0465413 | 3300049579 | Unclassified | 948 |
| 525 | Ga0501046_0757373 | 3300049580 | Bacteria | 682 |
| 526 | Ga0501249_001839 | 3300049679 | Bacteria | 4321 |
| 527 | Ga0501221_038092 | 3300049704 | Bacteria | 1038 |
| 528 | Ga0501225_0009489 | 3300049705 | Bacteria | 2768 |
| 529 | Ga0501262_000042 | 3300049759 | Bacteria | 16776 |
| 530 | Ga0501269_006202 | 3300049766 | Bacteria | 1440 |
| 531 | Ga0501035_0019463 | 3300049822 | Bacteria | 6242 |
| 532 | Ga0501044_0020301 | 3300049823 | Bacteria | 7091 |
| 533 | nmdc:mga03683_150667_c1 | 3300050489 | Bacteria | 1049 |
| 534 | nmdc:mga03683_229473_c1 | 3300050489 | Bacteria | 858 |
| 535 | nmdc:mga03683_270092_c1 | 3300050489 | Bacteria | 793 |
| 536 | nmdc:mga03683_348860_c1 | 3300050489 | Bacteria | 700 |
| 537 | nmdc:mga03683_667476_c1 | 3300050489 | Bacteria | 513 |
| 538 | nmdc:mga03n38_198939_c1 | 3300050490 | Bacteria | 1036 |
| 539 | nmdc:mga03n38_54842_c1 | 3300050490 | Bacteria | 1793 |
| 540 | nmdc:mga00v17_5334_c1 | 3300050491 | Bacteria | 6771 |
| 541 | nmdc:mga0yw44_251023_c1 | 3300050492 | Bacteria | 1177 |
| 542 | nmdc:mga0yw44_86079_c1 | 3300050492 | Bacteria | 1979 |
| 543 | nmdc:mga0k408_302159_c1 | 3300050493 | Bacteria | 955 |
| 544 | nmdc:mga0k408_34685_c1 | 3300050493 | Bacteria | 770 |
| 545 | nmdc:mga0k408_418613_c1 | 3300050493 | Bacteria | 797 |
| 546 | nmdc:mga06z11_143642_c1 | 3300050494 | Bacteria | 1351 |
| 547 | nmdc:mga04h51_138621_c1 | 3300050495 | Bacteria | 921 |
| 548 | nmdc:mga07m45_145905_c1 | 3300050496 | Bacteria | 1372 |
| 549 | nmdc:mga07m45_154243_c1 | 3300050496 | Bacteria | 1332 |
| 550 | nmdc:mga07m45_159_c1 | 3300050496 | Bacteria | 27066 |
| 551 | nmdc:mga07m45_88067_c1 | 3300050496 | Bacteria | 1777 |
| 552 | nmdc:mga0n895_229076_c1 | 3300050512 | Bacteria | 1886 |
| 553 | nmdc:mga0sz30_81306_c1 | 3300050516 | Bacteria | 1402 |
| 554 | Ga0500646_0065757 | 3300053090 | Bacteria | 1077 |
| 555 | Ga0500658_0489332 | 3300053134 | Bacteria | 558 |
| 556 | Ga0500616_0068248 | 3300053153 | Bacteria | 1822 |
| 557 | Ga0500616_0191940 | 3300053153 | Bacteria | 911 |
| 558 | Ga0500627_0225180 | 3300053158 | Bacteria | 836 |
| 559 | Ga0590071_011503 | 3300059421 | Bacteria | 2070 |
| 560 | Ga0590075_048819 | 3300059424 | Bacteria | 1085 |
| 561 | Ga0587077_009298 | 3300059493 | Bacteria | 1488 |
| 562 | Ga0587082_080726 | 3300059504 | Bacteria | 677 |
| 563 | Ga0587090_006132 | 3300059510 | Bacteria | 1533 |
| 564 | Ga0587090_010198 | 3300059510 | Bacteria | 1299 |
| 565 | Ga0587128_007279 | 3300059630 | Bacteria | 1392 |
| 566 | Ga0587128_012315 | 3300059630 | Bacteria | 1186 |
| 567 | Ga0587075_007701 | 3300059644 | Bacteria | 1359 |
| 568 | Ga0466962_0062261 | 3300061719 | Bacteria | 1781 |
| 569 | Ga0466962_0183128 | 3300061719 | Bacteria | 1021 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300022467 | Ga0224712_10062083 | Ga0224712_100620832 | 117 |
| 2 | 3300030731 | Ga0316177_1064101 | Ga0316177_10641012 | 118 |
| 3 | 3300030742 | Ga0316183_1071558 | Ga0316183_10715585 | 118 |
| 4 | 3300030744 | Ga0316181_1196510 | Ga0316181_11965101 | 118 |
| 5 | 3300005330 | Ga0070690_100112696 | Ga0070690_1001126962 | 119 |
| 6 | 3300005331 | Ga0070670_100000533 | Ga0070670_10000053318 | 119 |
| 7 | 3300005334 | Ga0068869_100000406 | Ga0068869_10000040611 | 119 |
| 8 | 3300005338 | Ga0068868_100049985 | Ga0068868_1000499852 | 119 |
| 9 | 3300005343 | Ga0070687_100013309 | Ga0070687_1000133094 | 119 |
| 10 | 3300005353 | Ga0070669_100008569 | Ga0070669_1000085696 | 119 |
| 11 | 3300005354 | Ga0070675_100273330 | Ga0070675_1002733303 | 119 |
| 12 | 3300005355 | Ga0070671_100380539 | Ga0070671_1003805392 | 119 |
| 13 | 3300005356 | Ga0070674_100598455 | Ga0070674_1005984551 | 119 |
| 14 | 3300005364 | Ga0070673_100061654 | Ga0070673_1000616544 | 119 |
| 15 | 3300005367 | Ga0070667_100003620 | Ga0070667_10000362012 | 119 |
| 16 | 3300005438 | Ga0070701_10499957 | Ga0070701_104999572 | 119 |
| 17 | 3300005455 | Ga0070663_101784200 | Ga0070663_1017842001 | 119 |
| 18 | 3300005456 | Ga0070678_101480722 | Ga0070678_1014807221 | 119 |
| 19 | 3300005457 | Ga0070662_100056358 | Ga0070662_1000563583 | 119 |
| 20 | 3300005459 | Ga0068867_100001139 | Ga0068867_1000011394 | 119 |
| 21 | 3300005543 | Ga0070672_100030513 | Ga0070672_1000305133 | 119 |
| 22 | 3300005545 | Ga0070695_101391885 | Ga0070695_1013918851 | 119 |
| 23 | 3300005564 | Ga0070664_100116728 | Ga0070664_1001167283 | 119 |
| 24 | 3300005577 | Ga0068857_100126615 | Ga0068857_1001266153 | 119 |
| 25 | 3300005617 | Ga0068859_100040426 | Ga0068859_1000404266 | 119 |
| 26 | 3300005618 | Ga0068864_100004785 | Ga0068864_10000478512 | 119 |
| 27 | 3300005719 | Ga0068861_100012836 | Ga0068861_1000128365 | 119 |
| 28 | 3300005834 | Ga0068851_10316999 | Ga0068851_103169992 | 119 |
| 29 | 3300005840 | Ga0068870_10057499 | Ga0068870_100574992 | 119 |
| 30 | 3300005841 | Ga0068863_100003307 | Ga0068863_10000330713 | 119 |
| 31 | 3300005842 | Ga0068858_100054415 | Ga0068858_1000544154 | 119 |
| 32 | 3300005843 | Ga0068860_100265386 | Ga0068860_1002653863 | 119 |
| 33 | 3300006358 | Ga0068871_100495812 | Ga0068871_1004958122 | 119 |
| 34 | 3300006881 | Ga0068865_100114582 | Ga0068865_1001145822 | 119 |
| 35 | 3300006931 | Ga0097620_100040424 | Ga0097620_1000404246 | 119 |
| 36 | 3300009101 | Ga0105247_10105670 | Ga0105247_101056703 | 119 |
| 37 | 3300009174 | Ga0105241_10821638 | Ga0105241_108216381 | 119 |
| 38 | 3300009177 | Ga0105248_10045430 | Ga0105248_100454304 | 119 |
| 39 | 3300010375 | Ga0105239_10931854 | Ga0105239_109318542 | 119 |
| 40 | 3300013297 | Ga0157378_10049080 | Ga0157378_100490804 | 119 |
| 41 | 3300013306 | Ga0163162_10186921 | Ga0163162_101869213 | 119 |
| 42 | 3300013308 | Ga0157375_10033632 | Ga0157375_100336325 | 119 |
| 43 | 3300014968 | Ga0157379_10000458 | Ga0157379_1000045811 | 119 |
| 44 | 3300014969 | Ga0157376_10234995 | Ga0157376_102349953 | 119 |
| 45 | 3300003322 | rootL2_10189271 | rootL2_101892713 | 121 |
| 46 | 3300005367 | Ga0070667_100538971 | Ga0070667_1005389712 | 121 |
| 47 | 3300005456 | Ga0070678_100605245 | Ga0070678_1006052452 | 121 |
| 48 | 3300005841 | Ga0068863_100270775 | Ga0068863_1002707752 | 121 |
| 49 | 3300006871 | Ga0075434_100230568 | Ga0075434_1002305683 | 121 |
| 50 | 3300009011 | Ga0105251_10075188 | Ga0105251_100751883 | 121 |
| 51 | 3300013296 | Ga0157374_10133865 | Ga0157374_101338652 | 121 |
| 52 | 3300013308 | Ga0157375_12719727 | Ga0157375_127197272 | 121 |
| 53 | 3300014325 | Ga0163163_10014439 | Ga0163163_100144397 | 121 |
| 54 | 3300014325 | Ga0163163_10028813 | Ga0163163_100288134 | 121 |
| 55 | 3300025941 | Ga0207711_10809168 | Ga0207711_108091682 | 121 |
| 56 | 3300025945 | Ga0207679_10388559 | Ga0207679_103885592 | 121 |
| 57 | 3300025986 | Ga0207658_10026500 | Ga0207658_100265003 | 121 |
| 58 | 3300026088 | Ga0207641_10571363 | Ga0207641_105713632 | 121 |
| 59 | 3300026121 | Ga0207683_10973805 | Ga0207683_109738052 | 121 |
| 60 | 3300028381 | Ga0268264_10261451 | Ga0268264_102614513 | 121 |
| 61 | 3300050512 | nmdc:mga0n895_229076_c1 | nmdc:mga0n895_229076_c1_1074_1487 | 121 |
| 62 | 3300005459 | Ga0068867_100214525 | Ga0068867_1002145253 | 122 |
| 63 | 3300006847 | Ga0075431_100974927 | Ga0075431_1009749272 | 122 |
| 64 | 3300026089 | Ga0207648_10224129 | Ga0207648_102241293 | 122 |
| 65 | 3300032133 | Ga0316583_10281273 | Ga0316583_102812731 | 122 |
| 66 | 3300044656 | Ga0466969_0052549 | Ga0466969_0052549_181_555 | 122 |
| 67 | 3300044683 | Ga0466965_0025588 | Ga0466965_0025588_1200_1574 | 122 |
| 68 | 3300044684 | Ga0466966_0090907 | Ga0466966_0090907_1260_1634 | 122 |
| 69 | 3300044693 | Ga0466961_0239704 | Ga0466961_0239704_489_863 | 122 |
| 70 | 3300045049 | Ga0466959_0100718 | Ga0466959_0100718_1208_1582 | 122 |
| 71 | 3300049580 | Ga0501046_0757373 | Ga0501046_0757373_11_397 | 122 |
| 72 | 3300059504 | Ga0587082_080726 | Ga0587082_080726_279_662 | 122 |
| 73 | 3300059510 | Ga0587090_010198 | Ga0587090_010198_569_952 | 122 |
| 74 | 3300059630 | Ga0587128_012315 | Ga0587128_012315_497_880 | 122 |
| 75 | 3300059644 | Ga0587075_007701 | Ga0587075_007701_495_878 | 122 |
| 76 | 3300061719 | Ga0466962_0062261 | Ga0466962_0062261_954_1328 | 122 |
| 77 | 3300005328 | Ga0070676_11157617 | Ga0070676_111576171 | 123 |
| 78 | 3300005330 | Ga0070690_101035656 | Ga0070690_1010356562 | 123 |
| 79 | 3300005354 | Ga0070675_101380628 | Ga0070675_1013806282 | 123 |
| 80 | 3300005365 | Ga0070688_100202753 | Ga0070688_1002027532 | 123 |
| 81 | 3300005367 | Ga0070667_100386876 | Ga0070667_1003868763 | 123 |
| 82 | 3300005456 | Ga0070678_100353695 | Ga0070678_1003536952 | 123 |
| 83 | 3300005459 | Ga0068867_100050990 | Ga0068867_1000509902 | 123 |
| 84 | 3300005544 | Ga0070686_100205867 | Ga0070686_1002058672 | 123 |
| 85 | 3300005615 | Ga0070702_100291566 | Ga0070702_1002915662 | 123 |
| 86 | 3300005617 | Ga0068859_100994660 | Ga0068859_1009946602 | 123 |
| 87 | 3300005618 | Ga0068864_100690169 | Ga0068864_1006901692 | 123 |
| 88 | 3300005718 | Ga0068866_10015561 | Ga0068866_100155611 | 123 |
| 89 | 3300005841 | Ga0068863_100053951 | Ga0068863_1000539512 | 123 |
| 90 | 3300005841 | Ga0068863_100329851 | Ga0068863_1003298512 | 123 |
| 91 | 3300005841 | Ga0068863_101053259 | Ga0068863_1010532592 | 123 |
| 92 | 3300005842 | Ga0068858_100076543 | Ga0068858_1000765432 | 123 |
| 93 | 3300005842 | Ga0068858_100263234 | Ga0068858_1002632342 | 123 |
| 94 | 3300005843 | Ga0068860_100144703 | Ga0068860_1001447032 | 123 |
| 95 | 3300005843 | Ga0068860_100167807 | Ga0068860_1001678073 | 123 |
| 96 | 3300005844 | Ga0068862_100343501 | Ga0068862_1003435012 | 123 |
| 97 | 3300006237 | Ga0097621_100072734 | Ga0097621_1000727342 | 123 |
| 98 | 3300006358 | Ga0068871_100776759 | Ga0068871_1007767592 | 123 |
| 99 | 3300006881 | Ga0068865_101146802 | Ga0068865_1011468022 | 123 |
| 100 | 3300006931 | Ga0097620_100994421 | Ga0097620_1009944212 | 123 |
| 101 | 3300009553 | Ga0105249_10938226 | Ga0105249_109382262 | 123 |
| 102 | 3300013297 | Ga0157378_10075997 | Ga0157378_100759975 | 123 |
| 103 | 3300013308 | Ga0157375_10023821 | Ga0157375_100238215 | 123 |
| 104 | 3300014326 | Ga0157380_10032686 | Ga0157380_100326862 | 123 |
| 105 | 3300014969 | Ga0157376_11099282 | Ga0157376_110992822 | 123 |
| 106 | 3300025938 | Ga0207704_10409435 | Ga0207704_104094352 | 123 |
| 107 | 3300025986 | Ga0207658_10291038 | Ga0207658_102910383 | 123 |
| 108 | 3300026041 | Ga0207639_10432561 | Ga0207639_104325613 | 123 |
| 109 | 3300026088 | Ga0207641_10747187 | Ga0207641_107471872 | 123 |
| 110 | 3300026088 | Ga0207641_10953351 | Ga0207641_109533512 | 123 |
| 111 | 3300026089 | Ga0207648_10011353 | Ga0207648_1001135310 | 123 |
| 112 | 3300026121 | Ga0207683_10821804 | Ga0207683_108218042 | 123 |
| 113 | 3300028381 | Ga0268264_10045905 | Ga0268264_100459052 | 123 |
| 114 | 3300028381 | Ga0268264_11510152 | Ga0268264_115101522 | 123 |
| 115 | 3300044658 | Ga0466972_0000073 | Ga0466972_0000073_25542_25919 | 123 |
| 116 | 3300048917 | Ga0496114_1500718 | Ga0496114_1500718_175_552 | 123 |
| 117 | iso_pu_bacteria | 2881927736 | 2881930594 | 123 |
| 118 | 3300005295 | Ga0065707_10200321 | Ga0065707_102003213 | 124 |
| 119 | 3300005331 | Ga0070670_100027021 | Ga0070670_1000270217 | 124 |
| 120 | 3300005331 | Ga0070670_100040589 | Ga0070670_1000405893 | 124 |
| 121 | 3300005336 | Ga0070680_101678104 | Ga0070680_1016781041 | 124 |
| 122 | 3300005343 | Ga0070687_100588948 | Ga0070687_1005889482 | 124 |
| 123 | 3300005344 | Ga0070661_100514904 | Ga0070661_1005149042 | 124 |
| 124 | 3300005347 | Ga0070668_100017834 | Ga0070668_1000178343 | 124 |
| 125 | 3300005353 | Ga0070669_100012132 | Ga0070669_1000121323 | 124 |
| 126 | 3300005354 | Ga0070675_100090529 | Ga0070675_1000905293 | 124 |
| 127 | 3300005355 | Ga0070671_100043399 | Ga0070671_1000433993 | 124 |
| 128 | 3300005356 | Ga0070674_100463617 | Ga0070674_1004636172 | 124 |
| 129 | 3300005364 | Ga0070673_100042478 | Ga0070673_1000424782 | 124 |
| 130 | 3300005364 | Ga0070673_100182935 | Ga0070673_1001829353 | 124 |
| 131 | 3300005367 | Ga0070667_100299802 | Ga0070667_1002998021 | 124 |
| 132 | 3300005367 | Ga0070667_100498353 | Ga0070667_1004983531 | 124 |
| 133 | 3300005436 | Ga0070713_100189900 | Ga0070713_1001899001 | 124 |
| 134 | 3300005437 | Ga0070710_10074023 | Ga0070710_100740231 | 124 |
| 135 | 3300005439 | Ga0070711_100132902 | Ga0070711_1001329022 | 124 |
| 136 | 3300005456 | Ga0070678_100720898 | Ga0070678_1007208982 | 124 |
| 137 | 3300005457 | Ga0070662_100021484 | Ga0070662_1000214841 | 124 |
| 138 | 3300005459 | Ga0068867_101004027 | Ga0068867_1010040271 | 124 |
| 139 | 3300005530 | Ga0070679_100434553 | Ga0070679_1004345532 | 124 |
| 140 | 3300005543 | Ga0070672_100000122 | Ga0070672_1000001225 | 124 |
| 141 | 3300005543 | Ga0070672_100229513 | Ga0070672_1002295133 | 124 |
| 142 | 3300005546 | Ga0070696_100026951 | Ga0070696_1000269513 | 124 |
| 143 | 3300005548 | Ga0070665_100253106 | Ga0070665_1002531062 | 124 |
| 144 | 3300005564 | Ga0070664_100507554 | Ga0070664_1005075542 | 124 |
| 145 | 3300005617 | Ga0068859_100744884 | Ga0068859_1007448842 | 124 |
| 146 | 3300005618 | Ga0068864_100084323 | Ga0068864_1000843233 | 124 |
| 147 | 3300005840 | Ga0068870_10638615 | Ga0068870_106386152 | 124 |
| 148 | 3300005840 | Ga0068870_11043444 | Ga0068870_110434442 | 124 |
| 149 | 3300005841 | Ga0068863_100029728 | Ga0068863_1000297284 | 124 |
| 150 | 3300005841 | Ga0068863_100073543 | Ga0068863_1000735432 | 124 |
| 151 | 3300005841 | Ga0068863_100309115 | Ga0068863_1003091152 | 124 |
| 152 | 3300005843 | Ga0068860_100083518 | Ga0068860_1000835182 | 124 |
| 153 | 3300005844 | Ga0068862_100170718 | Ga0068862_1001707182 | 124 |
| 154 | 3300005844 | Ga0068862_100803332 | Ga0068862_1008033322 | 124 |
| 155 | 3300005844 | Ga0068862_101025205 | Ga0068862_1010252052 | 124 |
| 156 | 3300006177 | Ga0075362_10197358 | Ga0075362_101973582 | 124 |
| 157 | 3300006358 | Ga0068871_100295055 | Ga0068871_1002950552 | 124 |
| 158 | 3300006881 | Ga0068865_100044739 | Ga0068865_1000447393 | 124 |
| 159 | 3300006931 | Ga0097620_100744885 | Ga0097620_1007448852 | 124 |
| 160 | 3300009093 | Ga0105240_10752336 | Ga0105240_107523362 | 124 |
| 161 | 3300009177 | Ga0105248_10421215 | Ga0105248_104212152 | 124 |
| 162 | 3300010375 | Ga0105239_10127965 | Ga0105239_101279655 | 124 |
| 163 | 3300013297 | Ga0157378_12609901 | Ga0157378_126099012 | 124 |
| 164 | 3300013306 | Ga0163162_10829743 | Ga0163162_108297432 | 124 |
| 165 | 3300013308 | Ga0157375_10172419 | Ga0157375_101724192 | 124 |
| 166 | 3300013308 | Ga0157375_10211196 | Ga0157375_102111964 | 124 |
| 167 | 3300014325 | Ga0163163_11258405 | Ga0163163_112584052 | 124 |
| 168 | 3300014968 | Ga0157379_11539449 | Ga0157379_115394491 | 124 |
| 169 | 3300014969 | Ga0157376_10175160 | Ga0157376_101751603 | 124 |
| 170 | 3300014969 | Ga0157376_10669715 | Ga0157376_106697151 | 124 |
| 171 | 3300017792 | Ga0163161_10084397 | Ga0163161_100843972 | 124 |
| 172 | 3300025315 | Ga0207697_10105967 | Ga0207697_101059672 | 124 |
| 173 | 3300025907 | Ga0207645_10185669 | Ga0207645_101856692 | 124 |
| 174 | 3300025908 | Ga0207643_10106404 | Ga0207643_101064043 | 124 |
| 175 | 3300025908 | Ga0207643_10846655 | Ga0207643_108466552 | 124 |
| 176 | 3300025918 | Ga0207662_10484563 | Ga0207662_104845632 | 124 |
| 177 | 3300025921 | Ga0207652_10452266 | Ga0207652_104522662 | 124 |
| 178 | 3300025923 | Ga0207681_10018212 | Ga0207681_100182123 | 124 |
| 179 | 3300025925 | Ga0207650_10036909 | Ga0207650_100369092 | 124 |
| 180 | 3300025925 | Ga0207650_10065500 | Ga0207650_100655002 | 124 |
| 181 | 3300025925 | Ga0207650_10304063 | Ga0207650_103040632 | 124 |
| 182 | 3300025926 | Ga0207659_10408638 | Ga0207659_104086382 | 124 |
| 183 | 3300025931 | Ga0207644_10029426 | Ga0207644_100294262 | 124 |
| 184 | 3300025938 | Ga0207704_10099725 | Ga0207704_100997251 | 124 |
| 185 | 3300025940 | Ga0207691_10001269 | Ga0207691_100012696 | 124 |
| 186 | 3300025940 | Ga0207691_10242089 | Ga0207691_102420892 | 124 |
| 187 | 3300025941 | Ga0207711_10028427 | Ga0207711_100284273 | 124 |
| 188 | 3300025941 | Ga0207711_10400307 | Ga0207711_104003072 | 124 |
| 189 | 3300025942 | Ga0207689_10211384 | Ga0207689_102113842 | 124 |
| 190 | 3300025945 | Ga0207679_10814964 | Ga0207679_108149642 | 124 |
| 191 | 3300025960 | Ga0207651_10016089 | Ga0207651_100160894 | 124 |
| 192 | 3300025960 | Ga0207651_10030527 | Ga0207651_100305272 | 124 |
| 193 | 3300025972 | Ga0207668_10002175 | Ga0207668_100021754 | 124 |
| 194 | 3300025972 | Ga0207668_10215271 | Ga0207668_102152712 | 124 |
| 195 | 3300025986 | Ga0207658_10029174 | Ga0207658_100291743 | 124 |
| 196 | 3300026023 | Ga0207677_10045500 | Ga0207677_100455002 | 124 |
| 197 | 3300026075 | Ga0207708_10481969 | Ga0207708_104819692 | 124 |
| 198 | 3300026088 | Ga0207641_10103199 | Ga0207641_101031993 | 124 |
| 199 | 3300026088 | Ga0207641_11029959 | Ga0207641_110299591 | 124 |
| 200 | 3300026089 | Ga0207648_11168374 | Ga0207648_111683741 | 124 |
| 201 | 3300026095 | Ga0207676_10067022 | Ga0207676_100670222 | 124 |
| 202 | 3300026118 | Ga0207675_101667957 | Ga0207675_1016679571 | 124 |
| 203 | 3300026121 | Ga0207683_10577310 | Ga0207683_105773102 | 124 |
| 204 | 3300028380 | Ga0268265_10112944 | Ga0268265_101129442 | 124 |
| 205 | 3300028380 | Ga0268265_10159718 | Ga0268265_101597182 | 124 |
| 206 | 3300028381 | Ga0268264_10160046 | Ga0268264_101600462 | 124 |
| 207 | 3300031238 | Ga0265332_10009346 | Ga0265332_100093464 | 124 |
| 208 | 3300031595 | Ga0265313_10066529 | Ga0265313_100665292 | 124 |
| 209 | 3300031665 | Ga0316575_10156966 | Ga0316575_101569662 | 124 |
| 210 | 3300031691 | Ga0316579_10000031 | Ga0316579_100000313 | 124 |
| 211 | 3300031691 | Ga0316579_10022550 | Ga0316579_100225504 | 124 |
| 212 | 3300031728 | Ga0316578_10009234 | Ga0316578_100092342 | 124 |
| 213 | 3300031730 | Ga0307516_10000497 | Ga0307516_1000049740 | 124 |
| 214 | 3300031733 | Ga0316577_10050834 | Ga0316577_100508344 | 124 |
| 215 | 3300032133 | Ga0316583_10009548 | Ga0316583_100095484 | 124 |
| 216 | 3300032133 | Ga0316583_10034495 | Ga0316583_100344952 | 124 |
| 217 | 3300032168 | Ga0316593_10026821 | Ga0316593_100268213 | 124 |
| 218 | 3300032168 | Ga0316593_10028851 | Ga0316593_100288512 | 124 |
| 219 | 3300032168 | Ga0316593_10047561 | Ga0316593_100475612 | 124 |
| 220 | 3300035398 | Ga0316574_0056355 | Ga0316574_0056355_789_1169 | 124 |
| 221 | 3300036647 | Ga0316582_0002941 | Ga0316582_0002941_6510_6893 | 124 |
| 222 | 3300036647 | Ga0316582_0092144 | Ga0316582_0092144_882_1265 | 124 |
| 223 | 3300036712 | Ga0316584_0023830 | Ga0316584_0023830_3238_3621 | 124 |
| 224 | 3300036712 | Ga0316584_0413979 | Ga0316584_0413979_303_686 | 124 |
| 225 | 3300037312 | Ga0395899_0219850 | Ga0395899_0219850_167_550 | 124 |
| 226 | 3300037312 | Ga0395899_0228049 | Ga0395899_0228049_132_515 | 124 |
| 227 | 3300037418 | Ga0395900_0023607 | Ga0395900_0023607_3712_4095 | 124 |
| 228 | 3300037471 | Ga0395905_0014027 | Ga0395905_0014027_3845_4228 | 124 |
| 229 | 3300037588 | Ga0316581_0010445 | Ga0316581_0010445_777_1160 | 124 |
| 230 | 3300038443 | Ga0395901_0605522 | Ga0395901_0605522_593_976 | 124 |
| 231 | 3300041460 | Ga0451802_0805532 | Ga0451802_0805532_681_1061 | 124 |
| 232 | 3300041486 | Ga0451807_0023713 | Ga0451807_0023713_285_665 | 124 |
| 233 | 3300041509 | Ga0451843_0193779 | Ga0451843_0193779_68_448 | 124 |
| 234 | 3300042437 | Ga0439444_0197363 | Ga0439444_0197363_47_427 | 124 |
| 235 | 3300042876 | Ga0451577_0121026 | Ga0451577_0121026_1902_2282 | 124 |
| 236 | 3300042876 | Ga0451577_1039927 | Ga0451577_1039927_338_718 | 124 |
| 237 | 3300044673 | Ga0453683_0389715 | Ga0453683_0389715_306_686 | 124 |
| 238 | 3300044712 | Ga0453684_0000163 | Ga0453684_0000163_30421_30801 | 124 |
| 239 | 3300044712 | Ga0453684_0031445 | Ga0453684_0031445_457_837 | 124 |
| 240 | 3300045051 | Ga0451576_0010764 | Ga0451576_0010764_2463_2843 | 124 |
| 241 | 3300045051 | Ga0451576_0101670 | Ga0451576_0101670_721_1101 | 124 |
| 242 | 3300045051 | Ga0451576_0483065 | Ga0451576_0483065_623_1006 | 124 |
| 243 | 3300046528 | Ga0495642_0008464 | Ga0495642_0008464_481_936 | 124 |
| 244 | 3300049575 | Ga0501039_0359806 | Ga0501039_0359806_628_1008 | 124 |
| 245 | 3300050489 | nmdc:mga03683_229473_c1 | nmdc:mga03683_229473_c1_159_539 | 124 |
| 246 | 3300050489 | nmdc:mga03683_270092_c1 | nmdc:mga03683_270092_c1_56_445 | 124 |
| 247 | 3300053134 | Ga0500658_0489332 | Ga0500658_0489332_112_492 | 124 |
| 248 | 3300053158 | Ga0500627_0225180 | Ga0500627_0225180_409_807 | 124 |
| 249 | 3300005331 | Ga0070670_100005607 | Ga0070670_1000056075 | 125 |
| 250 | 3300005337 | Ga0070682_100090713 | Ga0070682_1000907132 | 125 |
| 251 | 3300005339 | Ga0070660_100014671 | Ga0070660_1000146718 | 125 |
| 252 | 3300005343 | Ga0070687_100270753 | Ga0070687_1002707531 | 125 |
| 253 | 3300005344 | Ga0070661_100007314 | Ga0070661_1000073146 | 125 |
| 254 | 3300005347 | Ga0070668_100122893 | Ga0070668_1001228932 | 125 |
| 255 | 3300005353 | Ga0070669_100642606 | Ga0070669_1006426061 | 125 |
| 256 | 3300005354 | Ga0070675_101282440 | Ga0070675_1012824401 | 125 |
| 257 | 3300005365 | Ga0070688_100599656 | Ga0070688_1005996562 | 125 |
| 258 | 3300005366 | Ga0070659_100023938 | Ga0070659_1000239386 | 125 |
| 259 | 3300005367 | Ga0070667_101325974 | Ga0070667_1013259741 | 125 |
| 260 | 3300005455 | Ga0070663_101459400 | Ga0070663_1014594002 | 125 |
| 261 | 3300005456 | Ga0070678_102118239 | Ga0070678_1021182391 | 125 |
| 262 | 3300005548 | Ga0070665_100440486 | Ga0070665_1004404861 | 125 |
| 263 | 3300005564 | Ga0070664_100035103 | Ga0070664_1000351032 | 125 |
| 264 | 3300005564 | Ga0070664_100281049 | Ga0070664_1002810493 | 125 |
| 265 | 3300005617 | Ga0068859_100394718 | Ga0068859_1003947183 | 125 |
| 266 | 3300005618 | Ga0068864_100002029 | Ga0068864_1000020296 | 125 |
| 267 | 3300005618 | Ga0068864_100079774 | Ga0068864_1000797742 | 125 |
| 268 | 3300005719 | Ga0068861_100926217 | Ga0068861_1009262172 | 125 |
| 269 | 3300005841 | Ga0068863_100004930 | Ga0068863_1000049308 | 125 |
| 270 | 3300005843 | Ga0068860_100284706 | Ga0068860_1002847063 | 125 |
| 271 | 3300005844 | Ga0068862_100865241 | Ga0068862_1008652412 | 125 |
| 272 | 3300006931 | Ga0097620_100394728 | Ga0097620_1003947281 | 125 |
| 273 | 3300009098 | Ga0105245_11622759 | Ga0105245_116227592 | 125 |
| 274 | 3300009553 | Ga0105249_11852762 | Ga0105249_118527621 | 125 |
| 275 | 3300013296 | Ga0157374_11513265 | Ga0157374_115132652 | 125 |
| 276 | 3300013297 | Ga0157378_11044904 | Ga0157378_110449041 | 125 |
| 277 | 3300013306 | Ga0163162_10195652 | Ga0163162_101956522 | 125 |
| 278 | 3300025901 | Ga0207688_10495819 | Ga0207688_104958192 | 125 |
| 279 | 3300025918 | Ga0207662_10619647 | Ga0207662_106196472 | 125 |
| 280 | 3300025919 | Ga0207657_10016643 | Ga0207657_100166434 | 125 |
| 281 | 3300025920 | Ga0207649_10003885 | Ga0207649_100038856 | 125 |
| 282 | 3300025925 | Ga0207650_10004071 | Ga0207650_100040713 | 125 |
| 283 | 3300025925 | Ga0207650_11236665 | Ga0207650_112366651 | 125 |
| 284 | 3300025926 | Ga0207659_10680902 | Ga0207659_106809022 | 125 |
| 285 | 3300025932 | Ga0207690_10010241 | Ga0207690_100102412 | 125 |
| 286 | 3300025945 | Ga0207679_10002279 | Ga0207679_100022796 | 125 |
| 287 | 3300025960 | Ga0207651_10494912 | Ga0207651_104949122 | 125 |
| 288 | 3300025972 | Ga0207668_10238781 | Ga0207668_102387811 | 125 |
| 289 | 3300026067 | Ga0207678_10329572 | Ga0207678_103295722 | 125 |
| 290 | 3300026088 | Ga0207641_10005203 | Ga0207641_100052034 | 125 |
| 291 | 3300026095 | Ga0207676_10002773 | Ga0207676_100027737 | 125 |
| 292 | 3300026095 | Ga0207676_10521367 | Ga0207676_105213672 | 125 |
| 293 | 3300026118 | Ga0207675_101286864 | Ga0207675_1012868642 | 125 |
| 294 | 3300028381 | Ga0268264_10278590 | Ga0268264_102785902 | 125 |
| 295 | 3300037471 | Ga0395905_0000455 | Ga0395905_0000455_21274_21660 | 125 |
| 296 | 3300041410 | Ga0439461_0025782 | Ga0439461_0025782_621_1001 | 125 |
| 297 | 3300041413 | Ga0439465_0050740 | Ga0439465_0050740_841_1221 | 125 |
| 298 | 3300042131 | Ga0450894_006032 | Ga0450894_006032_1016_1396 | 125 |
| 299 | 3300042156 | Ga0439446_0010182 | Ga0439446_0010182_855_1235 | 125 |
| 300 | 3300042435 | Ga0439434_0107969 | Ga0439434_0107969_234_614 | 125 |
| 301 | 3300042532 | Ga0450893_0136812 | Ga0450893_0136812_23_403 | 125 |
| 302 | 3300044658 | Ga0466972_0321334 | Ga0466972_0321334_40_423 | 125 |
| 303 | 3300044693 | Ga0466961_0455503 | Ga0466961_0455503_243_626 | 125 |
| 304 | 3300044706 | Ga0466964_0043257 | Ga0466964_0043257_741_1124 | 125 |
| 305 | 3300044719 | Ga0466971_0031657 | Ga0466971_0031657_204_587 | 125 |
| 306 | 3300044901 | Ga0466960_0075337 | Ga0466960_0075337_207_590 | 125 |
| 307 | 3300045049 | Ga0466959_0037184 | Ga0466959_0037184_1285_1668 | 125 |
| 308 | 3300048915 | Ga0496112_0073060 | Ga0496112_0073060_1468_1881 | 125 |
| 309 | 3300048916 | Ga0496113_1448588 | Ga0496113_1448588_30_443 | 125 |
| 310 | 3300049573 | Ga0501037_0649407 | Ga0501037_0649407_176_559 | 125 |
| 311 | 3300049574 | Ga0501038_0202790 | Ga0501038_0202790_283_666 | 125 |
| 312 | 3300049579 | Ga0501043_0465413 | Ga0501043_0465413_250_633 | 125 |
| 313 | 3300049822 | Ga0501035_0019463 | Ga0501035_0019463_5274_5657 | 125 |
| 314 | 3300049823 | Ga0501044_0020301 | Ga0501044_0020301_6469_6852 | 125 |
| 315 | 3300059421 | Ga0590071_011503 | Ga0590071_011503_414_800 | 125 |
| 316 | 3300059424 | Ga0590075_048819 | Ga0590075_048819_674_1060 | 125 |
| 317 | 3300059493 | Ga0587077_009298 | Ga0587077_009298_548_931 | 125 |
| 318 | 3300059510 | Ga0587090_006132 | Ga0587090_006132_592_975 | 125 |
| 319 | 3300059630 | Ga0587128_007279 | Ga0587128_007279_557_940 | 125 |
| 320 | 3300061719 | Ga0466962_0183128 | Ga0466962_0183128_154_537 | 125 |
| 321 | iso_pu_bacteria | 2842677519 | 2842678446 | 125 |
| 322 | iso_pu_bacteria | 2919462493 | 2919465128 | 125 |
| 323 | iso_pu_bacteria | 2643221628 | 2644162526 | 126 |
| 324 | 3300042000 | Ga0439437_038609 | Ga0439437_038609_18_410 | 127 |
| 325 | 3300046522 | Ga0495643_0026684 | Ga0495643_0026684_878_1336 | 127 |
| 326 | 3300046542 | Ga0495597_0083934 | Ga0495597_0083934_305_763 | 127 |
| 327 | 3300047443 | Ga0495687_034200 | Ga0495687_034200_597_1055 | 127 |
| 328 | iso_pu_bacteria | 2513020051 | 2513229022 | 127 |
| 329 | iso_pu_bacteria | 2643221658 | 2644329090 | 127 |
| 330 | iso_pu_bacteria | 2643221672 | 2644401817 | 127 |
| 331 | 3300027665 | Ga0209983_1008978 | Ga0209983_10089782 | 128 |
| 332 | 3300031548 | Ga0307408_101357582 | Ga0307408_1013575822 | 128 |
| 333 | 3300031911 | Ga0307412_11780004 | Ga0307412_117800042 | 128 |
| 334 | iso_pu_bacteria | 2945972063 | 2945977841 | 128 |
| 335 | 3300015261 | Ga0182006_1026985 | Ga0182006_10269854 | 129 |
| 336 | 3300015683 | Ga0183362_10002 | Ga0183362_10002503 | 129 |
| 337 | 3300027252 | Ga0209973_1007964 | Ga0209973_10079641 | 129 |
| 338 | 3300030732 | Ga0316176_1095815 | Ga0316176_10958157 | 129 |
| 339 | 3300030734 | Ga0316179_1108004 | Ga0316179_11080043 | 129 |
| 340 | 3300030735 | Ga0316178_1073154 | Ga0316178_10731547 | 129 |
| 341 | 3300030736 | Ga0316180_1106339 | Ga0316180_11063393 | 129 |
| 342 | 3300030742 | Ga0316183_1037632 | Ga0316183_10376326 | 129 |
| 343 | 3300030744 | Ga0316181_1032171 | Ga0316181_10321715 | 129 |
| 344 | 3300031548 | Ga0307408_100237352 | Ga0307408_1002373523 | 129 |
| 345 | 3300031731 | Ga0307405_10581436 | Ga0307405_105814361 | 129 |
| 346 | 3300031731 | Ga0307405_10608725 | Ga0307405_106087252 | 129 |
| 347 | 3300031824 | Ga0307413_10256059 | Ga0307413_102560591 | 129 |
| 348 | 3300031901 | Ga0307406_10145519 | Ga0307406_101455192 | 129 |
| 349 | 3300031911 | Ga0307412_10099584 | Ga0307412_100995844 | 129 |
| 350 | 3300031911 | Ga0307412_10215434 | Ga0307412_102154343 | 129 |
| 351 | 3300032002 | Ga0307416_100215494 | Ga0307416_1002154943 | 129 |
| 352 | 3300032004 | Ga0307414_11276756 | Ga0307414_112767561 | 129 |
| 353 | 3300037471 | Ga0395905_0029176 | Ga0395905_0029176_90_587 | 129 |
| 354 | 3300041997 | Ga0439431_0149367 | Ga0439431_0149367_109_522 | 129 |
| 355 | 3300048924 | Ga0496121_0002968 | Ga0496121_0002968_16876_17271 | 129 |
| 356 | 3300048928 | Ga0496125_0114347 | Ga0496125_0114347_832_1257 | 129 |
| 357 | 3300049679 | Ga0501249_001839 | Ga0501249_001839_647_1051 | 129 |
| 358 | 3300049704 | Ga0501221_038092 | Ga0501221_038092_33_437 | 129 |
| 359 | 3300049705 | Ga0501225_0009489 | Ga0501225_0009489_2163_2567 | 129 |
| 360 | 3300049759 | Ga0501262_000042 | Ga0501262_000042_2669_3073 | 129 |
| 361 | 3300049766 | Ga0501269_006202 | Ga0501269_006202_820_1224 | 129 |
| 362 | iso_pu_bacteria | 2929520902 | 2929525208 | 129 |
| 363 | 3300003773 | Ga0055537_1000241 | Ga0055537_10002417 | 130 |
| 364 | 3300003775 | Ga0055524_1000378 | Ga0055524_100037825 | 130 |
| 365 | 3300003781 | Ga0055536_1000488 | Ga0055536_10004886 | 130 |
| 366 | 3300003784 | Ga0055534_1000232 | Ga0055534_100023228 | 130 |
| 367 | 3300003790 | Ga0055528_1000324 | Ga0055528_100032428 | 130 |
| 368 | 3300003790 | Ga0055528_1028323 | Ga0055528_10283233 | 130 |
| 369 | 3300003791 | Ga0055530_10005929 | Ga0055530_100059293 | 130 |
| 370 | 3300003792 | Ga0055540_1000174 | Ga0055540_100017414 | 130 |
| 371 | 3300003794 | Ga0055531_10000217 | Ga0055531_1000021743 | 130 |
| 372 | 3300005288 | Ga0065714_10002707 | Ga0065714_100027077 | 130 |
| 373 | 3300005327 | Ga0070658_10266738 | Ga0070658_102667382 | 130 |
| 374 | 3300005334 | Ga0068869_100736068 | Ga0068869_1007360682 | 130 |
| 375 | 3300005366 | Ga0070659_100614658 | Ga0070659_1006146581 | 130 |
| 376 | 3300005457 | Ga0070662_100005367 | Ga0070662_1000053674 | 130 |
| 377 | 3300005459 | Ga0068867_100097127 | Ga0068867_1000971273 | 130 |
| 378 | 3300005539 | Ga0068853_100210244 | Ga0068853_1002102442 | 130 |
| 379 | 3300005577 | Ga0068857_100550082 | Ga0068857_1005500822 | 130 |
| 380 | 3300005578 | Ga0068854_100260546 | Ga0068854_1002605462 | 130 |
| 381 | 3300006038 | Ga0075365_10019767 | Ga0075365_100197674 | 130 |
| 382 | 3300006042 | Ga0075368_10242961 | Ga0075368_102429612 | 130 |
| 383 | 3300006048 | Ga0075363_100017059 | Ga0075363_1000170594 | 130 |
| 384 | 3300006048 | Ga0075363_100634715 | Ga0075363_1006347152 | 130 |
| 385 | 3300006051 | Ga0075364_10001534 | Ga0075364_100015344 | 130 |
| 386 | 3300006058 | Ga0075432_10015262 | Ga0075432_100152621 | 130 |
| 387 | 3300006058 | Ga0075432_10016068 | Ga0075432_100160682 | 130 |
| 388 | 3300006177 | Ga0075362_10005878 | Ga0075362_100058784 | 130 |
| 389 | 3300006177 | Ga0075362_10018060 | Ga0075362_100180604 | 130 |
| 390 | 3300006177 | Ga0075362_10160366 | Ga0075362_101603661 | 130 |
| 391 | 3300006177 | Ga0075362_10632702 | Ga0075362_106327021 | 130 |
| 392 | 3300006178 | Ga0075367_10086305 | Ga0075367_100863052 | 130 |
| 393 | 3300006178 | Ga0075367_10208094 | Ga0075367_102080943 | 130 |
| 394 | 3300006178 | Ga0075367_10656534 | Ga0075367_106565342 | 130 |
| 395 | 3300006195 | Ga0075366_10008816 | Ga0075366_100088164 | 130 |
| 396 | 3300006195 | Ga0075366_10146196 | Ga0075366_101461963 | 130 |
| 397 | 3300006195 | Ga0075366_10391574 | Ga0075366_103915741 | 130 |
| 398 | 3300006195 | Ga0075366_10474018 | Ga0075366_104740182 | 130 |
| 399 | 3300006237 | Ga0097621_100320284 | Ga0097621_1003202843 | 130 |
| 400 | 3300006353 | Ga0075370_10000574 | Ga0075370_100005746 | 130 |
| 401 | 3300006353 | Ga0075370_10006076 | Ga0075370_100060763 | 130 |
| 402 | 3300006353 | Ga0075370_10044981 | Ga0075370_100449813 | 130 |
| 403 | 3300006358 | Ga0068871_100067773 | Ga0068871_1000677734 | 130 |
| 404 | 3300006948 | Ga0099826_10007477 | Ga0099826_100074775 | 130 |
| 405 | 3300006948 | Ga0099826_10081533 | Ga0099826_100815333 | 130 |
| 406 | 3300009036 | Ga0105244_10000473 | Ga0105244_1000047315 | 130 |
| 407 | 3300009148 | Ga0105243_10017643 | Ga0105243_100176437 | 130 |
| 408 | 3300009545 | Ga0105237_10938300 | Ga0105237_109383002 | 130 |
| 409 | 3300009551 | Ga0105238_10166661 | Ga0105238_101666612 | 130 |
| 410 | 3300013100 | Ga0157373_10044079 | Ga0157373_100440793 | 130 |
| 411 | 3300014497 | Ga0182008_10002559 | Ga0182008_100025597 | 130 |
| 412 | 3300014969 | Ga0157376_10056473 | Ga0157376_100564732 | 130 |
| 413 | 3300015261 | Ga0182006_1010239 | Ga0182006_10102394 | 130 |
| 414 | 3300015262 | Ga0182007_10000630 | Ga0182007_100006304 | 130 |
| 415 | 3300017792 | Ga0163161_10019186 | Ga0163161_100191865 | 130 |
| 416 | 3300025263 | Ga0209565_1000269 | Ga0209565_100026911 | 130 |
| 417 | 3300025263 | Ga0209565_1016792 | Ga0209565_10167922 | 130 |
| 418 | 3300025273 | Ga0209673_1000640 | Ga0209673_100064011 | 130 |
| 419 | 3300025273 | Ga0209673_1004228 | Ga0209673_10042286 | 130 |
| 420 | 3300025291 | Ga0209675_1000252 | Ga0209675_100025211 | 130 |
| 421 | 3300025291 | Ga0209675_1011408 | Ga0209675_10114084 | 130 |
| 422 | 3300025292 | Ga0209676_1000152 | Ga0209676_100015245 | 130 |
| 423 | 3300025292 | Ga0209676_1101651 | Ga0209676_11016511 | 130 |
| 424 | 3300025294 | Ga0209025_1006234 | Ga0209025_10062344 | 130 |
| 425 | 3300025298 | Ga0209050_1000210 | Ga0209050_1000210121 | 130 |
| 426 | 3300025299 | Ga0209256_1000092 | Ga0209256_1000092175 | 130 |
| 427 | 3300025303 | Ga0209051_1000074 | Ga0209051_1000074120 | 130 |
| 428 | 3300025303 | Ga0209051_1121512 | Ga0209051_11215122 | 130 |
| 429 | 3300025304 | Ga0209257_1000072 | Ga0209257_1000072121 | 130 |
| 430 | 3300025728 | Ga0207655_1003447 | Ga0207655_10034473 | 130 |
| 431 | 3300025914 | Ga0207671_10965514 | Ga0207671_109655141 | 130 |
| 432 | 3300025924 | Ga0207694_10178499 | Ga0207694_101784992 | 130 |
| 433 | 3300025927 | Ga0207687_11493552 | Ga0207687_114935521 | 130 |
| 434 | 3300025932 | Ga0207690_10715639 | Ga0207690_107156392 | 130 |
| 435 | 3300025933 | Ga0207706_10012799 | Ga0207706_100127992 | 130 |
| 436 | 3300025934 | Ga0207686_10846617 | Ga0207686_108466171 | 130 |
| 437 | 3300025935 | Ga0207709_10000793 | Ga0207709_1000079322 | 130 |
| 438 | 3300025942 | Ga0207689_10360279 | Ga0207689_103602792 | 130 |
| 439 | 3300025942 | Ga0207689_10994590 | Ga0207689_109945902 | 130 |
| 440 | 3300026089 | Ga0207648_10154622 | Ga0207648_101546223 | 130 |
| 441 | 3300027666 | Ga0209282_1004503 | Ga0209282_10045037 | 130 |
| 442 | 3300027907 | Ga0207428_10142336 | Ga0207428_101423361 | 130 |
| 443 | 3300030733 | Ga0314311_1187413 | Ga0314311_11874135 | 130 |
| 444 | 3300031731 | Ga0307405_10402858 | Ga0307405_104028582 | 130 |
| 445 | 3300031903 | Ga0307407_10123187 | Ga0307407_101231873 | 130 |
| 446 | 3300031911 | Ga0307412_10444558 | Ga0307412_104445581 | 130 |
| 447 | 3300031911 | Ga0307412_11556679 | Ga0307412_115566792 | 130 |
| 448 | 3300031995 | Ga0307409_100290249 | Ga0307409_1002902492 | 130 |
| 449 | 3300032002 | Ga0307416_101811752 | Ga0307416_1018117522 | 130 |
| 450 | 3300032004 | Ga0307414_10482449 | Ga0307414_104824492 | 130 |
| 451 | 3300032004 | Ga0307414_10715744 | Ga0307414_107157442 | 130 |
| 452 | 3300032005 | Ga0307411_10279208 | Ga0307411_102792082 | 130 |
| 453 | 3300032005 | Ga0307411_10598671 | Ga0307411_105986712 | 130 |
| 454 | 3300032126 | Ga0307415_100226450 | Ga0307415_1002264502 | 130 |
| 455 | 3300032168 | Ga0316593_10124615 | Ga0316593_101246151 | 130 |
| 456 | 3300041404 | Ga0439436_0103098 | Ga0439436_0103098_104_517 | 130 |
| 457 | 3300041411 | Ga0439466_0025115 | Ga0439466_0025115_752_1165 | 130 |
| 458 | 3300041413 | Ga0439465_0071484 | Ga0439465_0071484_114_527 | 130 |
| 459 | 3300041451 | Ga0451791_0231617 | Ga0451791_0231617_100_561 | 130 |
| 460 | 3300041452 | Ga0451793_1676247 | Ga0451793_1676247_149_610 | 130 |
| 461 | 3300042002 | Ga0439442_024383 | Ga0439442_024383_710_1123 | 130 |
| 462 | 3300042004 | Ga0439445_0073181 | Ga0439445_0073181_210_623 | 130 |
| 463 | 3300042121 | Ga0450919_006111 | Ga0450919_006111_492_905 | 130 |
| 464 | 3300042125 | Ga0450923_011732 | Ga0450923_011732_717_1130 | 130 |
| 465 | 3300042127 | Ga0450890_039348 | Ga0450890_039348_24_437 | 130 |
| 466 | 3300042133 | Ga0450896_063960 | Ga0450896_063960_124_537 | 130 |
| 467 | 3300042145 | Ga0450906_003616 | Ga0450906_003616_1731_2144 | 130 |
| 468 | 3300042147 | Ga0450910_003638 | Ga0450910_003638_1261_1674 | 130 |
| 469 | 3300042156 | Ga0439446_0026896 | Ga0439446_0026896_647_1060 | 130 |
| 470 | 3300042184 | Ga0450908_030040 | Ga0450908_030040_340_753 | 130 |
| 471 | 3300042435 | Ga0439434_0001996 | Ga0439434_0001996_3544_3957 | 130 |
| 472 | 3300042531 | Ga0450918_000965 | Ga0450918_000965_5483_5896 | 130 |
| 473 | 3300042532 | Ga0450893_0017575 | Ga0450893_0017575_73_486 | 130 |
| 474 | 3300046471 | Ga0495650_0017971 | Ga0495650_0017971_437_865 | 130 |
| 475 | 3300046660 | Ga0495625_0000012 | Ga0495625_0000012_174708_175121 | 130 |
| 476 | 3300047443 | Ga0495687_017881 | Ga0495687_017881_649_1146 | 130 |
| 477 | 3300048905 | Ga0496102_0165509 | Ga0496102_0165509_1257_1664 | 130 |
| 478 | 3300048906 | Ga0496103_0283746 | Ga0496103_0283746_644_1051 | 130 |
| 479 | 3300048917 | Ga0496114_0001657 | Ga0496114_0001657_14838_15266 | 130 |
| 480 | 3300048919 | Ga0496116_0014631 | Ga0496116_0014631_147_554 | 130 |
| 481 | 3300048920 | Ga0496117_0022808 | Ga0496117_0022808_2531_2938 | 130 |
| 482 | 3300048921 | Ga0496118_0006217 | Ga0496118_0006217_9628_10035 | 130 |
| 483 | 3300048924 | Ga0496121_0249340 | Ga0496121_0249340_90_497 | 130 |
| 484 | 3300048927 | Ga0496124_0306117 | Ga0496124_0306117_447_854 | 130 |
| 485 | 3300048928 | Ga0496125_0058334 | Ga0496125_0058334_2226_2633 | 130 |
| 486 | 3300050489 | nmdc:mga03683_150667_c1 | nmdc:mga03683_150667_c1_461_865 | 130 |
| 487 | 3300050489 | nmdc:mga03683_348860_c1 | nmdc:mga03683_348860_c1_193_600 | 130 |
| 488 | 3300050489 | nmdc:mga03683_667476_c1 | nmdc:mga03683_667476_c1_64_471 | 130 |
| 489 | 3300050490 | nmdc:mga03n38_54842_c1 | nmdc:mga03n38_54842_c1_1121_1525 | 130 |
| 490 | 3300050491 | nmdc:mga00v17_5334_c1 | nmdc:mga00v17_5334_c1_2666_3073 | 130 |
| 491 | 3300050492 | nmdc:mga0yw44_86079_c1 | nmdc:mga0yw44_86079_c1_1392_1799 | 130 |
| 492 | 3300050493 | nmdc:mga0k408_302159_c1 | nmdc:mga0k408_302159_c1_87_494 | 130 |
| 493 | 3300050493 | nmdc:mga0k408_34685_c1 | nmdc:mga0k408_34685_c1_235_648 | 130 |
| 494 | 3300050493 | nmdc:mga0k408_418613_c1 | nmdc:mga0k408_418613_c1_378_782 | 130 |
| 495 | 3300050494 | nmdc:mga06z11_143642_c1 | nmdc:mga06z11_143642_c1_677_1084 | 130 |
| 496 | 3300050496 | nmdc:mga07m45_145905_c1 | nmdc:mga07m45_145905_c1_776_1183 | 130 |
| 497 | 3300050496 | nmdc:mga07m45_159_c1 | nmdc:mga07m45_159_c1_8190_8597 | 130 |
| 498 | 3300050496 | nmdc:mga07m45_88067_c1 | nmdc:mga07m45_88067_c1_479_883 | 130 |
| 499 | iso_pu_bacteria | 2842747753 | 2842750328 | 130 |
| 500 | iso_pu_bacteria | 2904449895 | 2904455000 | 130 |
| 501 | iso_pu_bacteria | 2904456579 | 2904457362 | 130 |
| 502 | iso_pu_bacteria | 2904541872 | 2904550059 | 130 |
| 503 | iso_pu_bacteria | 2929160207 | 2929166553 | 130 |
| 504 | iso_pu_bacteria | 2954767861 | 2954772796 | 130 |
| 505 | 3300003322 | rootL2_10138106 | rootL2_101381062 | 131 |
| 506 | 3300006186 | Ga0075369_10199921 | Ga0075369_101999212 | 131 |
| 507 | 3300027866 | Ga0209813_10117890 | Ga0209813_101178902 | 131 |
| 508 | 3300050495 | nmdc:mga04h51_138621_c1 | nmdc:mga04h51_138621_c1_253_660 | 131 |
| 509 | 3300014497 | Ga0182008_10019529 | Ga0182008_100195292 | 132 |
| 510 | 3300015261 | Ga0182006_1254925 | Ga0182006_12549252 | 132 |
| 511 | 3300015262 | Ga0182007_10000192 | Ga0182007_1000019240 | 132 |
| 512 | 3300026142 | Ga0207698_10930496 | Ga0207698_109304962 | 132 |
| 513 | 3300031649 | Ga0307514_10030669 | Ga0307514_100306695 | 132 |
| 514 | 3300031731 | Ga0307405_10185802 | Ga0307405_101858022 | 132 |
| 515 | 3300031901 | Ga0307406_10017287 | Ga0307406_100172873 | 132 |
| 516 | 3300031911 | Ga0307412_10296651 | Ga0307412_102966512 | 132 |
| 517 | 3300003187 | JGI25151J46595_10001326 | JGI25151J46595_100013265 | 133 |
| 518 | 3300005328 | Ga0070676_10143556 | Ga0070676_101435563 | 133 |
| 519 | 3300005347 | Ga0070668_100449778 | Ga0070668_1004497782 | 133 |
| 520 | 3300005355 | Ga0070671_101481368 | Ga0070671_1014813682 | 133 |
| 521 | 3300005456 | Ga0070678_100078238 | Ga0070678_1000782383 | 133 |
| 522 | 3300005616 | Ga0068852_102088355 | Ga0068852_1020883552 | 133 |
| 523 | 3300005618 | Ga0068864_101486276 | Ga0068864_1014862762 | 133 |
| 524 | 3300006048 | Ga0075363_100134273 | Ga0075363_1001342732 | 133 |
| 525 | 3300006186 | Ga0075369_10031713 | Ga0075369_100317134 | 133 |
| 526 | 3300014497 | Ga0182008_10000374 | Ga0182008_100003745 | 133 |
| 527 | 3300025294 | Ga0209025_1000973 | Ga0209025_100097317 | 133 |
| 528 | 3300025907 | Ga0207645_10139830 | Ga0207645_101398302 | 133 |
| 529 | 3300026121 | Ga0207683_10035169 | Ga0207683_100351693 | 133 |
| 530 | 3300028379 | Ga0268266_10009652 | Ga0268266_100096525 | 133 |
| 531 | 3300031456 | Ga0307513_10292932 | Ga0307513_102929322 | 133 |
| 532 | 3300031548 | Ga0307408_100006090 | Ga0307408_1000060907 | 133 |
| 533 | 3300031548 | Ga0307408_100299510 | Ga0307408_1002995102 | 133 |
| 534 | 3300031731 | Ga0307405_11156511 | Ga0307405_111565112 | 133 |
| 535 | 3300031911 | Ga0307412_12048322 | Ga0307412_120483221 | 133 |
| 536 | 3300032005 | Ga0307411_10559543 | Ga0307411_105595432 | 133 |
| 537 | 3300041460 | Ga0451802_1837356 | Ga0451802_1837356_88_546 | 133 |
| 538 | 3300050490 | nmdc:mga03n38_198939_c1 | nmdc:mga03n38_198939_c1_425_862 | 133 |
| 539 | 3300050516 | nmdc:mga0sz30_81306_c1 | nmdc:mga0sz30_81306_c1_652_1089 | 133 |
| 540 | 3300053153 | Ga0500616_0068248 | Ga0500616_0068248_15_422 | 133 |
| 541 | 3300053153 | Ga0500616_0191940 | Ga0500616_0191940_454_861 | 133 |
| 542 | 3300003578 | Ga0006562J51391_1181789 | Ga0006562J51391_11817893 | 134 |
| 543 | 3300003578 | Ga0006562J51391_1181790 | Ga0006562J51391_11817903 | 134 |
| 544 | 3300003792 | Ga0055540_1001670 | Ga0055540_10016707 | 134 |
| 545 | 3300005289 | Ga0065704_10096167 | Ga0065704_100961675 | 134 |
| 546 | 3300005353 | Ga0070669_100001456 | Ga0070669_1000014567 | 134 |
| 547 | 3300005547 | Ga0070693_100560166 | Ga0070693_1005601661 | 134 |
| 548 | 3300006038 | Ga0075365_10585502 | Ga0075365_105855021 | 134 |
| 549 | 3300006051 | Ga0075364_10946292 | Ga0075364_109462921 | 134 |
| 550 | 3300013104 | Ga0157370_11018146 | Ga0157370_110181462 | 134 |
| 551 | 3300014497 | Ga0182008_10000675 | Ga0182008_100006757 | 134 |
| 552 | 3300014497 | Ga0182008_10048929 | Ga0182008_100489293 | 134 |
| 553 | 3300014497 | Ga0182008_10113869 | Ga0182008_101138692 | 134 |
| 554 | 3300015261 | Ga0182006_1094806 | Ga0182006_10948062 | 134 |
| 555 | 3300015262 | Ga0182007_10085958 | Ga0182007_100859582 | 134 |
| 556 | 3300015265 | Ga0182005_1032295 | Ga0182005_10322952 | 134 |
| 557 | 3300025292 | Ga0209676_1075433 | Ga0209676_10754332 | 134 |
| 558 | 3300025303 | Ga0209051_1000397 | Ga0209051_10003977 | 134 |
| 559 | 3300025923 | Ga0207681_10006381 | Ga0207681_100063813 | 134 |
| 560 | 3300030745 | Ga0316182_1397043 | Ga0316182_13970435 | 134 |
| 561 | 3300031649 | Ga0307514_10002271 | Ga0307514_1000227110 | 134 |
| 562 | 3300041453 | Ga0451797_0485924 | Ga0451797_0485924_169_588 | 134 |
| 563 | 3300041456 | Ga0451795_1550194 | Ga0451795_1550194_74_535 | 134 |
| 564 | 3300046530 | Ga0495654_0154246 | Ga0495654_0154246_148_609 | 134 |
| 565 | 3300048916 | Ga0496113_1050740 | Ga0496113_1050740_100_561 | 134 |
| 566 | 3300048925 | Ga0496122_0000039 | Ga0496122_0000039_57991_58452 | 134 |
| 567 | 3300048926 | Ga0496123_0000026 | Ga0496123_0000026_58087_58548 | 134 |
| 568 | 3300048927 | Ga0496124_0032772 | Ga0496124_0032772_1985_2446 | 134 |
| 569 | 3300050492 | nmdc:mga0yw44_251023_c1 | nmdc:mga0yw44_251023_c1_35_496 | 134 |
| 570 | 3300050496 | nmdc:mga07m45_154243_c1 | nmdc:mga07m45_154243_c1_102_542 | 134 |
| 571 | 3300053090 | Ga0500646_0065757 | Ga0500646_0065757_240_701 | 134 |
| 572 | 3300042156 | Ga0439446_0084780 | Ga0439446_0084780_254_673 | 135 |
| 573 | 3300002987 | JGI25159J45721_1045723 | JGI25159J45721_10457231 | 137 |
| 574 | 3300003781 | Ga0055536_1006774 | Ga0055536_10067747 | 137 |
| 575 | 3300003781 | Ga0055536_1008209 | Ga0055536_10082094 | 137 |
| 576 | 3300003784 | Ga0055534_1000516 | Ga0055534_100051615 | 137 |
| 577 | 3300005262 | Ga0065165_1157570 | Ga0065165_11575701 | 137 |
| 578 | 3300025284 | Ga0209130_1001875 | Ga0209130_100187511 | 137 |
| 579 | 3300025291 | Ga0209675_1001009 | Ga0209675_10010094 | 137 |
| 580 | 3300025292 | Ga0209676_1001899 | Ga0209676_100189916 | 137 |
| 581 | 3300025294 | Ga0209025_1026745 | Ga0209025_10267452 | 137 |
| 582 | 3300025298 | Ga0209050_1005555 | Ga0209050_100555512 | 137 |
| 583 | 3300025303 | Ga0209051_1004338 | Ga0209051_10043389 | 137 |
| 584 | 3300025304 | Ga0209257_1012460 | Ga0209257_10124603 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3n3e-assembly1.cif.gz_B | zebrafish alphaa crystallin | 0.855 | 32 | 123 |
| 2cg9-assembly1.cif.gz_Y | crystal structure of an hsp90-sba1 closed chaperone complex | 0.8523 | 30 | 122 |
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.8442 | 30 | 121 |
| 5zul-assembly1.cif.gz_E-2 | small heat shock protein from mycobacterium marinum m : form-3 | 0.8413 | 30 | 120 |
| 2h50-assembly1.cif.gz_P | multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 | 0.8351 | 32 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0GKS6_4_99_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8902 | 31 | 115 | 2.60.40.790 |
| af_F4HWW7_1_102_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8738 | 31 | 121 | 2.60.40.790 |
| af_I1MKZ4_1_104_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8629 | 31 | 121 | 2.60.40.790 |
| af_F1QZY5_45_141_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8613 | 31 | 123 | 2.60.40.790 |
| 2cg9Y01 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8523 | 30 | 122 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D5BZM4-F1-model_v4 | Heat shock protein Hsp20 | 0.8633 | 22 | 135 |
|
| AF-C4ANX2-F1-model_v4 | deleted | 0.8531 | 34 | 135 |
|
| AF-A0A3A4R451-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8493 | 30 | 136 |
|
| AF-A0A7Y4RBM7-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8486 | 30 | 135 |
|
| AF-A0A7C6DJZ5-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8389 | 31 | 133 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar