F466338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 237 | 581 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100039751|Ga0070662_1000397512 |
| Length | 345 |
| Sequence | MLHFHSEERSANRRAADSKETPMSVLEAEAPVSRNDHAKFHKLIATAQKHAPVKVAVAHPCDQVSLESVIEAANLKLIEPILVGPEQRIREVAAKHALDISRFEIVDAEYSQESAEKAVALVREGRAEALMKGSLHTDEVMAAVVKRETGLRTSRRVSHCFVMDVPGHDQPLIITDAAVNIAPDLKAKVDITQNAIDLAHALSPGDIRVAILSAMESVNPDVPSTLEAAALCKMAERGQITGAVLDGPLALDNAISMEAAAIKKIKSPVAGRANVLVVPDLEAGNMLAKSLSFLAGADAAGIVLGARVPVILTSRADDERARLASCAVAQLLVAARRADASAAIQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 2 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 3 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 234 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 236 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0.68 |
| Isolates | 0.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0 |
| Rhizoplane | 9.25 |
| Rhizosphere | 87.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10011860 | 3300001991 | Bacteria | 1578 |
| 2 | JGI25153J46596_10023647 | 3300003215 | Bacteria | 2234 |
| 3 | Ga0007417J51691_1018961 | 3300003544 | Bacteria | 6330 |
| 4 | Ga0007429J51699_1032193 | 3300003579 | Bacteria | 6854 |
| 5 | JGI25404J52841_10010491 | 3300003659 | Bacteria | 1992 |
| 6 | Ga0032354_1009780 | 3300003693 | Bacteria | 6947 |
| 7 | Ga0006780_1034692 | 3300003735 | Bacteria | 2809 |
| 8 | Ga0055537_1001075 | 3300003773 | Bacteria | 12107 |
| 9 | Ga0055524_1003687 | 3300003775 | Bacteria | 7331 |
| 10 | Ga0055528_1002814 | 3300003790 | Bacteria | 9099 |
| 11 | Ga0065712_10072445 | 3300005290 | Bacteria | 4751 |
| 12 | Ga0065715_10142795 | 3300005293 | Bacteria | 1828 |
| 13 | Ga0070658_10008251 | 3300005327 | Bacteria | 8381 |
| 14 | Ga0070658_10012543 | 3300005327 | Bacteria | 6799 |
| 15 | Ga0070658_10087173 | 3300005327 | Bacteria | 2569 |
| 16 | Ga0070658_10456593 | 3300005327 | Bacteria | 1101 |
| 17 | Ga0070676_10064858 | 3300005328 | Bacteria | 2179 |
| 18 | Ga0070683_100124783 | 3300005329 | Bacteria | 2433 |
| 19 | Ga0070690_100003185 | 3300005330 | Bacteria | 8950 |
| 20 | Ga0070670_100000038 | 3300005331 | Bacteria | 153333 |
| 21 | Ga0070670_100000333 | 3300005331 | Bacteria | 39598 |
| 22 | Ga0070670_100004518 | 3300005331 | Bacteria | 11661 |
| 23 | Ga0070670_100005006 | 3300005331 | Bacteria | 11148 |
| 24 | Ga0070670_100029590 | 3300005331 | Bacteria | 4715 |
| 25 | Ga0070670_100036812 | 3300005331 | Bacteria | 4210 |
| 26 | Ga0070670_100056676 | 3300005331 | Bacteria | 3363 |
| 27 | Ga0070670_100064443 | 3300005331 | Bacteria | 3144 |
| 28 | Ga0070670_100100501 | 3300005331 | Bacteria | 2490 |
| 29 | Ga0070670_100112649 | 3300005331 | Bacteria | 2345 |
| 30 | Ga0070670_100163025 | 3300005331 | Bacteria | 1932 |
| 31 | Ga0070670_100177569 | 3300005331 | Bacteria | 1848 |
| 32 | Ga0070670_100371759 | 3300005331 | Bacteria | 1258 |
| 33 | Ga0070677_10001797 | 3300005333 | Bacteria | 6785 |
| 34 | Ga0070677_10076333 | 3300005333 | Bacteria | 1423 |
| 35 | Ga0070666_10003297 | 3300005335 | Bacteria | 9785 |
| 36 | Ga0070666_10006841 | 3300005335 | Bacteria | 7024 |
| 37 | Ga0070666_10013709 | 3300005335 | Bacteria | 5146 |
| 38 | Ga0068868_100022702 | 3300005338 | Bacteria | 4740 |
| 39 | Ga0068868_100141245 | 3300005338 | Bacteria | 1977 |
| 40 | Ga0070660_100025931 | 3300005339 | Bacteria | 4361 |
| 41 | Ga0070660_100031481 | 3300005339 | Bacteria | 3984 |
| 42 | Ga0070660_100082475 | 3300005339 | Bacteria | 2525 |
| 43 | Ga0070689_100007475 | 3300005340 | Bacteria | 7643 |
| 44 | Ga0070687_100002574 | 3300005343 | Bacteria | 6841 |
| 45 | Ga0070687_100216966 | 3300005343 | Bacteria | 1169 |
| 46 | Ga0070661_100000545 | 3300005344 | Bacteria | 28860 |
| 47 | Ga0070661_100011423 | 3300005344 | Bacteria | 6186 |
| 48 | Ga0070661_100043849 | 3300005344 | Bacteria | 3267 |
| 49 | Ga0070661_100059618 | 3300005344 | Bacteria | 2799 |
| 50 | Ga0070668_100000224 | 3300005347 | Bacteria | 36476 |
| 51 | Ga0070668_100037144 | 3300005347 | Bacteria | 3718 |
| 52 | Ga0070669_100004592 | 3300005353 | Bacteria | 9968 |
| 53 | Ga0070669_100012310 | 3300005353 | Bacteria | 6069 |
| 54 | Ga0070669_100085162 | 3300005353 | Bacteria | 2360 |
| 55 | Ga0070669_100131406 | 3300005353 | Bacteria | 1921 |
| 56 | Ga0070669_100195412 | 3300005353 | Bacteria | 1589 |
| 57 | Ga0070675_100001409 | 3300005354 | Bacteria | 17655 |
| 58 | Ga0070675_100017025 | 3300005354 | Bacteria | 5777 |
| 59 | Ga0070671_100001770 | 3300005355 | Bacteria | 16415 |
| 60 | Ga0070671_100009558 | 3300005355 | Bacteria | 7790 |
| 61 | Ga0070671_100009655 | 3300005355 | Bacteria | 7752 |
| 62 | Ga0070671_100016988 | 3300005355 | Bacteria | 5884 |
| 63 | Ga0070671_100021172 | 3300005355 | Bacteria | 5309 |
| 64 | Ga0070671_100037871 | 3300005355 | Bacteria | 4002 |
| 65 | Ga0070671_100050603 | 3300005355 | Bacteria | 3455 |
| 66 | Ga0070671_100060715 | 3300005355 | Bacteria | 3148 |
| 67 | Ga0070671_100066803 | 3300005355 | Bacteria | 2997 |
| 68 | Ga0070671_100122423 | 3300005355 | Bacteria | 2189 |
| 69 | Ga0070671_100194281 | 3300005355 | Bacteria | 1720 |
| 70 | Ga0070674_100013581 | 3300005356 | Bacteria | 5039 |
| 71 | Ga0070674_100079318 | 3300005356 | Bacteria | 2342 |
| 72 | Ga0070674_100366179 | 3300005356 | Bacteria | 1168 |
| 73 | Ga0070673_100000300 | 3300005364 | Bacteria | 25842 |
| 74 | Ga0070673_100026432 | 3300005364 | Bacteria | 4287 |
| 75 | Ga0070673_100039479 | 3300005364 | Bacteria | 3613 |
| 76 | Ga0070673_100114494 | 3300005364 | Bacteria | 2241 |
| 77 | Ga0070659_100002628 | 3300005366 | Bacteria | 12778 |
| 78 | Ga0070659_100276291 | 3300005366 | Bacteria | 1397 |
| 79 | Ga0070667_100000106 | 3300005367 | Bacteria | 106516 |
| 80 | Ga0070667_100010153 | 3300005367 | Bacteria | 7786 |
| 81 | Ga0070667_100014598 | 3300005367 | Bacteria | 6491 |
| 82 | Ga0070713_100010826 | 3300005436 | Bacteria | 6610 |
| 83 | Ga0070713_100134896 | 3300005436 | Bacteria | 2180 |
| 84 | Ga0070710_10016878 | 3300005437 | Bacteria | 3726 |
| 85 | Ga0070701_10054270 | 3300005438 | Bacteria | 2089 |
| 86 | Ga0070705_100002258 | 3300005440 | Bacteria | 9756 |
| 87 | Ga0070663_100016283 | 3300005455 | Bacteria | 4824 |
| 88 | Ga0070663_100020564 | 3300005455 | Bacteria | 4371 |
| 89 | Ga0070663_100178664 | 3300005455 | Bacteria | 1645 |
| 90 | Ga0070678_100007469 | 3300005456 | Bacteria | 6488 |
| 91 | Ga0070678_100047649 | 3300005456 | Bacteria | 3081 |
| 92 | Ga0070678_100131068 | 3300005456 | Bacteria | 1992 |
| 93 | Ga0070662_100009297 | 3300005457 | Bacteria | 6424 |
| 94 | Ga0070662_100010863 | 3300005457 | Bacteria | 5996 |
| 95 | Ga0070662_100011838 | 3300005457 | Bacteria | 5767 |
| 96 | Ga0070662_100016370 | 3300005457 | Bacteria | 4977 |
| 97 | Ga0070662_100039751 | 3300005457 | Bacteria | 3346 |
| 98 | Ga0070662_100051656 | 3300005457 | Bacteria | 2969 |
| 99 | Ga0070662_100058817 | 3300005457 | Bacteria | 2798 |
| 100 | Ga0070662_100086952 | 3300005457 | Bacteria | 2339 |
| 101 | Ga0070662_100091954 | 3300005457 | Bacteria | 2279 |
| 102 | Ga0070662_100099363 | 3300005457 | Bacteria | 2199 |
| 103 | Ga0070662_100176156 | 3300005457 | Bacteria | 1683 |
| 104 | Ga0070662_100242281 | 3300005457 | Bacteria | 1447 |
| 105 | Ga0070681_10186457 | 3300005458 | Bacteria | 1995 |
| 106 | Ga0070681_10234716 | 3300005458 | Bacteria | 1748 |
| 107 | Ga0068867_100038272 | 3300005459 | Bacteria | 3491 |
| 108 | Ga0070685_10120290 | 3300005466 | Bacteria | 1630 |
| 109 | Ga0070679_100042606 | 3300005530 | Bacteria | 4521 |
| 110 | Ga0070684_100084908 | 3300005535 | Bacteria | 2807 |
| 111 | Ga0070684_100276264 | 3300005535 | Bacteria | 1539 |
| 112 | Ga0068853_100165091 | 3300005539 | Bacteria | 2001 |
| 113 | Ga0070672_100002941 | 3300005543 | Bacteria | 10965 |
| 114 | Ga0070672_100012862 | 3300005543 | Bacteria | 5896 |
| 115 | Ga0070672_100016004 | 3300005543 | Bacteria | 5360 |
| 116 | Ga0070672_100020844 | 3300005543 | Bacteria | 4787 |
| 117 | Ga0070672_100024407 | 3300005543 | Bacteria | 4468 |
| 118 | Ga0070672_100095935 | 3300005543 | Bacteria | 2399 |
| 119 | Ga0070686_100001982 | 3300005544 | Bacteria | 11363 |
| 120 | Ga0070686_100025720 | 3300005544 | Bacteria | 3544 |
| 121 | Ga0070665_100000294 | 3300005548 | Bacteria | 78909 |
| 122 | Ga0070664_100000558 | 3300005564 | Bacteria | 28520 |
| 123 | Ga0070664_100005749 | 3300005564 | Bacteria | 10002 |
| 124 | Ga0070664_100064312 | 3300005564 | Bacteria | 3129 |
| 125 | Ga0070664_100082862 | 3300005564 | Bacteria | 2766 |
| 126 | Ga0070664_100083601 | 3300005564 | Bacteria | 2754 |
| 127 | Ga0070664_100154814 | 3300005564 | Bacteria | 2025 |
| 128 | Ga0070664_100200865 | 3300005564 | Bacteria | 1779 |
| 129 | Ga0070664_100500666 | 3300005564 | Bacteria | 1120 |
| 130 | Ga0068857_100011361 | 3300005577 | Bacteria | 7746 |
| 131 | Ga0068857_100208162 | 3300005577 | Bacteria | 1784 |
| 132 | Ga0068854_100010732 | 3300005578 | Bacteria | 5945 |
| 133 | Ga0068854_100025193 | 3300005578 | Bacteria | 4081 |
| 134 | Ga0068856_100317584 | 3300005614 | Bacteria | 1575 |
| 135 | Ga0068856_100378877 | 3300005614 | Bacteria | 1434 |
| 136 | Ga0068852_100012269 | 3300005616 | Bacteria | 6497 |
| 137 | Ga0068859_100313446 | 3300005617 | Bacteria | 1662 |
| 138 | Ga0068864_100000065 | 3300005618 | Bacteria | 118170 |
| 139 | Ga0068864_100000487 | 3300005618 | Bacteria | 34323 |
| 140 | Ga0068864_100004640 | 3300005618 | Bacteria | 11267 |
| 141 | Ga0068864_100010436 | 3300005618 | Bacteria | 7675 |
| 142 | Ga0068864_100025311 | 3300005618 | Bacteria | 4997 |
| 143 | Ga0068864_100068693 | 3300005618 | Bacteria | 3079 |
| 144 | Ga0068864_100199075 | 3300005618 | Bacteria | 1839 |
| 145 | Ga0068864_100343726 | 3300005618 | Bacteria | 1406 |
| 146 | Ga0068866_10081486 | 3300005718 | Bacteria | 1738 |
| 147 | Ga0068861_100429171 | 3300005719 | Bacteria | 1179 |
| 148 | Ga0068851_10020008 | 3300005834 | Bacteria | 3237 |
| 149 | Ga0068863_100000226 | 3300005841 | Bacteria | 59763 |
| 150 | Ga0068863_100011300 | 3300005841 | Bacteria | 8647 |
| 151 | Ga0068863_100013452 | 3300005841 | Bacteria | 7891 |
| 152 | Ga0068863_100053573 | 3300005841 | Bacteria | 3824 |
| 153 | Ga0068863_100390971 | 3300005841 | Bacteria | 1359 |
| 154 | Ga0068858_100010061 | 3300005842 | Bacteria | 8980 |
| 155 | Ga0068858_100439317 | 3300005842 | Bacteria | 1257 |
| 156 | Ga0068860_100000191 | 3300005843 | Bacteria | 97369 |
| 157 | Ga0068860_100020147 | 3300005843 | Bacteria | 6463 |
| 158 | Ga0068860_100023182 | 3300005843 | Bacteria | 6001 |
| 159 | Ga0068860_100076617 | 3300005843 | Bacteria | 3181 |
| 160 | Ga0068860_100370068 | 3300005843 | Bacteria | 1413 |
| 161 | Ga0068862_100000351 | 3300005844 | Bacteria | 49912 |
| 162 | Ga0081540_1001103 | 3300005983 | Bacteria | 23924 |
| 163 | Ga0081540_1002217 | 3300005983 | Bacteria | 16033 |
| 164 | Ga0070712_100009973 | 3300006175 | Bacteria | 5987 |
| 165 | Ga0070712_100112069 | 3300006175 | Bacteria | 2038 |
| 166 | Ga0070712_100213507 | 3300006175 | Bacteria | 1523 |
| 167 | Ga0097621_100013044 | 3300006237 | Bacteria | 6178 |
| 168 | Ga0097621_100107302 | 3300006237 | Bacteria | 2356 |
| 169 | Ga0068871_100052468 | 3300006358 | Bacteria | 3302 |
| 170 | Ga0068871_100075801 | 3300006358 | Bacteria | 2777 |
| 171 | Ga0068871_100238791 | 3300006358 | Bacteria | 1579 |
| 172 | Ga0075428_100024288 | 3300006844 | Bacteria | 6705 |
| 173 | Ga0068865_100020904 | 3300006881 | Bacteria | 4250 |
| 174 | Ga0068865_100080157 | 3300006881 | Bacteria | 2340 |
| 175 | Ga0068865_100083834 | 3300006881 | Bacteria | 2295 |
| 176 | Ga0097620_100313439 | 3300006931 | Bacteria | 1662 |
| 177 | Ga0105240_10001450 | 3300009093 | Bacteria | 40534 |
| 178 | Ga0105240_10021752 | 3300009093 | Bacteria | 8523 |
| 179 | Ga0105240_10273920 | 3300009093 | Bacteria | 1942 |
| 180 | Ga0111539_10230394 | 3300009094 | Bacteria | 2157 |
| 181 | Ga0111539_10239315 | 3300009094 | Bacteria | 2113 |
| 182 | Ga0111539_10431339 | 3300009094 | Bacteria | 1535 |
| 183 | Ga0105245_10026405 | 3300009098 | Bacteria | 5111 |
| 184 | Ga0105245_10050563 | 3300009098 | Bacteria | 3726 |
| 185 | Ga0105241_10004888 | 3300009174 | Bacteria | 9883 |
| 186 | Ga0105241_10126078 | 3300009174 | Bacteria | 2067 |
| 187 | Ga0105242_10068003 | 3300009176 | Bacteria | 2946 |
| 188 | Ga0105248_10001528 | 3300009177 | Bacteria | 25762 |
| 189 | Ga0105248_10002100 | 3300009177 | Bacteria | 22075 |
| 190 | Ga0105248_10009072 | 3300009177 | Bacteria | 10937 |
| 191 | Ga0105248_10010223 | 3300009177 | Bacteria | 10331 |
| 192 | Ga0105248_10017754 | 3300009177 | Bacteria | 7849 |
| 193 | Ga0105248_10060005 | 3300009177 | Bacteria | 4271 |
| 194 | Ga0105248_10102106 | 3300009177 | Bacteria | 3233 |
| 195 | Ga0105248_10216217 | 3300009177 | Bacteria | 2158 |
| 196 | Ga0105248_10264893 | 3300009177 | Bacteria | 1935 |
| 197 | Ga0105238_10058255 | 3300009551 | Bacteria | 3872 |
| 198 | Ga0105249_10000765 | 3300009553 | Bacteria | 28895 |
| 199 | Ga0105249_10000982 | 3300009553 | Bacteria | 25267 |
| 200 | Ga0105239_10025535 | 3300010375 | Bacteria | 6504 |
| 201 | Ga0105239_10289122 | 3300010375 | Bacteria | 1846 |
| 202 | Ga0157373_10031648 | 3300013100 | Bacteria | 3807 |
| 203 | Ga0157371_10000585 | 3300013102 | Bacteria | 43238 |
| 204 | Ga0157371_10131138 | 3300013102 | Bacteria | 1783 |
| 205 | Ga0157378_10001666 | 3300013297 | Bacteria | 20065 |
| 206 | Ga0157378_10092217 | 3300013297 | Bacteria | 2756 |
| 207 | Ga0157378_10267822 | 3300013297 | Bacteria | 1642 |
| 208 | Ga0163162_10000590 | 3300013306 | Bacteria | 33723 |
| 209 | Ga0163162_10011425 | 3300013306 | Bacteria | 8658 |
| 210 | Ga0163162_10129598 | 3300013306 | Bacteria | 2631 |
| 211 | Ga0157375_10007360 | 3300013308 | Bacteria | 9638 |
| 212 | Ga0157375_10007958 | 3300013308 | Bacteria | 9280 |
| 213 | Ga0157375_10139321 | 3300013308 | Bacteria | 2552 |
| 214 | Ga0157375_10327805 | 3300013308 | Bacteria | 1696 |
| 215 | Ga0163163_10120025 | 3300014325 | Bacteria | 2662 |
| 216 | Ga0163163_10122468 | 3300014325 | Bacteria | 2635 |
| 217 | Ga0157380_10005457 | 3300014326 | Bacteria | 8885 |
| 218 | Ga0157380_10015277 | 3300014326 | Bacteria | 5640 |
| 219 | Ga0157380_10035011 | 3300014326 | Bacteria | 3876 |
| 220 | Ga0157380_10059072 | 3300014326 | Bacteria | 3059 |
| 221 | Ga0157380_10183039 | 3300014326 | Bacteria | 1842 |
| 222 | Ga0157380_10245189 | 3300014326 | Bacteria | 1618 |
| 223 | Ga0157377_10000555 | 3300014745 | Bacteria | 15690 |
| 224 | Ga0157379_10063427 | 3300014968 | Bacteria | 3304 |
| 225 | Ga0157376_10000627 | 3300014969 | Bacteria | 22898 |
| 226 | Ga0157376_10060483 | 3300014969 | Bacteria | 3181 |
| 227 | Ga0163161_10002499 | 3300017792 | Bacteria | 13116 |
| 228 | Ga0163161_10052637 | 3300017792 | Bacteria | 2951 |
| 229 | Ga0163161_10063782 | 3300017792 | Bacteria | 2686 |
| 230 | Ga0163161_10086768 | 3300017792 | Bacteria | 2310 |
| 231 | Ga0163161_10088747 | 3300017792 | Bacteria | 2285 |
| 232 | Ga0209565_1000429 | 3300025263 | Bacteria | 33769 |
| 233 | Ga0209673_1000895 | 3300025273 | Bacteria | 38370 |
| 234 | Ga0209564_1021950 | 3300025295 | Bacteria | 2273 |
| 235 | Ga0209758_1012668 | 3300025297 | Bacteria | 4690 |
| 236 | Ga0209256_1001309 | 3300025299 | Bacteria | 26742 |
| 237 | Ga0209256_1003185 | 3300025299 | Bacteria | 11885 |
| 238 | Ga0207697_10008313 | 3300025315 | Bacteria | 4552 |
| 239 | Ga0207682_10000111 | 3300025893 | Bacteria | 37550 |
| 240 | Ga0207682_10000662 | 3300025893 | Bacteria | 16097 |
| 241 | Ga0207682_10063210 | 3300025893 | Bacteria | 1553 |
| 242 | Ga0207682_10102251 | 3300025893 | Bacteria | 1254 |
| 243 | Ga0207692_10071259 | 3300025898 | Bacteria | 1832 |
| 244 | Ga0207710_10004942 | 3300025900 | Bacteria | 5777 |
| 245 | Ga0207688_10000076 | 3300025901 | Bacteria | 37517 |
| 246 | Ga0207688_10104369 | 3300025901 | Bacteria | 1640 |
| 247 | Ga0207680_10007728 | 3300025903 | Bacteria | 5254 |
| 248 | Ga0207680_10048496 | 3300025903 | Bacteria | 2523 |
| 249 | Ga0207680_10083609 | 3300025903 | Bacteria | 2012 |
| 250 | Ga0207680_10111604 | 3300025903 | Bacteria | 1774 |
| 251 | Ga0207647_10008421 | 3300025904 | Bacteria | 7397 |
| 252 | Ga0207645_10000016 | 3300025907 | Bacteria | 114058 |
| 253 | Ga0207645_10026740 | 3300025907 | Bacteria | 3728 |
| 254 | Ga0207643_10000010 | 3300025908 | Bacteria | 159218 |
| 255 | Ga0207643_10245719 | 3300025908 | Bacteria | 1101 |
| 256 | Ga0207705_10008872 | 3300025909 | Bacteria | 7327 |
| 257 | Ga0207705_10023151 | 3300025909 | Bacteria | 4431 |
| 258 | Ga0207695_10275582 | 3300025913 | Bacteria | 1577 |
| 259 | Ga0207693_10033175 | 3300025915 | Bacteria | 4075 |
| 260 | Ga0207693_10327561 | 3300025915 | Bacteria | 1199 |
| 261 | Ga0207660_10066237 | 3300025917 | Bacteria | 2612 |
| 262 | Ga0207662_10000014 | 3300025918 | Bacteria | 85091 |
| 263 | Ga0207657_10000060 | 3300025919 | Bacteria | 101953 |
| 264 | Ga0207657_10012932 | 3300025919 | Bacteria | 8207 |
| 265 | Ga0207657_10062553 | 3300025919 | Bacteria | 3186 |
| 266 | Ga0207657_10242271 | 3300025919 | Bacteria | 1439 |
| 267 | Ga0207649_10001207 | 3300025920 | Bacteria | 15583 |
| 268 | Ga0207649_10006237 | 3300025920 | Bacteria | 6477 |
| 269 | Ga0207649_10014785 | 3300025920 | Bacteria | 4377 |
| 270 | Ga0207649_10018547 | 3300025920 | Bacteria | 3960 |
| 271 | Ga0207649_10032483 | 3300025920 | Bacteria | 3112 |
| 272 | Ga0207649_10139753 | 3300025920 | Bacteria | 1655 |
| 273 | Ga0207649_10206749 | 3300025920 | Bacteria | 1390 |
| 274 | Ga0207649_10230736 | 3300025920 | Bacteria | 1323 |
| 275 | Ga0207681_10002071 | 3300025923 | Bacteria | 12845 |
| 276 | Ga0207681_10044015 | 3300025923 | Bacteria | 2990 |
| 277 | Ga0207681_10345386 | 3300025923 | Bacteria | 1190 |
| 278 | Ga0207681_10373089 | 3300025923 | Bacteria | 1147 |
| 279 | Ga0207650_10000032 | 3300025925 | Bacteria | 229538 |
| 280 | Ga0207650_10003050 | 3300025925 | Bacteria | 11536 |
| 281 | Ga0207650_10003575 | 3300025925 | Bacteria | 10660 |
| 282 | Ga0207650_10005549 | 3300025925 | Bacteria | 8611 |
| 283 | Ga0207650_10025063 | 3300025925 | Bacteria | 4247 |
| 284 | Ga0207650_10046824 | 3300025925 | Bacteria | 3185 |
| 285 | Ga0207650_10062493 | 3300025925 | Bacteria | 2782 |
| 286 | Ga0207650_10070085 | 3300025925 | Bacteria | 2635 |
| 287 | Ga0207650_10318172 | 3300025925 | Bacteria | 1274 |
| 288 | Ga0207659_10003360 | 3300025926 | Bacteria | 9599 |
| 289 | Ga0207659_10009623 | 3300025926 | Bacteria | 6045 |
| 290 | Ga0207659_10030155 | 3300025926 | Bacteria | 3703 |
| 291 | Ga0207659_10068366 | 3300025926 | Bacteria | 2583 |
| 292 | Ga0207687_10227762 | 3300025927 | Bacteria | 1471 |
| 293 | Ga0207700_10085153 | 3300025928 | Bacteria | 2480 |
| 294 | Ga0207664_10023845 | 3300025929 | Bacteria | 4591 |
| 295 | Ga0207644_10000652 | 3300025931 | Bacteria | 21952 |
| 296 | Ga0207644_10001325 | 3300025931 | Bacteria | 15899 |
| 297 | Ga0207644_10006562 | 3300025931 | Bacteria | 7579 |
| 298 | Ga0207644_10014305 | 3300025931 | Bacteria | 5309 |
| 299 | Ga0207644_10017574 | 3300025931 | Bacteria | 4834 |
| 300 | Ga0207644_10018466 | 3300025931 | Bacteria | 4718 |
| 301 | Ga0207644_10031962 | 3300025931 | Bacteria | 3670 |
| 302 | Ga0207644_10048636 | 3300025931 | Bacteria | 3033 |
| 303 | Ga0207644_10052433 | 3300025931 | Bacteria | 2931 |
| 304 | Ga0207644_10054428 | 3300025931 | Bacteria | 2882 |
| 305 | Ga0207644_10057431 | 3300025931 | Bacteria | 2810 |
| 306 | Ga0207644_10070036 | 3300025931 | Bacteria | 2562 |
| 307 | Ga0207644_10160304 | 3300025931 | Bacteria | 1748 |
| 308 | Ga0207644_10292657 | 3300025931 | Bacteria | 1310 |
| 309 | Ga0207690_10035242 | 3300025932 | Bacteria | 3231 |
| 310 | Ga0207690_10092728 | 3300025932 | Bacteria | 2138 |
| 311 | Ga0207690_10136473 | 3300025932 | Bacteria | 1802 |
| 312 | Ga0207706_10000132 | 3300025933 | Bacteria | 81128 |
| 313 | Ga0207706_10006242 | 3300025933 | Bacteria | 11077 |
| 314 | Ga0207706_10011039 | 3300025933 | Bacteria | 8232 |
| 315 | Ga0207706_10023001 | 3300025933 | Bacteria | 5596 |
| 316 | Ga0207706_10027737 | 3300025933 | Bacteria | 5062 |
| 317 | Ga0207706_10029078 | 3300025933 | Bacteria | 4935 |
| 318 | Ga0207706_10059993 | 3300025933 | Bacteria | 3350 |
| 319 | Ga0207706_10124348 | 3300025933 | Bacteria | 2269 |
| 320 | Ga0207706_10276120 | 3300025933 | Bacteria | 1466 |
| 321 | Ga0207709_10005096 | 3300025935 | Bacteria | 7499 |
| 322 | Ga0207670_10031047 | 3300025936 | Bacteria | 3418 |
| 323 | Ga0207669_10018286 | 3300025937 | Bacteria | 3619 |
| 324 | Ga0207669_10022376 | 3300025937 | Bacteria | 3357 |
| 325 | Ga0207669_10136055 | 3300025937 | Bacteria | 1697 |
| 326 | Ga0207669_10183439 | 3300025937 | Bacteria | 1503 |
| 327 | Ga0207704_10037238 | 3300025938 | Bacteria | 2809 |
| 328 | Ga0207704_10219408 | 3300025938 | Bacteria | 1406 |
| 329 | Ga0207691_10000011 | 3300025940 | Bacteria | 147984 |
| 330 | Ga0207691_10004037 | 3300025940 | Bacteria | 14227 |
| 331 | Ga0207691_10009106 | 3300025940 | Bacteria | 9528 |
| 332 | Ga0207691_10018251 | 3300025940 | Bacteria | 6646 |
| 333 | Ga0207691_10063321 | 3300025940 | Bacteria | 3354 |
| 334 | Ga0207691_10077666 | 3300025940 | Bacteria | 2990 |
| 335 | Ga0207691_10109835 | 3300025940 | Bacteria | 2453 |
| 336 | Ga0207691_10185542 | 3300025940 | Bacteria | 1816 |
| 337 | Ga0207711_10000345 | 3300025941 | Bacteria | 49338 |
| 338 | Ga0207711_10005958 | 3300025941 | Bacteria | 10303 |
| 339 | Ga0207711_10009303 | 3300025941 | Bacteria | 8203 |
| 340 | Ga0207711_10012804 | 3300025941 | Bacteria | 6967 |
| 341 | Ga0207711_10035389 | 3300025941 | Bacteria | 4232 |
| 342 | Ga0207711_10070869 | 3300025941 | Bacteria | 3023 |
| 343 | Ga0207711_10108521 | 3300025941 | Bacteria | 2466 |
| 344 | Ga0207689_10000011 | 3300025942 | Bacteria | 123627 |
| 345 | Ga0207661_10124671 | 3300025944 | Bacteria | 2198 |
| 346 | Ga0207679_10000250 | 3300025945 | Bacteria | 40949 |
| 347 | Ga0207679_10023018 | 3300025945 | Bacteria | 4252 |
| 348 | Ga0207679_10042792 | 3300025945 | Bacteria | 3257 |
| 349 | Ga0207679_10092253 | 3300025945 | Bacteria | 2346 |
| 350 | Ga0207679_10215982 | 3300025945 | Bacteria | 1611 |
| 351 | Ga0207679_10446966 | 3300025945 | Bacteria | 1146 |
| 352 | Ga0207651_10001464 | 3300025960 | Bacteria | 10735 |
| 353 | Ga0207651_10037502 | 3300025960 | Bacteria | 3176 |
| 354 | Ga0207651_10146454 | 3300025960 | Bacteria | 1832 |
| 355 | Ga0207651_10202003 | 3300025960 | Bacteria | 1593 |
| 356 | Ga0207651_10333455 | 3300025960 | Bacteria | 1272 |
| 357 | Ga0207712_10000795 | 3300025961 | Bacteria | 23347 |
| 358 | Ga0207668_10001250 | 3300025972 | Bacteria | 15150 |
| 359 | Ga0207640_10008148 | 3300025981 | Bacteria | 5805 |
| 360 | Ga0207640_10079255 | 3300025981 | Bacteria | 2238 |
| 361 | Ga0207658_10000473 | 3300025986 | Bacteria | 37262 |
| 362 | Ga0207658_10010621 | 3300025986 | Bacteria | 6257 |
| 363 | Ga0207658_10060602 | 3300025986 | Bacteria | 2824 |
| 364 | Ga0207658_10157177 | 3300025986 | Bacteria | 1859 |
| 365 | Ga0207677_10000219 | 3300026023 | Bacteria | 45702 |
| 366 | Ga0207677_10031297 | 3300026023 | Bacteria | 3407 |
| 367 | Ga0207677_10056105 | 3300026023 | Bacteria | 2697 |
| 368 | Ga0207703_10000434 | 3300026035 | Bacteria | 43951 |
| 369 | Ga0207703_10000524 | 3300026035 | Bacteria | 39370 |
| 370 | Ga0207703_10017170 | 3300026035 | Bacteria | 5646 |
| 371 | Ga0207703_10259400 | 3300026035 | Bacteria | 1570 |
| 372 | Ga0207703_10413942 | 3300026035 | Bacteria | 1253 |
| 373 | Ga0207639_10149166 | 3300026041 | Bacteria | 1957 |
| 374 | Ga0207678_10002515 | 3300026067 | Bacteria | 16696 |
| 375 | Ga0207678_10029231 | 3300026067 | Bacteria | 4809 |
| 376 | Ga0207678_10260109 | 3300026067 | Bacteria | 1487 |
| 377 | Ga0207708_10330195 | 3300026075 | Bacteria | 1247 |
| 378 | Ga0207641_10002207 | 3300026088 | Bacteria | 18322 |
| 379 | Ga0207641_10007924 | 3300026088 | Bacteria | 8809 |
| 380 | Ga0207641_10018158 | 3300026088 | Bacteria | 5764 |
| 381 | Ga0207641_10079950 | 3300026088 | Bacteria | 2835 |
| 382 | Ga0207648_10000258 | 3300026089 | Bacteria | 57424 |
| 383 | Ga0207648_10004248 | 3300026089 | Bacteria | 14795 |
| 384 | Ga0207648_10026314 | 3300026089 | Bacteria | 5172 |
| 385 | Ga0207648_10313431 | 3300026089 | Bacteria | 1409 |
| 386 | Ga0207676_10001189 | 3300026095 | Bacteria | 19527 |
| 387 | Ga0207676_10005392 | 3300026095 | Bacteria | 9052 |
| 388 | Ga0207676_10007059 | 3300026095 | Bacteria | 7959 |
| 389 | Ga0207676_10020930 | 3300026095 | Bacteria | 4793 |
| 390 | Ga0207676_10037419 | 3300026095 | Bacteria | 3698 |
| 391 | Ga0207676_10108198 | 3300026095 | Bacteria | 2320 |
| 392 | Ga0207676_10161850 | 3300026095 | Bacteria | 1940 |
| 393 | Ga0207674_10001589 | 3300026116 | Bacteria | 29230 |
| 394 | Ga0207674_10006098 | 3300026116 | Bacteria | 14248 |
| 395 | Ga0207674_10141597 | 3300026116 | Bacteria | 2364 |
| 396 | Ga0207675_100000164 | 3300026118 | Bacteria | 58951 |
| 397 | Ga0207675_100499586 | 3300026118 | Bacteria | 1211 |
| 398 | Ga0207683_10000080 | 3300026121 | Bacteria | 76652 |
| 399 | Ga0207683_10002371 | 3300026121 | Bacteria | 16461 |
| 400 | Ga0207683_10008588 | 3300026121 | Bacteria | 8743 |
| 401 | Ga0207683_10074002 | 3300026121 | Bacteria | 3014 |
| 402 | Ga0207683_10100350 | 3300026121 | Bacteria | 2584 |
| 403 | Ga0207683_10233435 | 3300026121 | Bacteria | 1678 |
| 404 | Ga0207698_10267424 | 3300026142 | Bacteria | 1574 |
| 405 | Ga0268266_10006858 | 3300028379 | Bacteria | 10368 |
| 406 | Ga0268266_10022945 | 3300028379 | Bacteria | 5310 |
| 407 | Ga0268265_10001169 | 3300028380 | Bacteria | 22998 |
| 408 | Ga0268265_10001945 | 3300028380 | Bacteria | 16405 |
| 409 | Ga0268265_10088422 | 3300028380 | Bacteria | 2468 |
| 410 | Ga0268264_10000266 | 3300028381 | Bacteria | 92216 |
| 411 | Ga0268264_10001259 | 3300028381 | Bacteria | 24103 |
| 412 | Ga0268264_10070330 | 3300028381 | Bacteria | 2963 |
| 413 | Ga0307405_10301344 | 3300031731 | Bacteria | 1216 |
| 414 | Ga0307410_10000425 | 3300031852 | Bacteria | 16799 |
| 415 | Ga0307410_10023180 | 3300031852 | Bacteria | 3854 |
| 416 | Ga0307410_10139843 | 3300031852 | Bacteria | 1790 |
| 417 | Ga0307410_10153613 | 3300031852 | Bacteria | 1716 |
| 418 | Ga0307410_10349586 | 3300031852 | Bacteria | 1181 |
| 419 | Ga0307406_10098487 | 3300031901 | Bacteria | 1985 |
| 420 | Ga0307406_10424455 | 3300031901 | Bacteria | 1060 |
| 421 | Ga0307407_10233713 | 3300031903 | Bacteria | 1250 |
| 422 | Ga0307409_100021116 | 3300031995 | Bacteria | 4457 |
| 423 | Ga0307409_100051178 | 3300031995 | Bacteria | 3159 |
| 424 | Ga0307409_100095503 | 3300031995 | Bacteria | 2449 |
| 425 | Ga0307416_100033284 | 3300032002 | Bacteria | 3905 |
| 426 | Ga0307416_100038095 | 3300032002 | Bacteria | 3706 |
| 427 | Ga0307416_100074064 | 3300032002 | Bacteria | 2843 |
| 428 | Ga0307416_100147399 | 3300032002 | Bacteria | 2152 |
| 429 | Ga0307414_10004523 | 3300032004 | Bacteria | 7565 |
| 430 | Ga0307414_10023815 | 3300032004 | Bacteria | 3891 |
| 431 | Ga0307414_10172241 | 3300032004 | Bacteria | 1732 |
| 432 | Ga0307414_10339400 | 3300032004 | Bacteria | 1285 |
| 433 | Ga0307414_10437709 | 3300032004 | Bacteria | 1144 |
| 434 | Ga0307411_10001130 | 3300032005 | Bacteria | 10431 |
| 435 | Ga0307411_10029154 | 3300032005 | Bacteria | 3366 |
| 436 | Ga0307411_10114470 | 3300032005 | Bacteria | 1938 |
| 437 | Ga0307411_10220984 | 3300032005 | Bacteria | 1470 |
| 438 | Ga0373943_0001816 | 3300035170 | Bacteria | 9653 |
| 439 | Ga0373931_0112614 | 3300035691 | Bacteria | 1546 |
| 440 | Ga0373937_0021650 | 3300036401 | Bacteria | 5770 |
| 441 | Ga0373937_0400066 | 3300036401 | Bacteria | 1303 |
| 442 | Ga0373925_0010421 | 3300037068 | Bacteria | 6745 |
| 443 | Ga0373925_0122722 | 3300037068 | Bacteria | 2018 |
| 444 | Ga0395899_0011101 | 3300037312 | Bacteria | 6899 |
| 445 | Ga0395899_0069849 | 3300037312 | Bacteria | 2571 |
| 446 | Ga0395900_0054480 | 3300037418 | Bacteria | 4118 |
| 447 | Ga0395898_0013078 | 3300037466 | Bacteria | 8556 |
| 448 | Ga0395898_0182456 | 3300037466 | Bacteria | 2006 |
| 449 | Ga0395905_0001203 | 3300037471 | Bacteria | 32348 |
| 450 | Ga0395905_0079273 | 3300037471 | Bacteria | 3078 |
| 451 | Ga0395905_0112163 | 3300037471 | Bacteria | 2561 |
| 452 | Ga0395905_0165738 | 3300037471 | Bacteria | 2076 |
| 453 | Ga0395901_0208881 | 3300038443 | Bacteria | 2044 |
| 454 | Ga0436363_0864307 | 3300039450 | Bacteria | 1556 |
| 455 | Ga0439465_0077687 | 3300041413 | Bacteria | 1121 |
| 456 | Ga0439448_0001486 | 3300042005 | Bacteria | 6097 |
| 457 | Ga0450904_000904 | 3300042139 | Bacteria | 4811 |
| 458 | Ga0466964_0135032 | 3300044706 | Bacteria | 1128 |
| 459 | Ga0495605_0021870 | 3300046474 | Bacteria | 3382 |
| 460 | Ga0495639_0075590 | 3300046475 | Bacteria | 1562 |
| 461 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 462 | Ga0495584_0037459 | 3300046491 | Bacteria | 2451 |
| 463 | Ga0495585_0000822 | 3300046492 | Bacteria | 26833 |
| 464 | Ga0495585_0005245 | 3300046492 | Bacteria | 8208 |
| 465 | Ga0495594_0000106 | 3300046499 | Bacteria | 39102 |
| 466 | Ga0495594_0003633 | 3300046499 | Bacteria | 7932 |
| 467 | Ga0495610_0034485 | 3300046512 | Bacteria | 2606 |
| 468 | Ga0495610_0115919 | 3300046512 | Bacteria | 1181 |
| 469 | Ga0495616_0031881 | 3300046513 | Bacteria | 2757 |
| 470 | Ga0495620_0071687 | 3300046515 | Bacteria | 1416 |
| 471 | Ga0495631_0000822 | 3300046518 | Bacteria | 19836 |
| 472 | Ga0495631_0014171 | 3300046518 | Bacteria | 3852 |
| 473 | Ga0495632_0000259 | 3300046519 | Bacteria | 52636 |
| 474 | Ga0495637_0002410 | 3300046520 | Bacteria | 10342 |
| 475 | Ga0495642_0010782 | 3300046528 | Bacteria | 3502 |
| 476 | Ga0495642_0013299 | 3300046528 | Bacteria | 3181 |
| 477 | Ga0495621_0002100 | 3300046539 | Bacteria | 5281 |
| 478 | Ga0495597_0041329 | 3300046542 | Bacteria | 2060 |
| 479 | Ga0495597_0113386 | 3300046542 | Bacteria | 1135 |
| 480 | Ga0495633_0003965 | 3300046558 | Bacteria | 9617 |
| 481 | Ga0495633_0009662 | 3300046558 | Bacteria | 5308 |
| 482 | Ga0495668_0038244 | 3300046616 | Bacteria | 2682 |
| 483 | Ga0495661_0000721 | 3300046665 | Bacteria | 32506 |
| 484 | Ga0495661_0007342 | 3300046665 | Bacteria | 7679 |
| 485 | Ga0495661_0009304 | 3300046665 | Bacteria | 6744 |
| 486 | Ga0495588_0002703 | 3300046674 | Bacteria | 7595 |
| 487 | Ga0495588_0036521 | 3300046674 | Bacteria | 2493 |
| 488 | Ga0495647_0060154 | 3300046681 | Bacteria | 1497 |
| 489 | Ga0495658_0023119 | 3300046683 | Bacteria | 3297 |
| 490 | Ga0495669_0001409 | 3300046684 | Bacteria | 9893 |
| 491 | Ga0495669_0007425 | 3300046684 | Bacteria | 4597 |
| 492 | Ga0495669_0024398 | 3300046684 | Bacteria | 2634 |
| 493 | Ga0495669_0061416 | 3300046684 | Bacteria | 1700 |
| 494 | Ga0495670_0000118 | 3300046691 | Bacteria | 34643 |
| 495 | Ga0495670_0006064 | 3300046691 | Bacteria | 5925 |
| 496 | Ga0495670_0120943 | 3300046691 | Bacteria | 1360 |
| 497 | Ga0495660_0039423 | 3300046810 | Bacteria | 2623 |
| 498 | Ga0495636_0010746 | 3300047318 | Bacteria | 3619 |
| 499 | Ga0495672_0000656 | 3300047320 | Bacteria | 38441 |
| 500 | Ga0495683_0009631 | 3300047323 | Bacteria | 5143 |
| 501 | Ga0495681_0000492 | 3300047470 | Bacteria | 30331 |
| 502 | Ga0495681_0044824 | 3300047470 | Bacteria | 2122 |
| 503 | Ga0495626_0011207 | 3300048091 | Bacteria | 4749 |
| 504 | Ga0496100_0009086 | 3300048903 | Bacteria | 5572 |
| 505 | Ga0496101_0003840 | 3300048904 | Bacteria | 9392 |
| 506 | Ga0496101_0024562 | 3300048904 | Bacteria | 4171 |
| 507 | Ga0496101_0086014 | 3300048904 | Bacteria | 2331 |
| 508 | Ga0496101_0087878 | 3300048904 | Bacteria | 2308 |
| 509 | Ga0496101_0135536 | 3300048904 | Bacteria | 1873 |
| 510 | Ga0496102_0006567 | 3300048905 | Bacteria | 9932 |
| 511 | Ga0496102_0084553 | 3300048905 | Bacteria | 2929 |
| 512 | Ga0496104_0030451 | 3300048907 | Bacteria | 5015 |
| 513 | Ga0496104_0179144 | 3300048907 | Bacteria | 2030 |
| 514 | Ga0496104_0207376 | 3300048907 | Bacteria | 1872 |
| 515 | Ga0496106_0001460 | 3300048909 | Bacteria | 17764 |
| 516 | Ga0496106_0002280 | 3300048909 | Bacteria | 14313 |
| 517 | Ga0496106_0019355 | 3300048909 | Bacteria | 5048 |
| 518 | Ga0496106_0246509 | 3300048909 | Bacteria | 1428 |
| 519 | Ga0496107_0000848 | 3300048910 | Bacteria | 17901 |
| 520 | Ga0496107_0008863 | 3300048910 | Bacteria | 6971 |
| 521 | Ga0496107_0016472 | 3300048910 | Bacteria | 5192 |
| 522 | Ga0496107_0045793 | 3300048910 | Bacteria | 3147 |
| 523 | Ga0496107_0053489 | 3300048910 | Bacteria | 2913 |
| 524 | Ga0496107_0429236 | 3300048910 | Bacteria | 982 |
| 525 | Ga0496108_0180403 | 3300048911 | Bacteria | 1828 |
| 526 | Ga0496109_0001761 | 3300048912 | Bacteria | 17994 |
| 527 | Ga0496109_0012908 | 3300048912 | Bacteria | 7223 |
| 528 | Ga0496109_0060351 | 3300048912 | Bacteria | 3465 |
| 529 | Ga0496109_0072010 | 3300048912 | Bacteria | 3174 |
| 530 | Ga0496109_0072933 | 3300048912 | Bacteria | 3154 |
| 531 | Ga0496109_0130791 | 3300048912 | Bacteria | 2342 |
| 532 | Ga0496109_0135357 | 3300048912 | Bacteria | 2302 |
| 533 | Ga0496109_0173580 | 3300048912 | Bacteria | 2023 |
| 534 | Ga0496110_0005414 | 3300048913 | Bacteria | 10012 |
| 535 | Ga0496110_0009390 | 3300048913 | Bacteria | 7919 |
| 536 | Ga0496110_0012297 | 3300048913 | Bacteria | 7036 |
| 537 | Ga0496110_0041259 | 3300048913 | Bacteria | 4026 |
| 538 | Ga0496111_0000782 | 3300048914 | Bacteria | 16994 |
| 539 | Ga0496111_0004951 | 3300048914 | Bacteria | 8465 |
| 540 | Ga0496111_0008972 | 3300048914 | Bacteria | 6652 |
| 541 | Ga0496111_0033780 | 3300048914 | Bacteria | 3649 |
| 542 | Ga0496112_0011111 | 3300048915 | Bacteria | 8206 |
| 543 | Ga0496112_0016757 | 3300048915 | Bacteria | 6872 |
| 544 | Ga0496112_0069327 | 3300048915 | Bacteria | 3483 |
| 545 | Ga0496112_0071039 | 3300048915 | Bacteria | 3440 |
| 546 | Ga0496112_0286829 | 3300048915 | Bacteria | 1592 |
| 547 | Ga0496112_0465808 | 3300048915 | Bacteria | 1201 |
| 548 | Ga0496113_0010228 | 3300048916 | Bacteria | 6194 |
| 549 | Ga0496113_0055823 | 3300048916 | Bacteria | 2962 |
| 550 | Ga0496113_0118539 | 3300048916 | Bacteria | 2067 |
| 551 | Ga0496113_0156730 | 3300048916 | Bacteria | 1799 |
| 552 | Ga0496113_0171471 | 3300048916 | Bacteria | 1718 |
| 553 | Ga0496114_0006322 | 3300048917 | Bacteria | 9322 |
| 554 | Ga0496114_0071835 | 3300048917 | Bacteria | 2909 |
| 555 | Ga0496114_0089144 | 3300048917 | Bacteria | 2618 |
| 556 | Ga0496115_0000750 | 3300048918 | Bacteria | 23896 |
| 557 | Ga0496115_0005663 | 3300048918 | Bacteria | 9089 |
| 558 | Ga0496119_0028366 | 3300048922 | Bacteria | 3821 |
| 559 | Ga0496121_0002470 | 3300048924 | Bacteria | 28202 |
| 560 | Ga0495678_000620 | 3300049459 | Bacteria | 33056 |
| 561 | Ga0501032_0062454 | 3300049569 | Bacteria | 2496 |
| 562 | Ga0501037_0020911 | 3300049573 | Bacteria | 4832 |
| 563 | Ga0501038_0045412 | 3300049574 | Bacteria | 3814 |
| 564 | Ga0501039_0003903 | 3300049575 | Bacteria | 11198 |
| 565 | Ga0501041_0013312 | 3300049577 | Bacteria | 4875 |
| 566 | Ga0501042_0010695 | 3300049578 | Bacteria | 6166 |
| 567 | Ga0501048_0022984 | 3300049582 | Bacteria | 4557 |
| 568 | Ga0501071_0063950 | 3300049587 | Bacteria | 2669 |
| 569 | Ga0501071_0225021 | 3300049587 | Bacteria | 1413 |
| 570 | Ga0501077_0049553 | 3300049593 | Bacteria | 2669 |
| 571 | Ga0501079_0047416 | 3300049741 | Bacteria | 3315 |
| 572 | Ga0501079_0090451 | 3300049741 | Bacteria | 2371 |
| 573 | Ga0501035_0037013 | 3300049822 | Bacteria | 4420 |
| 574 | Ga0501044_0057398 | 3300049823 | Bacteria | 3995 |
| 575 | Ga0501045_0074608 | 3300049824 | Bacteria | 2498 |
| 576 | nmdc:mga09592_20168_c1 | 3300050508 | Bacteria | 5478 |
| 577 | Ga0500647_0013311 | 3300053091 | Bacteria | 3719 |
| 578 | Ga0500555_012929 | 3300053103 | Bacteria | 2404 |
| 579 | Ga0500556_0000870 | 3300053104 | Bacteria | 17074 |
| 580 | Ga0500645_001019 | 3300053730 | Bacteria | 15706 |
| 581 | Ga0530510_0108524 | 3300061734 | Bacteria | 2032 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100134896 | Ga0070713_1001348962 | 271 |
| 2 | 3300025928 | Ga0207700_10085153 | Ga0207700_100851532 | 276 |
| 3 | 3300037466 | Ga0395898_0013078 | Ga0395898_0013078_1652_2617 | 278 |
| 4 | 3300037471 | Ga0395905_0079273 | Ga0395905_0079273_1393_2358 | 278 |
| 5 | 3300038443 | Ga0395901_0208881 | Ga0395901_0208881_627_1592 | 278 |
| 6 | 3300053091 | Ga0500647_0013311 | Ga0500647_0013311_2512_3495 | 278 |
| 7 | 3300006175 | Ga0070712_100112069 | Ga0070712_1001120691 | 280 |
| 8 | 3300048910 | Ga0496107_0429236 | Ga0496107_0429236_125_967 | 280 |
| 9 | 3300048916 | Ga0496113_0171471 | Ga0496113_0171471_752_1594 | 280 |
| 10 | 3300025908 | Ga0207643_10245719 | Ga0207643_102457192 | 284 |
| 11 | 3300005614 | Ga0068856_100317584 | Ga0068856_1003175841 | 289 |
| 12 | 3300025915 | Ga0207693_10327561 | Ga0207693_103275611 | 289 |
| 13 | 3300032004 | Ga0307414_10437709 | Ga0307414_104377092 | 289 |
| 14 | 3300048909 | Ga0496106_0246509 | Ga0496106_0246509_383_1342 | 291 |
| 15 | 3300005331 | Ga0070670_100163025 | Ga0070670_1001630252 | 292 |
| 16 | 3300005335 | Ga0070666_10003297 | Ga0070666_100032975 | 292 |
| 17 | 3300005338 | Ga0068868_100141245 | Ga0068868_1001412453 | 292 |
| 18 | 3300005355 | Ga0070671_100016988 | Ga0070671_1000169882 | 292 |
| 19 | 3300005364 | Ga0070673_100026432 | Ga0070673_1000264322 | 292 |
| 20 | 3300005367 | Ga0070667_100014598 | Ga0070667_1000145984 | 292 |
| 21 | 3300005457 | Ga0070662_100011838 | Ga0070662_1000118382 | 292 |
| 22 | 3300005466 | Ga0070685_10120290 | Ga0070685_101202902 | 292 |
| 23 | 3300005543 | Ga0070672_100002941 | Ga0070672_1000029413 | 292 |
| 24 | 3300005564 | Ga0070664_100500666 | Ga0070664_1005006662 | 292 |
| 25 | 3300005618 | Ga0068864_100010436 | Ga0068864_1000104362 | 292 |
| 26 | 3300005841 | Ga0068863_100013452 | Ga0068863_1000134524 | 292 |
| 27 | 3300005842 | Ga0068858_100439317 | Ga0068858_1004393171 | 292 |
| 28 | 3300006237 | Ga0097621_100013044 | Ga0097621_1000130443 | 292 |
| 29 | 3300006358 | Ga0068871_100075801 | Ga0068871_1000758012 | 292 |
| 30 | 3300006881 | Ga0068865_100083834 | Ga0068865_1000838342 | 292 |
| 31 | 3300009177 | Ga0105248_10017754 | Ga0105248_100177543 | 292 |
| 32 | 3300013297 | Ga0157378_10267822 | Ga0157378_102678222 | 292 |
| 33 | 3300013306 | Ga0163162_10011425 | Ga0163162_100114255 | 292 |
| 34 | 3300013308 | Ga0157375_10007360 | Ga0157375_100073605 | 292 |
| 35 | 3300014325 | Ga0163163_10120025 | Ga0163163_101200253 | 292 |
| 36 | 3300025903 | Ga0207680_10048496 | Ga0207680_100484962 | 292 |
| 37 | 3300025920 | Ga0207649_10230736 | Ga0207649_102307362 | 292 |
| 38 | 3300025925 | Ga0207650_10062493 | Ga0207650_100624932 | 292 |
| 39 | 3300025926 | Ga0207659_10068366 | Ga0207659_100683662 | 292 |
| 40 | 3300025931 | Ga0207644_10000652 | Ga0207644_1000065210 | 292 |
| 41 | 3300025938 | Ga0207704_10037238 | Ga0207704_100372382 | 292 |
| 42 | 3300025940 | Ga0207691_10018251 | Ga0207691_100182514 | 292 |
| 43 | 3300025941 | Ga0207711_10009303 | Ga0207711_100093035 | 292 |
| 44 | 3300025945 | Ga0207679_10446966 | Ga0207679_104469661 | 292 |
| 45 | 3300025960 | Ga0207651_10202003 | Ga0207651_102020032 | 292 |
| 46 | 3300025986 | Ga0207658_10060602 | Ga0207658_100606022 | 292 |
| 47 | 3300026035 | Ga0207703_10413942 | Ga0207703_104139422 | 292 |
| 48 | 3300026095 | Ga0207676_10005392 | Ga0207676_100053922 | 292 |
| 49 | 3300028381 | Ga0268264_10070330 | Ga0268264_100703302 | 292 |
| 50 | 3300036401 | Ga0373937_0400066 | Ga0373937_0400066_141_1106 | 292 |
| 51 | 3300046681 | Ga0495647_0060154 | Ga0495647_0060154_505_1476 | 292 |
| 52 | 3300048904 | Ga0496101_0086014 | Ga0496101_0086014_104_1075 | 292 |
| 53 | 3300048912 | Ga0496109_0060351 | Ga0496109_0060351_198_1169 | 292 |
| 54 | 3300048916 | Ga0496113_0118539 | Ga0496113_0118539_31_1002 | 292 |
| 55 | 3300046518 | Ga0495631_0014171 | Ga0495631_0014171_1551_2492 | 293 |
| 56 | 3300046519 | Ga0495632_0000259 | Ga0495632_0000259_30727_31662 | 293 |
| 57 | 3300046616 | Ga0495668_0038244 | Ga0495668_0038244_495_1436 | 293 |
| 58 | 3300046665 | Ga0495661_0009304 | Ga0495661_0009304_3182_4123 | 293 |
| 59 | 3300046810 | Ga0495660_0039423 | Ga0495660_0039423_410_1345 | 293 |
| 60 | 3300049459 | Ga0495678_000620 | Ga0495678_000620_30727_31662 | 293 |
| 61 | 3300025893 | Ga0207682_10102251 | Ga0207682_101022512 | 294 |
| 62 | 3300046528 | Ga0495642_0013299 | Ga0495642_0013299_2103_3038 | 294 |
| 63 | 3300041413 | Ga0439465_0077687 | Ga0439465_0077687_104_1060 | 295 |
| 64 | 3300042139 | Ga0450904_000904 | Ga0450904_000904_1563_2498 | 295 |
| 65 | 3300044706 | Ga0466964_0135032 | Ga0466964_0135032_31_966 | 295 |
| 66 | 3300046474 | Ga0495605_0021870 | Ga0495605_0021870_1870_2805 | 295 |
| 67 | 3300046520 | Ga0495637_0002410 | Ga0495637_0002410_958_1944 | 295 |
| 68 | 3300048091 | Ga0495626_0011207 | Ga0495626_0011207_1830_2765 | 295 |
| 69 | 3300048909 | Ga0496106_0002280 | Ga0496106_0002280_11329_12321 | 295 |
| 70 | 3300048910 | Ga0496107_0000848 | Ga0496107_0000848_472_1464 | 295 |
| 71 | 3300048924 | Ga0496121_0002470 | Ga0496121_0002470_6056_7048 | 295 |
| 72 | 3300053104 | Ga0500556_0000870 | Ga0500556_0000870_12191_13177 | 295 |
| 73 | 3300053730 | Ga0500645_001019 | Ga0500645_001019_10979_11965 | 295 |
| 74 | 3300005457 | Ga0070662_100009297 | Ga0070662_1000092974 | 296 |
| 75 | 3300005458 | Ga0070681_10234716 | Ga0070681_102347162 | 296 |
| 76 | 3300025933 | Ga0207706_10023001 | Ga0207706_100230014 | 296 |
| 77 | 3300006175 | Ga0070712_100213507 | Ga0070712_1002135072 | 298 |
| 78 | 3300031901 | Ga0307406_10098487 | Ga0307406_100984872 | 298 |
| 79 | 3300031903 | Ga0307407_10233713 | Ga0307407_102337132 | 298 |
| 80 | 3300031995 | Ga0307409_100051178 | Ga0307409_1000511782 | 298 |
| 81 | 3300032002 | Ga0307416_100033284 | Ga0307416_1000332841 | 298 |
| 82 | 3300032004 | Ga0307414_10023815 | Ga0307414_100238152 | 298 |
| 83 | 3300013308 | Ga0157375_10139321 | Ga0157375_101393212 | 299 |
| 84 | 3300048922 | Ga0496119_0028366 | Ga0496119_0028366_2890_3798 | 299 |
| 85 | 3300005331 | Ga0070670_100000038 | Ga0070670_10000003830 | 300 |
| 86 | 3300005335 | Ga0070666_10013709 | Ga0070666_100137094 | 300 |
| 87 | 3300005347 | Ga0070668_100000224 | Ga0070668_10000022420 | 300 |
| 88 | 3300005367 | Ga0070667_100000106 | Ga0070667_10000010678 | 300 |
| 89 | 3300005548 | Ga0070665_100000294 | Ga0070665_10000029440 | 300 |
| 90 | 3300005618 | Ga0068864_100000065 | Ga0068864_10000006522 | 300 |
| 91 | 3300005841 | Ga0068863_100000226 | Ga0068863_10000022630 | 300 |
| 92 | 3300005842 | Ga0068858_100010061 | Ga0068858_1000100616 | 300 |
| 93 | 3300005843 | Ga0068860_100000191 | Ga0068860_10000019130 | 300 |
| 94 | 3300005844 | Ga0068862_100000351 | Ga0068862_10000035130 | 300 |
| 95 | 3300009553 | Ga0105249_10000982 | Ga0105249_100009826 | 300 |
| 96 | 3300025903 | Ga0207680_10007728 | Ga0207680_100077282 | 300 |
| 97 | 3300025920 | Ga0207649_10006237 | Ga0207649_100062372 | 300 |
| 98 | 3300025925 | Ga0207650_10000032 | Ga0207650_10000032136 | 300 |
| 99 | 3300025931 | Ga0207644_10054428 | Ga0207644_100544282 | 300 |
| 100 | 3300025972 | Ga0207668_10001250 | Ga0207668_100012505 | 300 |
| 101 | 3300025986 | Ga0207658_10000473 | Ga0207658_1000047330 | 300 |
| 102 | 3300026023 | Ga0207677_10056105 | Ga0207677_100561052 | 300 |
| 103 | 3300026035 | Ga0207703_10000524 | Ga0207703_1000052427 | 300 |
| 104 | 3300026088 | Ga0207641_10002207 | Ga0207641_1000220716 | 300 |
| 105 | 3300026089 | Ga0207648_10313431 | Ga0207648_103134312 | 300 |
| 106 | 3300026095 | Ga0207676_10001189 | Ga0207676_1000118917 | 300 |
| 107 | 3300028379 | Ga0268266_10006858 | Ga0268266_100068584 | 300 |
| 108 | 3300028380 | Ga0268265_10001945 | Ga0268265_1000194515 | 300 |
| 109 | 3300028381 | Ga0268264_10000266 | Ga0268264_1000026671 | 300 |
| 110 | 3300005438 | Ga0070701_10054270 | Ga0070701_100542703 | 301 |
| 111 | 3300005543 | Ga0070672_100016004 | Ga0070672_1000160042 | 301 |
| 112 | 3300036401 | Ga0373937_0021650 | Ga0373937_0021650_1292_2230 | 303 |
| 113 | 3300037068 | Ga0373925_0122722 | Ga0373925_0122722_36_974 | 303 |
| 114 | 3300046491 | Ga0495584_0037459 | Ga0495584_0037459_854_1792 | 303 |
| 115 | 3300046492 | Ga0495585_0000822 | Ga0495585_0000822_10216_11154 | 303 |
| 116 | 3300046512 | Ga0495610_0115919 | Ga0495610_0115919_149_1087 | 303 |
| 117 | 3300046513 | Ga0495616_0031881 | Ga0495616_0031881_684_1622 | 303 |
| 118 | 3300046518 | Ga0495631_0000822 | Ga0495631_0000822_9866_10804 | 303 |
| 119 | 3300046558 | Ga0495633_0003965 | Ga0495633_0003965_1275_2213 | 303 |
| 120 | 3300046665 | Ga0495661_0000721 | Ga0495661_0000721_9980_10918 | 303 |
| 121 | 3300046683 | Ga0495658_0023119 | Ga0495658_0023119_1278_2216 | 303 |
| 122 | 3300046691 | Ga0495670_0000118 | Ga0495670_0000118_10125_11063 | 303 |
| 123 | 3300047323 | Ga0495683_0009631 | Ga0495683_0009631_1450_2388 | 303 |
| 124 | 3300047470 | Ga0495681_0000492 | Ga0495681_0000492_10469_11407 | 303 |
| 125 | 3300050508 | nmdc:mga09592_20168_c1 | nmdc:mga09592_20168_c1_2926_3867 | 303 |
| 126 | 3300026075 | Ga0207708_10330195 | Ga0207708_103301952 | 305 |
| 127 | 3300005329 | Ga0070683_100124783 | Ga0070683_1001247832 | 306 |
| 128 | 3300005535 | Ga0070684_100276264 | Ga0070684_1002762642 | 306 |
| 129 | 3300025944 | Ga0207661_10124671 | Ga0207661_101246712 | 306 |
| 130 | 3300053103 | Ga0500555_012929 | Ga0500555_012929_537_1496 | 307 |
| 131 | 3300003215 | JGI25153J46596_10023647 | JGI25153J46596_100236472 | 310 |
| 132 | 3300003773 | Ga0055537_1001075 | Ga0055537_10010756 | 310 |
| 133 | 3300003775 | Ga0055524_1003687 | Ga0055524_10036872 | 310 |
| 134 | 3300003790 | Ga0055528_1002814 | Ga0055528_10028142 | 310 |
| 135 | 3300025263 | Ga0209565_1000429 | Ga0209565_100042911 | 310 |
| 136 | 3300025273 | Ga0209673_1000895 | Ga0209673_100089513 | 310 |
| 137 | 3300025295 | Ga0209564_1021950 | Ga0209564_10219502 | 310 |
| 138 | 3300025297 | Ga0209758_1012668 | Ga0209758_10126682 | 310 |
| 139 | 3300025299 | Ga0209256_1001309 | Ga0209256_10013093 | 310 |
| 140 | 3300025299 | Ga0209256_1003185 | Ga0209256_10031856 | 310 |
| 141 | 3300031852 | Ga0307410_10139843 | Ga0307410_101398431 | 310 |
| 142 | 3300046512 | Ga0495610_0034485 | Ga0495610_0034485_1008_1994 | 310 |
| 143 | 3300048918 | Ga0496115_0005663 | Ga0496115_0005663_7235_8218 | 310 |
| 144 | iso_pu_bacteria | 2643221545 | 2643746968 | 310 |
| 145 | iso_pu_bacteria | 2643221663 | 2644351941 | 310 |
| 146 | iso_pu_bacteria | 2643221691 | 2644507825 | 310 |
| 147 | 3300005841 | Ga0068863_100390971 | Ga0068863_1003909712 | 311 |
| 148 | 3300046528 | Ga0495642_0010782 | Ga0495642_0010782_1399_2334 | 311 |
| 149 | 3300049569 | Ga0501032_0062454 | Ga0501032_0062454_1283_2251 | 311 |
| 150 | 3300049573 | Ga0501037_0020911 | Ga0501037_0020911_3424_4392 | 311 |
| 151 | 3300049574 | Ga0501038_0045412 | Ga0501038_0045412_1639_2607 | 311 |
| 152 | 3300049575 | Ga0501039_0003903 | Ga0501039_0003903_1363_2331 | 311 |
| 153 | 3300049577 | Ga0501041_0013312 | Ga0501041_0013312_2118_3086 | 311 |
| 154 | 3300049578 | Ga0501042_0010695 | Ga0501042_0010695_1433_2401 | 311 |
| 155 | 3300049582 | Ga0501048_0022984 | Ga0501048_0022984_1098_2066 | 311 |
| 156 | 3300049587 | Ga0501071_0063950 | Ga0501071_0063950_1181_2149 | 311 |
| 157 | 3300049587 | Ga0501071_0225021 | Ga0501071_0225021_272_1240 | 311 |
| 158 | 3300049593 | Ga0501077_0049553 | Ga0501077_0049553_1143_2111 | 311 |
| 159 | 3300049741 | Ga0501079_0047416 | Ga0501079_0047416_1464_2432 | 311 |
| 160 | 3300049741 | Ga0501079_0090451 | Ga0501079_0090451_929_1897 | 311 |
| 161 | 3300049822 | Ga0501035_0037013 | Ga0501035_0037013_1960_2928 | 311 |
| 162 | 3300049824 | Ga0501045_0074608 | Ga0501045_0074608_418_1386 | 311 |
| 163 | 3300061734 | Ga0530510_0108524 | Ga0530510_0108524_441_1409 | 311 |
| 164 | 3300003544 | Ga0007417J51691_1018961 | Ga0007417J51691_10189612 | 312 |
| 165 | 3300003579 | Ga0007429J51699_1032193 | Ga0007429J51699_10321932 | 312 |
| 166 | 3300003693 | Ga0032354_1009780 | Ga0032354_10097802 | 312 |
| 167 | 3300003735 | Ga0006780_1034692 | Ga0006780_10346922 | 312 |
| 168 | 3300005293 | Ga0065715_10142795 | Ga0065715_101427952 | 312 |
| 169 | 3300005327 | Ga0070658_10008251 | Ga0070658_100082515 | 312 |
| 170 | 3300005328 | Ga0070676_10064858 | Ga0070676_100648582 | 312 |
| 171 | 3300005330 | Ga0070690_100003185 | Ga0070690_1000031852 | 312 |
| 172 | 3300005335 | Ga0070666_10006841 | Ga0070666_100068416 | 312 |
| 173 | 3300005338 | Ga0068868_100022702 | Ga0068868_1000227021 | 312 |
| 174 | 3300005339 | Ga0070660_100025931 | Ga0070660_1000259313 | 312 |
| 175 | 3300005344 | Ga0070661_100043849 | Ga0070661_1000438492 | 312 |
| 176 | 3300005356 | Ga0070674_100366179 | Ga0070674_1003661791 | 312 |
| 177 | 3300005367 | Ga0070667_100010153 | Ga0070667_1000101531 | 312 |
| 178 | 3300005456 | Ga0070678_100047649 | Ga0070678_1000476492 | 312 |
| 179 | 3300005457 | Ga0070662_100058817 | Ga0070662_1000588171 | 312 |
| 180 | 3300005459 | Ga0068867_100038272 | Ga0068867_1000382722 | 312 |
| 181 | 3300005543 | Ga0070672_100020844 | Ga0070672_1000208442 | 312 |
| 182 | 3300005544 | Ga0070686_100025720 | Ga0070686_1000257202 | 312 |
| 183 | 3300005578 | Ga0068854_100025193 | Ga0068854_1000251932 | 312 |
| 184 | 3300005616 | Ga0068852_100012269 | Ga0068852_1000122693 | 312 |
| 185 | 3300005617 | Ga0068859_100313446 | Ga0068859_1003134462 | 312 |
| 186 | 3300005618 | Ga0068864_100025311 | Ga0068864_1000253113 | 312 |
| 187 | 3300005719 | Ga0068861_100429171 | Ga0068861_1004291711 | 312 |
| 188 | 3300005834 | Ga0068851_10020008 | Ga0068851_100200082 | 312 |
| 189 | 3300005841 | Ga0068863_100011300 | Ga0068863_1000113003 | 312 |
| 190 | 3300005843 | Ga0068860_100023182 | Ga0068860_1000231821 | 312 |
| 191 | 3300006237 | Ga0097621_100107302 | Ga0097621_1001073022 | 312 |
| 192 | 3300006358 | Ga0068871_100052468 | Ga0068871_1000524683 | 312 |
| 193 | 3300006881 | Ga0068865_100080157 | Ga0068865_1000801572 | 312 |
| 194 | 3300006931 | Ga0097620_100313439 | Ga0097620_1003134392 | 312 |
| 195 | 3300009093 | Ga0105240_10273920 | Ga0105240_102739201 | 312 |
| 196 | 3300009098 | Ga0105245_10026405 | Ga0105245_100264054 | 312 |
| 197 | 3300009176 | Ga0105242_10068003 | Ga0105242_100680032 | 312 |
| 198 | 3300009551 | Ga0105238_10058255 | Ga0105238_100582552 | 312 |
| 199 | 3300010375 | Ga0105239_10289122 | Ga0105239_102891222 | 312 |
| 200 | 3300013297 | Ga0157378_10092217 | Ga0157378_100922172 | 312 |
| 201 | 3300014968 | Ga0157379_10063427 | Ga0157379_100634272 | 312 |
| 202 | 3300014969 | Ga0157376_10060483 | Ga0157376_100604833 | 312 |
| 203 | 3300025903 | Ga0207680_10111604 | Ga0207680_101116041 | 312 |
| 204 | 3300025907 | Ga0207645_10026740 | Ga0207645_100267404 | 312 |
| 205 | 3300025909 | Ga0207705_10008872 | Ga0207705_100088724 | 312 |
| 206 | 3300025919 | Ga0207657_10012932 | Ga0207657_100129322 | 312 |
| 207 | 3300025920 | Ga0207649_10032483 | Ga0207649_100324832 | 312 |
| 208 | 3300025927 | Ga0207687_10227762 | Ga0207687_102277622 | 312 |
| 209 | 3300025931 | Ga0207644_10052433 | Ga0207644_100524332 | 312 |
| 210 | 3300025932 | Ga0207690_10092728 | Ga0207690_100927282 | 312 |
| 211 | 3300025933 | Ga0207706_10006242 | Ga0207706_100062422 | 312 |
| 212 | 3300025937 | Ga0207669_10136055 | Ga0207669_101360551 | 312 |
| 213 | 3300025940 | Ga0207691_10009106 | Ga0207691_1000910616 | 312 |
| 214 | 3300025940 | Ga0207691_10185542 | Ga0207691_101855422 | 312 |
| 215 | 3300025981 | Ga0207640_10079255 | Ga0207640_100792552 | 312 |
| 216 | 3300026023 | Ga0207677_10031297 | Ga0207677_100312972 | 312 |
| 217 | 3300026035 | Ga0207703_10017170 | Ga0207703_100171702 | 312 |
| 218 | 3300026088 | Ga0207641_10018158 | Ga0207641_100181586 | 312 |
| 219 | 3300026089 | Ga0207648_10004248 | Ga0207648_1000424821 | 312 |
| 220 | 3300026118 | Ga0207675_100499586 | Ga0207675_1004995862 | 312 |
| 221 | 3300026121 | Ga0207683_10002371 | Ga0207683_100023715 | 312 |
| 222 | 3300035691 | Ga0373931_0112614 | Ga0373931_0112614_222_1196 | 312 |
| 223 | 3300046475 | Ga0495639_0075590 | Ga0495639_0075590_252_1190 | 312 |
| 224 | 3300046491 | Ga0495584_0000001 | Ga0495584_0000001_72266_73204 | 312 |
| 225 | 3300046492 | Ga0495585_0005245 | Ga0495585_0005245_3279_4217 | 312 |
| 226 | 3300046499 | Ga0495594_0000106 | Ga0495594_0000106_19110_20051 | 312 |
| 227 | 3300046499 | Ga0495594_0003633 | Ga0495594_0003633_3897_4835 | 312 |
| 228 | 3300046542 | Ga0495597_0041329 | Ga0495597_0041329_502_1440 | 312 |
| 229 | 3300046542 | Ga0495597_0113386 | Ga0495597_0113386_60_998 | 312 |
| 230 | 3300046558 | Ga0495633_0009662 | Ga0495633_0009662_2841_3779 | 312 |
| 231 | 3300046665 | Ga0495661_0007342 | Ga0495661_0007342_3809_4747 | 312 |
| 232 | 3300046674 | Ga0495588_0002703 | Ga0495588_0002703_2287_3225 | 312 |
| 233 | 3300046674 | Ga0495588_0036521 | Ga0495588_0036521_806_1756 | 312 |
| 234 | 3300046691 | Ga0495670_0006064 | Ga0495670_0006064_935_1873 | 312 |
| 235 | 3300047318 | Ga0495636_0010746 | Ga0495636_0010746_997_1935 | 312 |
| 236 | 3300047320 | Ga0495672_0000656 | Ga0495672_0000656_23397_24335 | 312 |
| 237 | 3300047470 | Ga0495681_0044824 | Ga0495681_0044824_855_1793 | 312 |
| 238 | 3300048904 | Ga0496101_0135536 | Ga0496101_0135536_777_1751 | 312 |
| 239 | 3300048905 | Ga0496102_0084553 | Ga0496102_0084553_132_1106 | 312 |
| 240 | 3300048907 | Ga0496104_0179144 | Ga0496104_0179144_600_1574 | 312 |
| 241 | 3300048910 | Ga0496107_0053489 | Ga0496107_0053489_1459_2433 | 312 |
| 242 | 3300048913 | Ga0496110_0012297 | Ga0496110_0012297_1977_2951 | 312 |
| 243 | 3300048914 | Ga0496111_0004951 | Ga0496111_0004951_3826_4800 | 312 |
| 244 | 3300048915 | Ga0496112_0071039 | Ga0496112_0071039_2276_3250 | 312 |
| 245 | 3300048916 | Ga0496113_0055823 | Ga0496113_0055823_1872_2846 | 312 |
| 246 | 3300001991 | JGI24743J22301_10011860 | JGI24743J22301_100118602 | 313 |
| 247 | 3300003659 | JGI25404J52841_10010491 | JGI25404J52841_100104911 | 313 |
| 248 | 3300005290 | Ga0065712_10072445 | Ga0065712_100724452 | 313 |
| 249 | 3300005327 | Ga0070658_10012543 | Ga0070658_100125433 | 313 |
| 250 | 3300005327 | Ga0070658_10087173 | Ga0070658_100871732 | 313 |
| 251 | 3300005327 | Ga0070658_10456593 | Ga0070658_104565931 | 313 |
| 252 | 3300005331 | Ga0070670_100000333 | Ga0070670_10000033319 | 313 |
| 253 | 3300005331 | Ga0070670_100004518 | Ga0070670_1000045185 | 313 |
| 254 | 3300005331 | Ga0070670_100005006 | Ga0070670_1000050063 | 313 |
| 255 | 3300005331 | Ga0070670_100029590 | Ga0070670_1000295904 | 313 |
| 256 | 3300005331 | Ga0070670_100036812 | Ga0070670_1000368122 | 313 |
| 257 | 3300005331 | Ga0070670_100056676 | Ga0070670_1000566762 | 313 |
| 258 | 3300005331 | Ga0070670_100064443 | Ga0070670_1000644433 | 313 |
| 259 | 3300005331 | Ga0070670_100100501 | Ga0070670_1001005012 | 313 |
| 260 | 3300005331 | Ga0070670_100112649 | Ga0070670_1001126492 | 313 |
| 261 | 3300005331 | Ga0070670_100177569 | Ga0070670_1001775692 | 313 |
| 262 | 3300005331 | Ga0070670_100371759 | Ga0070670_1003717592 | 313 |
| 263 | 3300005333 | Ga0070677_10001797 | Ga0070677_100017972 | 313 |
| 264 | 3300005333 | Ga0070677_10076333 | Ga0070677_100763331 | 313 |
| 265 | 3300005339 | Ga0070660_100031481 | Ga0070660_1000314812 | 313 |
| 266 | 3300005339 | Ga0070660_100082475 | Ga0070660_1000824752 | 313 |
| 267 | 3300005340 | Ga0070689_100007475 | Ga0070689_1000074753 | 313 |
| 268 | 3300005343 | Ga0070687_100002574 | Ga0070687_1000025742 | 313 |
| 269 | 3300005343 | Ga0070687_100216966 | Ga0070687_1002169662 | 313 |
| 270 | 3300005344 | Ga0070661_100000545 | Ga0070661_10000054518 | 313 |
| 271 | 3300005344 | Ga0070661_100011423 | Ga0070661_1000114238 | 313 |
| 272 | 3300005344 | Ga0070661_100059618 | Ga0070661_1000596184 | 313 |
| 273 | 3300005347 | Ga0070668_100037144 | Ga0070668_1000371442 | 313 |
| 274 | 3300005353 | Ga0070669_100004592 | Ga0070669_1000045926 | 313 |
| 275 | 3300005353 | Ga0070669_100012310 | Ga0070669_1000123104 | 313 |
| 276 | 3300005353 | Ga0070669_100085162 | Ga0070669_1000851622 | 313 |
| 277 | 3300005353 | Ga0070669_100131406 | Ga0070669_1001314062 | 313 |
| 278 | 3300005353 | Ga0070669_100195412 | Ga0070669_1001954121 | 313 |
| 279 | 3300005354 | Ga0070675_100001409 | Ga0070675_1000014094 | 313 |
| 280 | 3300005354 | Ga0070675_100017025 | Ga0070675_1000170253 | 313 |
| 281 | 3300005355 | Ga0070671_100001770 | Ga0070671_10000177013 | 313 |
| 282 | 3300005355 | Ga0070671_100009558 | Ga0070671_1000095583 | 313 |
| 283 | 3300005355 | Ga0070671_100009655 | Ga0070671_1000096553 | 313 |
| 284 | 3300005355 | Ga0070671_100021172 | Ga0070671_1000211722 | 313 |
| 285 | 3300005355 | Ga0070671_100037871 | Ga0070671_1000378712 | 313 |
| 286 | 3300005355 | Ga0070671_100050603 | Ga0070671_1000506033 | 313 |
| 287 | 3300005355 | Ga0070671_100060715 | Ga0070671_1000607152 | 313 |
| 288 | 3300005355 | Ga0070671_100066803 | Ga0070671_1000668033 | 313 |
| 289 | 3300005355 | Ga0070671_100122423 | Ga0070671_1001224232 | 313 |
| 290 | 3300005355 | Ga0070671_100194281 | Ga0070671_1001942812 | 313 |
| 291 | 3300005356 | Ga0070674_100013581 | Ga0070674_1000135812 | 313 |
| 292 | 3300005356 | Ga0070674_100079318 | Ga0070674_1000793182 | 313 |
| 293 | 3300005364 | Ga0070673_100000300 | Ga0070673_1000003003 | 313 |
| 294 | 3300005364 | Ga0070673_100039479 | Ga0070673_1000394792 | 313 |
| 295 | 3300005364 | Ga0070673_100114494 | Ga0070673_1001144942 | 313 |
| 296 | 3300005366 | Ga0070659_100002628 | Ga0070659_1000026284 | 313 |
| 297 | 3300005366 | Ga0070659_100276291 | Ga0070659_1002762911 | 313 |
| 298 | 3300005436 | Ga0070713_100010826 | Ga0070713_1000108262 | 313 |
| 299 | 3300005437 | Ga0070710_10016878 | Ga0070710_100168782 | 313 |
| 300 | 3300005440 | Ga0070705_100002258 | Ga0070705_1000022582 | 313 |
| 301 | 3300005455 | Ga0070663_100016283 | Ga0070663_1000162835 | 313 |
| 302 | 3300005455 | Ga0070663_100020564 | Ga0070663_1000205646 | 313 |
| 303 | 3300005455 | Ga0070663_100178664 | Ga0070663_1001786642 | 313 |
| 304 | 3300005456 | Ga0070678_100007469 | Ga0070678_1000074695 | 313 |
| 305 | 3300005456 | Ga0070678_100131068 | Ga0070678_1001310682 | 313 |
| 306 | 3300005457 | Ga0070662_100010863 | Ga0070662_1000108638 | 313 |
| 307 | 3300005457 | Ga0070662_100016370 | Ga0070662_1000163706 | 313 |
| 308 | 3300005457 | Ga0070662_100039751 | Ga0070662_1000397512 | 313 |
| 309 | 3300005457 | Ga0070662_100051656 | Ga0070662_1000516562 | 313 |
| 310 | 3300005457 | Ga0070662_100086952 | Ga0070662_1000869523 | 313 |
| 311 | 3300005457 | Ga0070662_100091954 | Ga0070662_1000919541 | 313 |
| 312 | 3300005457 | Ga0070662_100099363 | Ga0070662_1000993632 | 313 |
| 313 | 3300005457 | Ga0070662_100176156 | Ga0070662_1001761562 | 313 |
| 314 | 3300005457 | Ga0070662_100242281 | Ga0070662_1002422812 | 313 |
| 315 | 3300005458 | Ga0070681_10186457 | Ga0070681_101864574 | 313 |
| 316 | 3300005530 | Ga0070679_100042606 | Ga0070679_1000426062 | 313 |
| 317 | 3300005535 | Ga0070684_100084908 | Ga0070684_1000849082 | 313 |
| 318 | 3300005539 | Ga0068853_100165091 | Ga0068853_1001650912 | 313 |
| 319 | 3300005543 | Ga0070672_100012862 | Ga0070672_1000128623 | 313 |
| 320 | 3300005543 | Ga0070672_100024407 | Ga0070672_1000244072 | 313 |
| 321 | 3300005543 | Ga0070672_100095935 | Ga0070672_1000959353 | 313 |
| 322 | 3300005544 | Ga0070686_100001982 | Ga0070686_1000019824 | 313 |
| 323 | 3300005564 | Ga0070664_100000558 | Ga0070664_10000055814 | 313 |
| 324 | 3300005564 | Ga0070664_100005749 | Ga0070664_1000057496 | 313 |
| 325 | 3300005564 | Ga0070664_100064312 | Ga0070664_1000643122 | 313 |
| 326 | 3300005564 | Ga0070664_100082862 | Ga0070664_1000828622 | 313 |
| 327 | 3300005564 | Ga0070664_100083601 | Ga0070664_1000836012 | 313 |
| 328 | 3300005564 | Ga0070664_100154814 | Ga0070664_1001548141 | 313 |
| 329 | 3300005564 | Ga0070664_100200865 | Ga0070664_1002008652 | 313 |
| 330 | 3300005577 | Ga0068857_100011361 | Ga0068857_1000113612 | 313 |
| 331 | 3300005577 | Ga0068857_100208162 | Ga0068857_1002081621 | 313 |
| 332 | 3300005578 | Ga0068854_100010732 | Ga0068854_1000107322 | 313 |
| 333 | 3300005614 | Ga0068856_100378877 | Ga0068856_1003788771 | 313 |
| 334 | 3300005618 | Ga0068864_100000487 | Ga0068864_1000004873 | 313 |
| 335 | 3300005618 | Ga0068864_100004640 | Ga0068864_1000046405 | 313 |
| 336 | 3300005618 | Ga0068864_100068693 | Ga0068864_1000686932 | 313 |
| 337 | 3300005618 | Ga0068864_100199075 | Ga0068864_1001990752 | 313 |
| 338 | 3300005618 | Ga0068864_100343726 | Ga0068864_1003437262 | 313 |
| 339 | 3300005718 | Ga0068866_10081486 | Ga0068866_100814862 | 313 |
| 340 | 3300005841 | Ga0068863_100053573 | Ga0068863_1000535735 | 313 |
| 341 | 3300005843 | Ga0068860_100020147 | Ga0068860_1000201477 | 313 |
| 342 | 3300005843 | Ga0068860_100076617 | Ga0068860_1000766172 | 313 |
| 343 | 3300005843 | Ga0068860_100370068 | Ga0068860_1003700682 | 313 |
| 344 | 3300005983 | Ga0081540_1001103 | Ga0081540_10011035 | 313 |
| 345 | 3300005983 | Ga0081540_1002217 | Ga0081540_10022178 | 313 |
| 346 | 3300006175 | Ga0070712_100009973 | Ga0070712_1000099733 | 313 |
| 347 | 3300006358 | Ga0068871_100238791 | Ga0068871_1002387912 | 313 |
| 348 | 3300006844 | Ga0075428_100024288 | Ga0075428_1000242885 | 313 |
| 349 | 3300006881 | Ga0068865_100020904 | Ga0068865_1000209042 | 313 |
| 350 | 3300009093 | Ga0105240_10001450 | Ga0105240_100014504 | 313 |
| 351 | 3300009093 | Ga0105240_10021752 | Ga0105240_100217522 | 313 |
| 352 | 3300009094 | Ga0111539_10230394 | Ga0111539_102303942 | 313 |
| 353 | 3300009094 | Ga0111539_10239315 | Ga0111539_102393152 | 313 |
| 354 | 3300009094 | Ga0111539_10431339 | Ga0111539_104313392 | 313 |
| 355 | 3300009098 | Ga0105245_10050563 | Ga0105245_100505632 | 313 |
| 356 | 3300009174 | Ga0105241_10004888 | Ga0105241_100048882 | 313 |
| 357 | 3300009174 | Ga0105241_10126078 | Ga0105241_101260782 | 313 |
| 358 | 3300009177 | Ga0105248_10001528 | Ga0105248_100015288 | 313 |
| 359 | 3300009177 | Ga0105248_10002100 | Ga0105248_1000210018 | 313 |
| 360 | 3300009177 | Ga0105248_10009072 | Ga0105248_100090723 | 313 |
| 361 | 3300009177 | Ga0105248_10010223 | Ga0105248_100102235 | 313 |
| 362 | 3300009177 | Ga0105248_10060005 | Ga0105248_100600053 | 313 |
| 363 | 3300009177 | Ga0105248_10102106 | Ga0105248_101021062 | 313 |
| 364 | 3300009177 | Ga0105248_10216217 | Ga0105248_102162172 | 313 |
| 365 | 3300009177 | Ga0105248_10264893 | Ga0105248_102648932 | 313 |
| 366 | 3300009553 | Ga0105249_10000765 | Ga0105249_100007652 | 313 |
| 367 | 3300010375 | Ga0105239_10025535 | Ga0105239_100255352 | 313 |
| 368 | 3300013100 | Ga0157373_10031648 | Ga0157373_100316483 | 313 |
| 369 | 3300013102 | Ga0157371_10000585 | Ga0157371_1000058540 | 313 |
| 370 | 3300013102 | Ga0157371_10131138 | Ga0157371_101311382 | 313 |
| 371 | 3300013297 | Ga0157378_10001666 | Ga0157378_1000166615 | 313 |
| 372 | 3300013306 | Ga0163162_10000590 | Ga0163162_1000059015 | 313 |
| 373 | 3300013306 | Ga0163162_10129598 | Ga0163162_101295982 | 313 |
| 374 | 3300013308 | Ga0157375_10007958 | Ga0157375_1000795812 | 313 |
| 375 | 3300013308 | Ga0157375_10327805 | Ga0157375_103278052 | 313 |
| 376 | 3300014325 | Ga0163163_10122468 | Ga0163163_101224682 | 313 |
| 377 | 3300014326 | Ga0157380_10005457 | Ga0157380_100054577 | 313 |
| 378 | 3300014326 | Ga0157380_10015277 | Ga0157380_100152773 | 313 |
| 379 | 3300014326 | Ga0157380_10035011 | Ga0157380_100350112 | 313 |
| 380 | 3300014326 | Ga0157380_10059072 | Ga0157380_100590723 | 313 |
| 381 | 3300014326 | Ga0157380_10183039 | Ga0157380_101830392 | 313 |
| 382 | 3300014326 | Ga0157380_10245189 | Ga0157380_102451892 | 313 |
| 383 | 3300014745 | Ga0157377_10000555 | Ga0157377_100005556 | 313 |
| 384 | 3300014969 | Ga0157376_10000627 | Ga0157376_1000062726 | 313 |
| 385 | 3300017792 | Ga0163161_10002499 | Ga0163161_100024994 | 313 |
| 386 | 3300017792 | Ga0163161_10052637 | Ga0163161_100526373 | 313 |
| 387 | 3300017792 | Ga0163161_10063782 | Ga0163161_100637822 | 313 |
| 388 | 3300017792 | Ga0163161_10086768 | Ga0163161_100867682 | 313 |
| 389 | 3300017792 | Ga0163161_10088747 | Ga0163161_100887472 | 313 |
| 390 | 3300025315 | Ga0207697_10008313 | Ga0207697_100083132 | 313 |
| 391 | 3300025893 | Ga0207682_10000111 | Ga0207682_1000011131 | 313 |
| 392 | 3300025893 | Ga0207682_10000662 | Ga0207682_100006628 | 313 |
| 393 | 3300025893 | Ga0207682_10063210 | Ga0207682_100632102 | 313 |
| 394 | 3300025898 | Ga0207692_10071259 | Ga0207692_100712592 | 313 |
| 395 | 3300025900 | Ga0207710_10004942 | Ga0207710_100049422 | 313 |
| 396 | 3300025901 | Ga0207688_10000076 | Ga0207688_100000763 | 313 |
| 397 | 3300025901 | Ga0207688_10104369 | Ga0207688_101043692 | 313 |
| 398 | 3300025903 | Ga0207680_10083609 | Ga0207680_100836091 | 313 |
| 399 | 3300025904 | Ga0207647_10008421 | Ga0207647_100084213 | 313 |
| 400 | 3300025907 | Ga0207645_10000016 | Ga0207645_1000001641 | 313 |
| 401 | 3300025908 | Ga0207643_10000010 | Ga0207643_1000001041 | 313 |
| 402 | 3300025909 | Ga0207705_10023151 | Ga0207705_100231513 | 313 |
| 403 | 3300025913 | Ga0207695_10275582 | Ga0207695_102755823 | 313 |
| 404 | 3300025915 | Ga0207693_10033175 | Ga0207693_100331753 | 313 |
| 405 | 3300025917 | Ga0207660_10066237 | Ga0207660_100662371 | 313 |
| 406 | 3300025918 | Ga0207662_10000014 | Ga0207662_1000001432 | 313 |
| 407 | 3300025919 | Ga0207657_10000060 | Ga0207657_1000006089 | 313 |
| 408 | 3300025919 | Ga0207657_10062553 | Ga0207657_100625532 | 313 |
| 409 | 3300025919 | Ga0207657_10242271 | Ga0207657_102422712 | 313 |
| 410 | 3300025920 | Ga0207649_10001207 | Ga0207649_100012078 | 313 |
| 411 | 3300025920 | Ga0207649_10014785 | Ga0207649_100147855 | 313 |
| 412 | 3300025920 | Ga0207649_10018547 | Ga0207649_100185475 | 313 |
| 413 | 3300025920 | Ga0207649_10139753 | Ga0207649_101397532 | 313 |
| 414 | 3300025920 | Ga0207649_10206749 | Ga0207649_102067491 | 313 |
| 415 | 3300025923 | Ga0207681_10002071 | Ga0207681_100020714 | 313 |
| 416 | 3300025923 | Ga0207681_10044015 | Ga0207681_100440152 | 313 |
| 417 | 3300025923 | Ga0207681_10345386 | Ga0207681_103453861 | 313 |
| 418 | 3300025923 | Ga0207681_10373089 | Ga0207681_103730892 | 313 |
| 419 | 3300025925 | Ga0207650_10003050 | Ga0207650_100030503 | 313 |
| 420 | 3300025925 | Ga0207650_10003575 | Ga0207650_100035756 | 313 |
| 421 | 3300025925 | Ga0207650_10005549 | Ga0207650_100055493 | 313 |
| 422 | 3300025925 | Ga0207650_10025063 | Ga0207650_100250633 | 313 |
| 423 | 3300025925 | Ga0207650_10046824 | Ga0207650_100468242 | 313 |
| 424 | 3300025925 | Ga0207650_10070085 | Ga0207650_100700852 | 313 |
| 425 | 3300025925 | Ga0207650_10318172 | Ga0207650_103181722 | 313 |
| 426 | 3300025926 | Ga0207659_10003360 | Ga0207659_100033605 | 313 |
| 427 | 3300025926 | Ga0207659_10009623 | Ga0207659_100096237 | 313 |
| 428 | 3300025926 | Ga0207659_10030155 | Ga0207659_100301552 | 313 |
| 429 | 3300025929 | Ga0207664_10023845 | Ga0207664_100238452 | 313 |
| 430 | 3300025931 | Ga0207644_10001325 | Ga0207644_100013257 | 313 |
| 431 | 3300025931 | Ga0207644_10006562 | Ga0207644_100065625 | 313 |
| 432 | 3300025931 | Ga0207644_10014305 | Ga0207644_100143053 | 313 |
| 433 | 3300025931 | Ga0207644_10017574 | Ga0207644_100175744 | 313 |
| 434 | 3300025931 | Ga0207644_10018466 | Ga0207644_100184663 | 313 |
| 435 | 3300025931 | Ga0207644_10031962 | Ga0207644_100319622 | 313 |
| 436 | 3300025931 | Ga0207644_10048636 | Ga0207644_100486363 | 313 |
| 437 | 3300025931 | Ga0207644_10057431 | Ga0207644_100574312 | 313 |
| 438 | 3300025931 | Ga0207644_10070036 | Ga0207644_100700362 | 313 |
| 439 | 3300025931 | Ga0207644_10160304 | Ga0207644_101603042 | 313 |
| 440 | 3300025931 | Ga0207644_10292657 | Ga0207644_102926571 | 313 |
| 441 | 3300025932 | Ga0207690_10035242 | Ga0207690_100352422 | 313 |
| 442 | 3300025932 | Ga0207690_10136473 | Ga0207690_101364732 | 313 |
| 443 | 3300025933 | Ga0207706_10000132 | Ga0207706_100001322 | 313 |
| 444 | 3300025933 | Ga0207706_10011039 | Ga0207706_100110394 | 313 |
| 445 | 3300025933 | Ga0207706_10027737 | Ga0207706_100277376 | 313 |
| 446 | 3300025933 | Ga0207706_10029078 | Ga0207706_100290783 | 313 |
| 447 | 3300025933 | Ga0207706_10059993 | Ga0207706_100599934 | 313 |
| 448 | 3300025933 | Ga0207706_10124348 | Ga0207706_101243482 | 313 |
| 449 | 3300025933 | Ga0207706_10276120 | Ga0207706_102761202 | 313 |
| 450 | 3300025935 | Ga0207709_10005096 | Ga0207709_100050968 | 313 |
| 451 | 3300025936 | Ga0207670_10031047 | Ga0207670_100310475 | 313 |
| 452 | 3300025937 | Ga0207669_10018286 | Ga0207669_100182862 | 313 |
| 453 | 3300025937 | Ga0207669_10022376 | Ga0207669_100223762 | 313 |
| 454 | 3300025937 | Ga0207669_10183439 | Ga0207669_101834392 | 313 |
| 455 | 3300025938 | Ga0207704_10219408 | Ga0207704_102194082 | 313 |
| 456 | 3300025940 | Ga0207691_10000011 | Ga0207691_1000001185 | 313 |
| 457 | 3300025940 | Ga0207691_10004037 | Ga0207691_100040376 | 313 |
| 458 | 3300025940 | Ga0207691_10063321 | Ga0207691_100633213 | 313 |
| 459 | 3300025940 | Ga0207691_10077666 | Ga0207691_100776662 | 313 |
| 460 | 3300025940 | Ga0207691_10109835 | Ga0207691_101098353 | 313 |
| 461 | 3300025941 | Ga0207711_10000345 | Ga0207711_1000034536 | 313 |
| 462 | 3300025941 | Ga0207711_10005958 | Ga0207711_100059585 | 313 |
| 463 | 3300025941 | Ga0207711_10012804 | Ga0207711_100128042 | 313 |
| 464 | 3300025941 | Ga0207711_10035389 | Ga0207711_100353892 | 313 |
| 465 | 3300025941 | Ga0207711_10070869 | Ga0207711_100708692 | 313 |
| 466 | 3300025941 | Ga0207711_10108521 | Ga0207711_101085212 | 313 |
| 467 | 3300025942 | Ga0207689_10000011 | Ga0207689_1000001141 | 313 |
| 468 | 3300025945 | Ga0207679_10000250 | Ga0207679_100002506 | 313 |
| 469 | 3300025945 | Ga0207679_10023018 | Ga0207679_100230183 | 313 |
| 470 | 3300025945 | Ga0207679_10042792 | Ga0207679_100427922 | 313 |
| 471 | 3300025945 | Ga0207679_10092253 | Ga0207679_100922532 | 313 |
| 472 | 3300025945 | Ga0207679_10215982 | Ga0207679_102159822 | 313 |
| 473 | 3300025960 | Ga0207651_10001464 | Ga0207651_100014649 | 313 |
| 474 | 3300025960 | Ga0207651_10037502 | Ga0207651_100375022 | 313 |
| 475 | 3300025960 | Ga0207651_10146454 | Ga0207651_101464541 | 313 |
| 476 | 3300025960 | Ga0207651_10333455 | Ga0207651_103334552 | 313 |
| 477 | 3300025961 | Ga0207712_10000795 | Ga0207712_1000079515 | 313 |
| 478 | 3300025981 | Ga0207640_10008148 | Ga0207640_100081482 | 313 |
| 479 | 3300025986 | Ga0207658_10010621 | Ga0207658_100106213 | 313 |
| 480 | 3300025986 | Ga0207658_10157177 | Ga0207658_101571772 | 313 |
| 481 | 3300026023 | Ga0207677_10000219 | Ga0207677_100002198 | 313 |
| 482 | 3300026035 | Ga0207703_10000434 | Ga0207703_100004344 | 313 |
| 483 | 3300026035 | Ga0207703_10259400 | Ga0207703_102594002 | 313 |
| 484 | 3300026041 | Ga0207639_10149166 | Ga0207639_101491662 | 313 |
| 485 | 3300026067 | Ga0207678_10002515 | Ga0207678_100025156 | 313 |
| 486 | 3300026067 | Ga0207678_10029231 | Ga0207678_100292313 | 313 |
| 487 | 3300026067 | Ga0207678_10260109 | Ga0207678_102601092 | 313 |
| 488 | 3300026088 | Ga0207641_10007924 | Ga0207641_100079243 | 313 |
| 489 | 3300026088 | Ga0207641_10079950 | Ga0207641_100799502 | 313 |
| 490 | 3300026089 | Ga0207648_10000258 | Ga0207648_100002582 | 313 |
| 491 | 3300026089 | Ga0207648_10026314 | Ga0207648_100263142 | 313 |
| 492 | 3300026095 | Ga0207676_10007059 | Ga0207676_100070593 | 313 |
| 493 | 3300026095 | Ga0207676_10020930 | Ga0207676_100209303 | 313 |
| 494 | 3300026095 | Ga0207676_10037419 | Ga0207676_100374192 | 313 |
| 495 | 3300026095 | Ga0207676_10108198 | Ga0207676_101081982 | 313 |
| 496 | 3300026095 | Ga0207676_10161850 | Ga0207676_101618502 | 313 |
| 497 | 3300026116 | Ga0207674_10001589 | Ga0207674_100015896 | 313 |
| 498 | 3300026116 | Ga0207674_10006098 | Ga0207674_1000609812 | 313 |
| 499 | 3300026116 | Ga0207674_10141597 | Ga0207674_101415971 | 313 |
| 500 | 3300026118 | Ga0207675_100000164 | Ga0207675_1000001643 | 313 |
| 501 | 3300026121 | Ga0207683_10000080 | Ga0207683_1000008020 | 313 |
| 502 | 3300026121 | Ga0207683_10008588 | Ga0207683_100085889 | 313 |
| 503 | 3300026121 | Ga0207683_10074002 | Ga0207683_100740022 | 313 |
| 504 | 3300026121 | Ga0207683_10100350 | Ga0207683_101003501 | 313 |
| 505 | 3300026121 | Ga0207683_10233435 | Ga0207683_102334352 | 313 |
| 506 | 3300026142 | Ga0207698_10267424 | Ga0207698_102674242 | 313 |
| 507 | 3300028379 | Ga0268266_10022945 | Ga0268266_100229453 | 313 |
| 508 | 3300028380 | Ga0268265_10001169 | Ga0268265_100011694 | 313 |
| 509 | 3300028380 | Ga0268265_10088422 | Ga0268265_100884222 | 313 |
| 510 | 3300028381 | Ga0268264_10001259 | Ga0268264_100012596 | 313 |
| 511 | 3300031731 | Ga0307405_10301344 | Ga0307405_103013442 | 313 |
| 512 | 3300031852 | Ga0307410_10000425 | Ga0307410_100004253 | 313 |
| 513 | 3300031852 | Ga0307410_10023180 | Ga0307410_100231803 | 313 |
| 514 | 3300031852 | Ga0307410_10153613 | Ga0307410_101536132 | 313 |
| 515 | 3300031852 | Ga0307410_10349586 | Ga0307410_103495862 | 313 |
| 516 | 3300031901 | Ga0307406_10424455 | Ga0307406_104244551 | 313 |
| 517 | 3300031995 | Ga0307409_100021116 | Ga0307409_1000211163 | 313 |
| 518 | 3300031995 | Ga0307409_100095503 | Ga0307409_1000955032 | 313 |
| 519 | 3300032002 | Ga0307416_100038095 | Ga0307416_1000380952 | 313 |
| 520 | 3300032002 | Ga0307416_100074064 | Ga0307416_1000740642 | 313 |
| 521 | 3300032002 | Ga0307416_100147399 | Ga0307416_1001473992 | 313 |
| 522 | 3300032004 | Ga0307414_10004523 | Ga0307414_1000452310 | 313 |
| 523 | 3300032004 | Ga0307414_10172241 | Ga0307414_101722412 | 313 |
| 524 | 3300032004 | Ga0307414_10339400 | Ga0307414_103394002 | 313 |
| 525 | 3300032005 | Ga0307411_10001130 | Ga0307411_100011309 | 313 |
| 526 | 3300032005 | Ga0307411_10029154 | Ga0307411_100291545 | 313 |
| 527 | 3300032005 | Ga0307411_10114470 | Ga0307411_101144702 | 313 |
| 528 | 3300032005 | Ga0307411_10220984 | Ga0307411_102209842 | 313 |
| 529 | 3300035170 | Ga0373943_0001816 | Ga0373943_0001816_5152_6123 | 313 |
| 530 | 3300037068 | Ga0373925_0010421 | Ga0373925_0010421_4950_5921 | 313 |
| 531 | 3300037312 | Ga0395899_0011101 | Ga0395899_0011101_934_1905 | 313 |
| 532 | 3300037312 | Ga0395899_0069849 | Ga0395899_0069849_156_1127 | 313 |
| 533 | 3300037418 | Ga0395900_0054480 | Ga0395900_0054480_1053_2024 | 313 |
| 534 | 3300037466 | Ga0395898_0182456 | Ga0395898_0182456_692_1663 | 313 |
| 535 | 3300037471 | Ga0395905_0001203 | Ga0395905_0001203_11188_12159 | 313 |
| 536 | 3300037471 | Ga0395905_0112163 | Ga0395905_0112163_546_1517 | 313 |
| 537 | 3300037471 | Ga0395905_0165738 | Ga0395905_0165738_406_1377 | 313 |
| 538 | 3300039450 | Ga0436363_0864307 | Ga0436363_0864307_248_1189 | 313 |
| 539 | 3300042005 | Ga0439448_0001486 | Ga0439448_0001486_2426_3367 | 313 |
| 540 | 3300046515 | Ga0495620_0071687 | Ga0495620_0071687_155_1126 | 313 |
| 541 | 3300046539 | Ga0495621_0002100 | Ga0495621_0002100_3406_4377 | 313 |
| 542 | 3300046684 | Ga0495669_0001409 | Ga0495669_0001409_3394_4431 | 313 |
| 543 | 3300046684 | Ga0495669_0007425 | Ga0495669_0007425_1109_2089 | 313 |
| 544 | 3300046684 | Ga0495669_0024398 | Ga0495669_0024398_799_1770 | 313 |
| 545 | 3300046684 | Ga0495669_0061416 | Ga0495669_0061416_483_1469 | 313 |
| 546 | 3300046691 | Ga0495670_0120943 | Ga0495670_0120943_184_1155 | 313 |
| 547 | 3300048903 | Ga0496100_0009086 | Ga0496100_0009086_527_1498 | 313 |
| 548 | 3300048904 | Ga0496101_0003840 | Ga0496101_0003840_2435_3421 | 313 |
| 549 | 3300048904 | Ga0496101_0024562 | Ga0496101_0024562_10_981 | 313 |
| 550 | 3300048904 | Ga0496101_0087878 | Ga0496101_0087878_834_1811 | 313 |
| 551 | 3300048905 | Ga0496102_0006567 | Ga0496102_0006567_1543_2484 | 313 |
| 552 | 3300048907 | Ga0496104_0030451 | Ga0496104_0030451_2294_3271 | 313 |
| 553 | 3300048907 | Ga0496104_0207376 | Ga0496104_0207376_507_1493 | 313 |
| 554 | 3300048909 | Ga0496106_0001460 | Ga0496106_0001460_7396_8382 | 313 |
| 555 | 3300048909 | Ga0496106_0019355 | Ga0496106_0019355_10_951 | 313 |
| 556 | 3300048910 | Ga0496107_0008863 | Ga0496107_0008863_5776_6717 | 313 |
| 557 | 3300048910 | Ga0496107_0016472 | Ga0496107_0016472_531_1517 | 313 |
| 558 | 3300048910 | Ga0496107_0045793 | Ga0496107_0045793_1523_2503 | 313 |
| 559 | 3300048911 | Ga0496108_0180403 | Ga0496108_0180403_705_1646 | 313 |
| 560 | 3300048912 | Ga0496109_0001761 | Ga0496109_0001761_164_1150 | 313 |
| 561 | 3300048912 | Ga0496109_0012908 | Ga0496109_0012908_4100_5041 | 313 |
| 562 | 3300048912 | Ga0496109_0072010 | Ga0496109_0072010_1185_2156 | 313 |
| 563 | 3300048912 | Ga0496109_0072933 | Ga0496109_0072933_1533_2504 | 313 |
| 564 | 3300048912 | Ga0496109_0130791 | Ga0496109_0130791_729_1706 | 313 |
| 565 | 3300048912 | Ga0496109_0135357 | Ga0496109_0135357_101_1075 | 313 |
| 566 | 3300048912 | Ga0496109_0173580 | Ga0496109_0173580_779_1759 | 313 |
| 567 | 3300048913 | Ga0496110_0005414 | Ga0496110_0005414_3363_4343 | 313 |
| 568 | 3300048913 | Ga0496110_0009390 | Ga0496110_0009390_5900_6886 | 313 |
| 569 | 3300048913 | Ga0496110_0041259 | Ga0496110_0041259_1904_2875 | 313 |
| 570 | 3300048914 | Ga0496111_0000782 | Ga0496111_0000782_6678_7658 | 313 |
| 571 | 3300048914 | Ga0496111_0008972 | Ga0496111_0008972_170_1150 | 313 |
| 572 | 3300048914 | Ga0496111_0033780 | Ga0496111_0033780_1696_2673 | 313 |
| 573 | 3300048915 | Ga0496112_0011111 | Ga0496112_0011111_3108_4049 | 313 |
| 574 | 3300048915 | Ga0496112_0016757 | Ga0496112_0016757_4670_5656 | 313 |
| 575 | 3300048915 | Ga0496112_0069327 | Ga0496112_0069327_277_1248 | 313 |
| 576 | 3300048915 | Ga0496112_0286829 | Ga0496112_0286829_361_1338 | 313 |
| 577 | 3300048915 | Ga0496112_0465808 | Ga0496112_0465808_58_1029 | 313 |
| 578 | 3300048916 | Ga0496113_0010228 | Ga0496113_0010228_1425_2396 | 313 |
| 579 | 3300048916 | Ga0496113_0156730 | Ga0496113_0156730_498_1469 | 313 |
| 580 | 3300048917 | Ga0496114_0006322 | Ga0496114_0006322_5275_6255 | 313 |
| 581 | 3300048917 | Ga0496114_0071835 | Ga0496114_0071835_1759_2730 | 313 |
| 582 | 3300048917 | Ga0496114_0089144 | Ga0496114_0089144_949_1920 | 313 |
| 583 | 3300048918 | Ga0496115_0000750 | Ga0496115_0000750_1034_2005 | 313 |
| 584 | 3300049823 | Ga0501044_0057398 | Ga0501044_0057398_2096_3046 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vg9-assembly1.cif.gz_A | crystal structure of phosphotransbutyrylase from clostridium acetobutylicum | 0.953 | 8 | 300 |
| 7vg9-assembly1.cif.gz_A | crystal structure of phosphotransbutyrylase from clostridium acetobutylicum | 0.9255 | 8 | 300 |
| 3u9e-assembly1.cif.gz_B | the crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa. | 0.9141 | 20 | 299 |
| 1yco-assembly1.cif.gz_A | crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583 | 0.8936 | 21 | 299 |
| 1yco-assembly1.cif.gz_B | crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583 | 0.8897 | 21 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u9eA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9151 | 20 | 299 | 3.40.718.10 |
| 1ycoB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8897 | 21 | 300 | 3.40.718.10 |
| 1ycoB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8803 | 21 | 300 | 3.40.718.10 |
| 3u9eA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8714 | 20 | 299 | 3.40.718.10 |
| af_Q2G0J0_17_327_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8409 | 22 | 298 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536WXC6-F1-model_v4 | Phosphate acetyltransferase (EC 2.3.1.8) | 0.9901 | 5 | 104 |
GO:0008959
|
| AF-T0YYQ8-F1-model_v4 | Bifunctional enoyl-CoA hydratase/phosphate acetyltransferase | 0.9752 | 1 | 137 |
GO:0016740
|
| AF-A0A3N5YH57-F1-model_v4 | Bifunctional enoyl-CoA hydratase/phosphate acetyltransferase | 0.9743 | 1 | 142 |
GO:0005524
GO:0006633 GO:0019171 GO:0047761 |
| AF-A0A7T4R738-F1-model_v4 | deleted | 0.9725 | 5 | 299 |
|
| AF-A0A6A7RYE1-F1-model_v4 | Enoyl-CoA hydratase | 0.9703 | 4 | 178 |
GO:0016746
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar