F466338

General Info

Members Datasets Scaffolds Average Seq Length
584 237 581 317

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100039751|Ga0070662_1000397512
Length 345
Sequence MLHFHSEERSANRRAADSKETPMSVLEAEAPVSRNDHAKFHKLIATAQKHAPVKVAVAHPCDQVSLESVIEAANLKLIEPILVGPEQRIREVAAKHALDISRFEIVDAEYSQESAEKAVALVREGRAEALMKGSLHTDEVMAAVVKRETGLRTSRRVSHCFVMDVPGHDQPLIITDAAVNIAPDLKAKVDITQNAIDLAHALSPGDIRVAILSAMESVNPDVPSTLEAAALCKMAERGQITGAVLDGPLALDNAISMEAAAIKKIKSPVAGRANVLVVPDLEAGNMLAKSLSFLAGADAAGIVLGARVPVILTSRADDERARLASCAVAQLLVAARRADASAAIQ

Samples

Sample ID Description Type Environment
1 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
2 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
3 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
234 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.68
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 9.25
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10011860 3300001991 Bacteria 1578
2 JGI25153J46596_10023647 3300003215 Bacteria 2234
3 Ga0007417J51691_1018961 3300003544 Bacteria 6330
4 Ga0007429J51699_1032193 3300003579 Bacteria 6854
5 JGI25404J52841_10010491 3300003659 Bacteria 1992
6 Ga0032354_1009780 3300003693 Bacteria 6947
7 Ga0006780_1034692 3300003735 Bacteria 2809
8 Ga0055537_1001075 3300003773 Bacteria 12107
9 Ga0055524_1003687 3300003775 Bacteria 7331
10 Ga0055528_1002814 3300003790 Bacteria 9099
11 Ga0065712_10072445 3300005290 Bacteria 4751
12 Ga0065715_10142795 3300005293 Bacteria 1828
13 Ga0070658_10008251 3300005327 Bacteria 8381
14 Ga0070658_10012543 3300005327 Bacteria 6799
15 Ga0070658_10087173 3300005327 Bacteria 2569
16 Ga0070658_10456593 3300005327 Bacteria 1101
17 Ga0070676_10064858 3300005328 Bacteria 2179
18 Ga0070683_100124783 3300005329 Bacteria 2433
19 Ga0070690_100003185 3300005330 Bacteria 8950
20 Ga0070670_100000038 3300005331 Bacteria 153333
21 Ga0070670_100000333 3300005331 Bacteria 39598
22 Ga0070670_100004518 3300005331 Bacteria 11661
23 Ga0070670_100005006 3300005331 Bacteria 11148
24 Ga0070670_100029590 3300005331 Bacteria 4715
25 Ga0070670_100036812 3300005331 Bacteria 4210
26 Ga0070670_100056676 3300005331 Bacteria 3363
27 Ga0070670_100064443 3300005331 Bacteria 3144
28 Ga0070670_100100501 3300005331 Bacteria 2490
29 Ga0070670_100112649 3300005331 Bacteria 2345
30 Ga0070670_100163025 3300005331 Bacteria 1932
31 Ga0070670_100177569 3300005331 Bacteria 1848
32 Ga0070670_100371759 3300005331 Bacteria 1258
33 Ga0070677_10001797 3300005333 Bacteria 6785
34 Ga0070677_10076333 3300005333 Bacteria 1423
35 Ga0070666_10003297 3300005335 Bacteria 9785
36 Ga0070666_10006841 3300005335 Bacteria 7024
37 Ga0070666_10013709 3300005335 Bacteria 5146
38 Ga0068868_100022702 3300005338 Bacteria 4740
39 Ga0068868_100141245 3300005338 Bacteria 1977
40 Ga0070660_100025931 3300005339 Bacteria 4361
41 Ga0070660_100031481 3300005339 Bacteria 3984
42 Ga0070660_100082475 3300005339 Bacteria 2525
43 Ga0070689_100007475 3300005340 Bacteria 7643
44 Ga0070687_100002574 3300005343 Bacteria 6841
45 Ga0070687_100216966 3300005343 Bacteria 1169
46 Ga0070661_100000545 3300005344 Bacteria 28860
47 Ga0070661_100011423 3300005344 Bacteria 6186
48 Ga0070661_100043849 3300005344 Bacteria 3267
49 Ga0070661_100059618 3300005344 Bacteria 2799
50 Ga0070668_100000224 3300005347 Bacteria 36476
51 Ga0070668_100037144 3300005347 Bacteria 3718
52 Ga0070669_100004592 3300005353 Bacteria 9968
53 Ga0070669_100012310 3300005353 Bacteria 6069
54 Ga0070669_100085162 3300005353 Bacteria 2360
55 Ga0070669_100131406 3300005353 Bacteria 1921
56 Ga0070669_100195412 3300005353 Bacteria 1589
57 Ga0070675_100001409 3300005354 Bacteria 17655
58 Ga0070675_100017025 3300005354 Bacteria 5777
59 Ga0070671_100001770 3300005355 Bacteria 16415
60 Ga0070671_100009558 3300005355 Bacteria 7790
61 Ga0070671_100009655 3300005355 Bacteria 7752
62 Ga0070671_100016988 3300005355 Bacteria 5884
63 Ga0070671_100021172 3300005355 Bacteria 5309
64 Ga0070671_100037871 3300005355 Bacteria 4002
65 Ga0070671_100050603 3300005355 Bacteria 3455
66 Ga0070671_100060715 3300005355 Bacteria 3148
67 Ga0070671_100066803 3300005355 Bacteria 2997
68 Ga0070671_100122423 3300005355 Bacteria 2189
69 Ga0070671_100194281 3300005355 Bacteria 1720
70 Ga0070674_100013581 3300005356 Bacteria 5039
71 Ga0070674_100079318 3300005356 Bacteria 2342
72 Ga0070674_100366179 3300005356 Bacteria 1168
73 Ga0070673_100000300 3300005364 Bacteria 25842
74 Ga0070673_100026432 3300005364 Bacteria 4287
75 Ga0070673_100039479 3300005364 Bacteria 3613
76 Ga0070673_100114494 3300005364 Bacteria 2241
77 Ga0070659_100002628 3300005366 Bacteria 12778
78 Ga0070659_100276291 3300005366 Bacteria 1397
79 Ga0070667_100000106 3300005367 Bacteria 106516
80 Ga0070667_100010153 3300005367 Bacteria 7786
81 Ga0070667_100014598 3300005367 Bacteria 6491
82 Ga0070713_100010826 3300005436 Bacteria 6610
83 Ga0070713_100134896 3300005436 Bacteria 2180
84 Ga0070710_10016878 3300005437 Bacteria 3726
85 Ga0070701_10054270 3300005438 Bacteria 2089
86 Ga0070705_100002258 3300005440 Bacteria 9756
87 Ga0070663_100016283 3300005455 Bacteria 4824
88 Ga0070663_100020564 3300005455 Bacteria 4371
89 Ga0070663_100178664 3300005455 Bacteria 1645
90 Ga0070678_100007469 3300005456 Bacteria 6488
91 Ga0070678_100047649 3300005456 Bacteria 3081
92 Ga0070678_100131068 3300005456 Bacteria 1992
93 Ga0070662_100009297 3300005457 Bacteria 6424
94 Ga0070662_100010863 3300005457 Bacteria 5996
95 Ga0070662_100011838 3300005457 Bacteria 5767
96 Ga0070662_100016370 3300005457 Bacteria 4977
97 Ga0070662_100039751 3300005457 Bacteria 3346
98 Ga0070662_100051656 3300005457 Bacteria 2969
99 Ga0070662_100058817 3300005457 Bacteria 2798
100 Ga0070662_100086952 3300005457 Bacteria 2339
101 Ga0070662_100091954 3300005457 Bacteria 2279
102 Ga0070662_100099363 3300005457 Bacteria 2199
103 Ga0070662_100176156 3300005457 Bacteria 1683
104 Ga0070662_100242281 3300005457 Bacteria 1447
105 Ga0070681_10186457 3300005458 Bacteria 1995
106 Ga0070681_10234716 3300005458 Bacteria 1748
107 Ga0068867_100038272 3300005459 Bacteria 3491
108 Ga0070685_10120290 3300005466 Bacteria 1630
109 Ga0070679_100042606 3300005530 Bacteria 4521
110 Ga0070684_100084908 3300005535 Bacteria 2807
111 Ga0070684_100276264 3300005535 Bacteria 1539
112 Ga0068853_100165091 3300005539 Bacteria 2001
113 Ga0070672_100002941 3300005543 Bacteria 10965
114 Ga0070672_100012862 3300005543 Bacteria 5896
115 Ga0070672_100016004 3300005543 Bacteria 5360
116 Ga0070672_100020844 3300005543 Bacteria 4787
117 Ga0070672_100024407 3300005543 Bacteria 4468
118 Ga0070672_100095935 3300005543 Bacteria 2399
119 Ga0070686_100001982 3300005544 Bacteria 11363
120 Ga0070686_100025720 3300005544 Bacteria 3544
121 Ga0070665_100000294 3300005548 Bacteria 78909
122 Ga0070664_100000558 3300005564 Bacteria 28520
123 Ga0070664_100005749 3300005564 Bacteria 10002
124 Ga0070664_100064312 3300005564 Bacteria 3129
125 Ga0070664_100082862 3300005564 Bacteria 2766
126 Ga0070664_100083601 3300005564 Bacteria 2754
127 Ga0070664_100154814 3300005564 Bacteria 2025
128 Ga0070664_100200865 3300005564 Bacteria 1779
129 Ga0070664_100500666 3300005564 Bacteria 1120
130 Ga0068857_100011361 3300005577 Bacteria 7746
131 Ga0068857_100208162 3300005577 Bacteria 1784
132 Ga0068854_100010732 3300005578 Bacteria 5945
133 Ga0068854_100025193 3300005578 Bacteria 4081
134 Ga0068856_100317584 3300005614 Bacteria 1575
135 Ga0068856_100378877 3300005614 Bacteria 1434
136 Ga0068852_100012269 3300005616 Bacteria 6497
137 Ga0068859_100313446 3300005617 Bacteria 1662
138 Ga0068864_100000065 3300005618 Bacteria 118170
139 Ga0068864_100000487 3300005618 Bacteria 34323
140 Ga0068864_100004640 3300005618 Bacteria 11267
141 Ga0068864_100010436 3300005618 Bacteria 7675
142 Ga0068864_100025311 3300005618 Bacteria 4997
143 Ga0068864_100068693 3300005618 Bacteria 3079
144 Ga0068864_100199075 3300005618 Bacteria 1839
145 Ga0068864_100343726 3300005618 Bacteria 1406
146 Ga0068866_10081486 3300005718 Bacteria 1738
147 Ga0068861_100429171 3300005719 Bacteria 1179
148 Ga0068851_10020008 3300005834 Bacteria 3237
149 Ga0068863_100000226 3300005841 Bacteria 59763
150 Ga0068863_100011300 3300005841 Bacteria 8647
151 Ga0068863_100013452 3300005841 Bacteria 7891
152 Ga0068863_100053573 3300005841 Bacteria 3824
153 Ga0068863_100390971 3300005841 Bacteria 1359
154 Ga0068858_100010061 3300005842 Bacteria 8980
155 Ga0068858_100439317 3300005842 Bacteria 1257
156 Ga0068860_100000191 3300005843 Bacteria 97369
157 Ga0068860_100020147 3300005843 Bacteria 6463
158 Ga0068860_100023182 3300005843 Bacteria 6001
159 Ga0068860_100076617 3300005843 Bacteria 3181
160 Ga0068860_100370068 3300005843 Bacteria 1413
161 Ga0068862_100000351 3300005844 Bacteria 49912
162 Ga0081540_1001103 3300005983 Bacteria 23924
163 Ga0081540_1002217 3300005983 Bacteria 16033
164 Ga0070712_100009973 3300006175 Bacteria 5987
165 Ga0070712_100112069 3300006175 Bacteria 2038
166 Ga0070712_100213507 3300006175 Bacteria 1523
167 Ga0097621_100013044 3300006237 Bacteria 6178
168 Ga0097621_100107302 3300006237 Bacteria 2356
169 Ga0068871_100052468 3300006358 Bacteria 3302
170 Ga0068871_100075801 3300006358 Bacteria 2777
171 Ga0068871_100238791 3300006358 Bacteria 1579
172 Ga0075428_100024288 3300006844 Bacteria 6705
173 Ga0068865_100020904 3300006881 Bacteria 4250
174 Ga0068865_100080157 3300006881 Bacteria 2340
175 Ga0068865_100083834 3300006881 Bacteria 2295
176 Ga0097620_100313439 3300006931 Bacteria 1662
177 Ga0105240_10001450 3300009093 Bacteria 40534
178 Ga0105240_10021752 3300009093 Bacteria 8523
179 Ga0105240_10273920 3300009093 Bacteria 1942
180 Ga0111539_10230394 3300009094 Bacteria 2157
181 Ga0111539_10239315 3300009094 Bacteria 2113
182 Ga0111539_10431339 3300009094 Bacteria 1535
183 Ga0105245_10026405 3300009098 Bacteria 5111
184 Ga0105245_10050563 3300009098 Bacteria 3726
185 Ga0105241_10004888 3300009174 Bacteria 9883
186 Ga0105241_10126078 3300009174 Bacteria 2067
187 Ga0105242_10068003 3300009176 Bacteria 2946
188 Ga0105248_10001528 3300009177 Bacteria 25762
189 Ga0105248_10002100 3300009177 Bacteria 22075
190 Ga0105248_10009072 3300009177 Bacteria 10937
191 Ga0105248_10010223 3300009177 Bacteria 10331
192 Ga0105248_10017754 3300009177 Bacteria 7849
193 Ga0105248_10060005 3300009177 Bacteria 4271
194 Ga0105248_10102106 3300009177 Bacteria 3233
195 Ga0105248_10216217 3300009177 Bacteria 2158
196 Ga0105248_10264893 3300009177 Bacteria 1935
197 Ga0105238_10058255 3300009551 Bacteria 3872
198 Ga0105249_10000765 3300009553 Bacteria 28895
199 Ga0105249_10000982 3300009553 Bacteria 25267
200 Ga0105239_10025535 3300010375 Bacteria 6504
201 Ga0105239_10289122 3300010375 Bacteria 1846
202 Ga0157373_10031648 3300013100 Bacteria 3807
203 Ga0157371_10000585 3300013102 Bacteria 43238
204 Ga0157371_10131138 3300013102 Bacteria 1783
205 Ga0157378_10001666 3300013297 Bacteria 20065
206 Ga0157378_10092217 3300013297 Bacteria 2756
207 Ga0157378_10267822 3300013297 Bacteria 1642
208 Ga0163162_10000590 3300013306 Bacteria 33723
209 Ga0163162_10011425 3300013306 Bacteria 8658
210 Ga0163162_10129598 3300013306 Bacteria 2631
211 Ga0157375_10007360 3300013308 Bacteria 9638
212 Ga0157375_10007958 3300013308 Bacteria 9280
213 Ga0157375_10139321 3300013308 Bacteria 2552
214 Ga0157375_10327805 3300013308 Bacteria 1696
215 Ga0163163_10120025 3300014325 Bacteria 2662
216 Ga0163163_10122468 3300014325 Bacteria 2635
217 Ga0157380_10005457 3300014326 Bacteria 8885
218 Ga0157380_10015277 3300014326 Bacteria 5640
219 Ga0157380_10035011 3300014326 Bacteria 3876
220 Ga0157380_10059072 3300014326 Bacteria 3059
221 Ga0157380_10183039 3300014326 Bacteria 1842
222 Ga0157380_10245189 3300014326 Bacteria 1618
223 Ga0157377_10000555 3300014745 Bacteria 15690
224 Ga0157379_10063427 3300014968 Bacteria 3304
225 Ga0157376_10000627 3300014969 Bacteria 22898
226 Ga0157376_10060483 3300014969 Bacteria 3181
227 Ga0163161_10002499 3300017792 Bacteria 13116
228 Ga0163161_10052637 3300017792 Bacteria 2951
229 Ga0163161_10063782 3300017792 Bacteria 2686
230 Ga0163161_10086768 3300017792 Bacteria 2310
231 Ga0163161_10088747 3300017792 Bacteria 2285
232 Ga0209565_1000429 3300025263 Bacteria 33769
233 Ga0209673_1000895 3300025273 Bacteria 38370
234 Ga0209564_1021950 3300025295 Bacteria 2273
235 Ga0209758_1012668 3300025297 Bacteria 4690
236 Ga0209256_1001309 3300025299 Bacteria 26742
237 Ga0209256_1003185 3300025299 Bacteria 11885
238 Ga0207697_10008313 3300025315 Bacteria 4552
239 Ga0207682_10000111 3300025893 Bacteria 37550
240 Ga0207682_10000662 3300025893 Bacteria 16097
241 Ga0207682_10063210 3300025893 Bacteria 1553
242 Ga0207682_10102251 3300025893 Bacteria 1254
243 Ga0207692_10071259 3300025898 Bacteria 1832
244 Ga0207710_10004942 3300025900 Bacteria 5777
245 Ga0207688_10000076 3300025901 Bacteria 37517
246 Ga0207688_10104369 3300025901 Bacteria 1640
247 Ga0207680_10007728 3300025903 Bacteria 5254
248 Ga0207680_10048496 3300025903 Bacteria 2523
249 Ga0207680_10083609 3300025903 Bacteria 2012
250 Ga0207680_10111604 3300025903 Bacteria 1774
251 Ga0207647_10008421 3300025904 Bacteria 7397
252 Ga0207645_10000016 3300025907 Bacteria 114058
253 Ga0207645_10026740 3300025907 Bacteria 3728
254 Ga0207643_10000010 3300025908 Bacteria 159218
255 Ga0207643_10245719 3300025908 Bacteria 1101
256 Ga0207705_10008872 3300025909 Bacteria 7327
257 Ga0207705_10023151 3300025909 Bacteria 4431
258 Ga0207695_10275582 3300025913 Bacteria 1577
259 Ga0207693_10033175 3300025915 Bacteria 4075
260 Ga0207693_10327561 3300025915 Bacteria 1199
261 Ga0207660_10066237 3300025917 Bacteria 2612
262 Ga0207662_10000014 3300025918 Bacteria 85091
263 Ga0207657_10000060 3300025919 Bacteria 101953
264 Ga0207657_10012932 3300025919 Bacteria 8207
265 Ga0207657_10062553 3300025919 Bacteria 3186
266 Ga0207657_10242271 3300025919 Bacteria 1439
267 Ga0207649_10001207 3300025920 Bacteria 15583
268 Ga0207649_10006237 3300025920 Bacteria 6477
269 Ga0207649_10014785 3300025920 Bacteria 4377
270 Ga0207649_10018547 3300025920 Bacteria 3960
271 Ga0207649_10032483 3300025920 Bacteria 3112
272 Ga0207649_10139753 3300025920 Bacteria 1655
273 Ga0207649_10206749 3300025920 Bacteria 1390
274 Ga0207649_10230736 3300025920 Bacteria 1323
275 Ga0207681_10002071 3300025923 Bacteria 12845
276 Ga0207681_10044015 3300025923 Bacteria 2990
277 Ga0207681_10345386 3300025923 Bacteria 1190
278 Ga0207681_10373089 3300025923 Bacteria 1147
279 Ga0207650_10000032 3300025925 Bacteria 229538
280 Ga0207650_10003050 3300025925 Bacteria 11536
281 Ga0207650_10003575 3300025925 Bacteria 10660
282 Ga0207650_10005549 3300025925 Bacteria 8611
283 Ga0207650_10025063 3300025925 Bacteria 4247
284 Ga0207650_10046824 3300025925 Bacteria 3185
285 Ga0207650_10062493 3300025925 Bacteria 2782
286 Ga0207650_10070085 3300025925 Bacteria 2635
287 Ga0207650_10318172 3300025925 Bacteria 1274
288 Ga0207659_10003360 3300025926 Bacteria 9599
289 Ga0207659_10009623 3300025926 Bacteria 6045
290 Ga0207659_10030155 3300025926 Bacteria 3703
291 Ga0207659_10068366 3300025926 Bacteria 2583
292 Ga0207687_10227762 3300025927 Bacteria 1471
293 Ga0207700_10085153 3300025928 Bacteria 2480
294 Ga0207664_10023845 3300025929 Bacteria 4591
295 Ga0207644_10000652 3300025931 Bacteria 21952
296 Ga0207644_10001325 3300025931 Bacteria 15899
297 Ga0207644_10006562 3300025931 Bacteria 7579
298 Ga0207644_10014305 3300025931 Bacteria 5309
299 Ga0207644_10017574 3300025931 Bacteria 4834
300 Ga0207644_10018466 3300025931 Bacteria 4718
301 Ga0207644_10031962 3300025931 Bacteria 3670
302 Ga0207644_10048636 3300025931 Bacteria 3033
303 Ga0207644_10052433 3300025931 Bacteria 2931
304 Ga0207644_10054428 3300025931 Bacteria 2882
305 Ga0207644_10057431 3300025931 Bacteria 2810
306 Ga0207644_10070036 3300025931 Bacteria 2562
307 Ga0207644_10160304 3300025931 Bacteria 1748
308 Ga0207644_10292657 3300025931 Bacteria 1310
309 Ga0207690_10035242 3300025932 Bacteria 3231
310 Ga0207690_10092728 3300025932 Bacteria 2138
311 Ga0207690_10136473 3300025932 Bacteria 1802
312 Ga0207706_10000132 3300025933 Bacteria 81128
313 Ga0207706_10006242 3300025933 Bacteria 11077
314 Ga0207706_10011039 3300025933 Bacteria 8232
315 Ga0207706_10023001 3300025933 Bacteria 5596
316 Ga0207706_10027737 3300025933 Bacteria 5062
317 Ga0207706_10029078 3300025933 Bacteria 4935
318 Ga0207706_10059993 3300025933 Bacteria 3350
319 Ga0207706_10124348 3300025933 Bacteria 2269
320 Ga0207706_10276120 3300025933 Bacteria 1466
321 Ga0207709_10005096 3300025935 Bacteria 7499
322 Ga0207670_10031047 3300025936 Bacteria 3418
323 Ga0207669_10018286 3300025937 Bacteria 3619
324 Ga0207669_10022376 3300025937 Bacteria 3357
325 Ga0207669_10136055 3300025937 Bacteria 1697
326 Ga0207669_10183439 3300025937 Bacteria 1503
327 Ga0207704_10037238 3300025938 Bacteria 2809
328 Ga0207704_10219408 3300025938 Bacteria 1406
329 Ga0207691_10000011 3300025940 Bacteria 147984
330 Ga0207691_10004037 3300025940 Bacteria 14227
331 Ga0207691_10009106 3300025940 Bacteria 9528
332 Ga0207691_10018251 3300025940 Bacteria 6646
333 Ga0207691_10063321 3300025940 Bacteria 3354
334 Ga0207691_10077666 3300025940 Bacteria 2990
335 Ga0207691_10109835 3300025940 Bacteria 2453
336 Ga0207691_10185542 3300025940 Bacteria 1816
337 Ga0207711_10000345 3300025941 Bacteria 49338
338 Ga0207711_10005958 3300025941 Bacteria 10303
339 Ga0207711_10009303 3300025941 Bacteria 8203
340 Ga0207711_10012804 3300025941 Bacteria 6967
341 Ga0207711_10035389 3300025941 Bacteria 4232
342 Ga0207711_10070869 3300025941 Bacteria 3023
343 Ga0207711_10108521 3300025941 Bacteria 2466
344 Ga0207689_10000011 3300025942 Bacteria 123627
345 Ga0207661_10124671 3300025944 Bacteria 2198
346 Ga0207679_10000250 3300025945 Bacteria 40949
347 Ga0207679_10023018 3300025945 Bacteria 4252
348 Ga0207679_10042792 3300025945 Bacteria 3257
349 Ga0207679_10092253 3300025945 Bacteria 2346
350 Ga0207679_10215982 3300025945 Bacteria 1611
351 Ga0207679_10446966 3300025945 Bacteria 1146
352 Ga0207651_10001464 3300025960 Bacteria 10735
353 Ga0207651_10037502 3300025960 Bacteria 3176
354 Ga0207651_10146454 3300025960 Bacteria 1832
355 Ga0207651_10202003 3300025960 Bacteria 1593
356 Ga0207651_10333455 3300025960 Bacteria 1272
357 Ga0207712_10000795 3300025961 Bacteria 23347
358 Ga0207668_10001250 3300025972 Bacteria 15150
359 Ga0207640_10008148 3300025981 Bacteria 5805
360 Ga0207640_10079255 3300025981 Bacteria 2238
361 Ga0207658_10000473 3300025986 Bacteria 37262
362 Ga0207658_10010621 3300025986 Bacteria 6257
363 Ga0207658_10060602 3300025986 Bacteria 2824
364 Ga0207658_10157177 3300025986 Bacteria 1859
365 Ga0207677_10000219 3300026023 Bacteria 45702
366 Ga0207677_10031297 3300026023 Bacteria 3407
367 Ga0207677_10056105 3300026023 Bacteria 2697
368 Ga0207703_10000434 3300026035 Bacteria 43951
369 Ga0207703_10000524 3300026035 Bacteria 39370
370 Ga0207703_10017170 3300026035 Bacteria 5646
371 Ga0207703_10259400 3300026035 Bacteria 1570
372 Ga0207703_10413942 3300026035 Bacteria 1253
373 Ga0207639_10149166 3300026041 Bacteria 1957
374 Ga0207678_10002515 3300026067 Bacteria 16696
375 Ga0207678_10029231 3300026067 Bacteria 4809
376 Ga0207678_10260109 3300026067 Bacteria 1487
377 Ga0207708_10330195 3300026075 Bacteria 1247
378 Ga0207641_10002207 3300026088 Bacteria 18322
379 Ga0207641_10007924 3300026088 Bacteria 8809
380 Ga0207641_10018158 3300026088 Bacteria 5764
381 Ga0207641_10079950 3300026088 Bacteria 2835
382 Ga0207648_10000258 3300026089 Bacteria 57424
383 Ga0207648_10004248 3300026089 Bacteria 14795
384 Ga0207648_10026314 3300026089 Bacteria 5172
385 Ga0207648_10313431 3300026089 Bacteria 1409
386 Ga0207676_10001189 3300026095 Bacteria 19527
387 Ga0207676_10005392 3300026095 Bacteria 9052
388 Ga0207676_10007059 3300026095 Bacteria 7959
389 Ga0207676_10020930 3300026095 Bacteria 4793
390 Ga0207676_10037419 3300026095 Bacteria 3698
391 Ga0207676_10108198 3300026095 Bacteria 2320
392 Ga0207676_10161850 3300026095 Bacteria 1940
393 Ga0207674_10001589 3300026116 Bacteria 29230
394 Ga0207674_10006098 3300026116 Bacteria 14248
395 Ga0207674_10141597 3300026116 Bacteria 2364
396 Ga0207675_100000164 3300026118 Bacteria 58951
397 Ga0207675_100499586 3300026118 Bacteria 1211
398 Ga0207683_10000080 3300026121 Bacteria 76652
399 Ga0207683_10002371 3300026121 Bacteria 16461
400 Ga0207683_10008588 3300026121 Bacteria 8743
401 Ga0207683_10074002 3300026121 Bacteria 3014
402 Ga0207683_10100350 3300026121 Bacteria 2584
403 Ga0207683_10233435 3300026121 Bacteria 1678
404 Ga0207698_10267424 3300026142 Bacteria 1574
405 Ga0268266_10006858 3300028379 Bacteria 10368
406 Ga0268266_10022945 3300028379 Bacteria 5310
407 Ga0268265_10001169 3300028380 Bacteria 22998
408 Ga0268265_10001945 3300028380 Bacteria 16405
409 Ga0268265_10088422 3300028380 Bacteria 2468
410 Ga0268264_10000266 3300028381 Bacteria 92216
411 Ga0268264_10001259 3300028381 Bacteria 24103
412 Ga0268264_10070330 3300028381 Bacteria 2963
413 Ga0307405_10301344 3300031731 Bacteria 1216
414 Ga0307410_10000425 3300031852 Bacteria 16799
415 Ga0307410_10023180 3300031852 Bacteria 3854
416 Ga0307410_10139843 3300031852 Bacteria 1790
417 Ga0307410_10153613 3300031852 Bacteria 1716
418 Ga0307410_10349586 3300031852 Bacteria 1181
419 Ga0307406_10098487 3300031901 Bacteria 1985
420 Ga0307406_10424455 3300031901 Bacteria 1060
421 Ga0307407_10233713 3300031903 Bacteria 1250
422 Ga0307409_100021116 3300031995 Bacteria 4457
423 Ga0307409_100051178 3300031995 Bacteria 3159
424 Ga0307409_100095503 3300031995 Bacteria 2449
425 Ga0307416_100033284 3300032002 Bacteria 3905
426 Ga0307416_100038095 3300032002 Bacteria 3706
427 Ga0307416_100074064 3300032002 Bacteria 2843
428 Ga0307416_100147399 3300032002 Bacteria 2152
429 Ga0307414_10004523 3300032004 Bacteria 7565
430 Ga0307414_10023815 3300032004 Bacteria 3891
431 Ga0307414_10172241 3300032004 Bacteria 1732
432 Ga0307414_10339400 3300032004 Bacteria 1285
433 Ga0307414_10437709 3300032004 Bacteria 1144
434 Ga0307411_10001130 3300032005 Bacteria 10431
435 Ga0307411_10029154 3300032005 Bacteria 3366
436 Ga0307411_10114470 3300032005 Bacteria 1938
437 Ga0307411_10220984 3300032005 Bacteria 1470
438 Ga0373943_0001816 3300035170 Bacteria 9653
439 Ga0373931_0112614 3300035691 Bacteria 1546
440 Ga0373937_0021650 3300036401 Bacteria 5770
441 Ga0373937_0400066 3300036401 Bacteria 1303
442 Ga0373925_0010421 3300037068 Bacteria 6745
443 Ga0373925_0122722 3300037068 Bacteria 2018
444 Ga0395899_0011101 3300037312 Bacteria 6899
445 Ga0395899_0069849 3300037312 Bacteria 2571
446 Ga0395900_0054480 3300037418 Bacteria 4118
447 Ga0395898_0013078 3300037466 Bacteria 8556
448 Ga0395898_0182456 3300037466 Bacteria 2006
449 Ga0395905_0001203 3300037471 Bacteria 32348
450 Ga0395905_0079273 3300037471 Bacteria 3078
451 Ga0395905_0112163 3300037471 Bacteria 2561
452 Ga0395905_0165738 3300037471 Bacteria 2076
453 Ga0395901_0208881 3300038443 Bacteria 2044
454 Ga0436363_0864307 3300039450 Bacteria 1556
455 Ga0439465_0077687 3300041413 Bacteria 1121
456 Ga0439448_0001486 3300042005 Bacteria 6097
457 Ga0450904_000904 3300042139 Bacteria 4811
458 Ga0466964_0135032 3300044706 Bacteria 1128
459 Ga0495605_0021870 3300046474 Bacteria 3382
460 Ga0495639_0075590 3300046475 Bacteria 1562
461 Ga0495584_0000001 3300046491 Bacteria 649329
462 Ga0495584_0037459 3300046491 Bacteria 2451
463 Ga0495585_0000822 3300046492 Bacteria 26833
464 Ga0495585_0005245 3300046492 Bacteria 8208
465 Ga0495594_0000106 3300046499 Bacteria 39102
466 Ga0495594_0003633 3300046499 Bacteria 7932
467 Ga0495610_0034485 3300046512 Bacteria 2606
468 Ga0495610_0115919 3300046512 Bacteria 1181
469 Ga0495616_0031881 3300046513 Bacteria 2757
470 Ga0495620_0071687 3300046515 Bacteria 1416
471 Ga0495631_0000822 3300046518 Bacteria 19836
472 Ga0495631_0014171 3300046518 Bacteria 3852
473 Ga0495632_0000259 3300046519 Bacteria 52636
474 Ga0495637_0002410 3300046520 Bacteria 10342
475 Ga0495642_0010782 3300046528 Bacteria 3502
476 Ga0495642_0013299 3300046528 Bacteria 3181
477 Ga0495621_0002100 3300046539 Bacteria 5281
478 Ga0495597_0041329 3300046542 Bacteria 2060
479 Ga0495597_0113386 3300046542 Bacteria 1135
480 Ga0495633_0003965 3300046558 Bacteria 9617
481 Ga0495633_0009662 3300046558 Bacteria 5308
482 Ga0495668_0038244 3300046616 Bacteria 2682
483 Ga0495661_0000721 3300046665 Bacteria 32506
484 Ga0495661_0007342 3300046665 Bacteria 7679
485 Ga0495661_0009304 3300046665 Bacteria 6744
486 Ga0495588_0002703 3300046674 Bacteria 7595
487 Ga0495588_0036521 3300046674 Bacteria 2493
488 Ga0495647_0060154 3300046681 Bacteria 1497
489 Ga0495658_0023119 3300046683 Bacteria 3297
490 Ga0495669_0001409 3300046684 Bacteria 9893
491 Ga0495669_0007425 3300046684 Bacteria 4597
492 Ga0495669_0024398 3300046684 Bacteria 2634
493 Ga0495669_0061416 3300046684 Bacteria 1700
494 Ga0495670_0000118 3300046691 Bacteria 34643
495 Ga0495670_0006064 3300046691 Bacteria 5925
496 Ga0495670_0120943 3300046691 Bacteria 1360
497 Ga0495660_0039423 3300046810 Bacteria 2623
498 Ga0495636_0010746 3300047318 Bacteria 3619
499 Ga0495672_0000656 3300047320 Bacteria 38441
500 Ga0495683_0009631 3300047323 Bacteria 5143
501 Ga0495681_0000492 3300047470 Bacteria 30331
502 Ga0495681_0044824 3300047470 Bacteria 2122
503 Ga0495626_0011207 3300048091 Bacteria 4749
504 Ga0496100_0009086 3300048903 Bacteria 5572
505 Ga0496101_0003840 3300048904 Bacteria 9392
506 Ga0496101_0024562 3300048904 Bacteria 4171
507 Ga0496101_0086014 3300048904 Bacteria 2331
508 Ga0496101_0087878 3300048904 Bacteria 2308
509 Ga0496101_0135536 3300048904 Bacteria 1873
510 Ga0496102_0006567 3300048905 Bacteria 9932
511 Ga0496102_0084553 3300048905 Bacteria 2929
512 Ga0496104_0030451 3300048907 Bacteria 5015
513 Ga0496104_0179144 3300048907 Bacteria 2030
514 Ga0496104_0207376 3300048907 Bacteria 1872
515 Ga0496106_0001460 3300048909 Bacteria 17764
516 Ga0496106_0002280 3300048909 Bacteria 14313
517 Ga0496106_0019355 3300048909 Bacteria 5048
518 Ga0496106_0246509 3300048909 Bacteria 1428
519 Ga0496107_0000848 3300048910 Bacteria 17901
520 Ga0496107_0008863 3300048910 Bacteria 6971
521 Ga0496107_0016472 3300048910 Bacteria 5192
522 Ga0496107_0045793 3300048910 Bacteria 3147
523 Ga0496107_0053489 3300048910 Bacteria 2913
524 Ga0496107_0429236 3300048910 Bacteria 982
525 Ga0496108_0180403 3300048911 Bacteria 1828
526 Ga0496109_0001761 3300048912 Bacteria 17994
527 Ga0496109_0012908 3300048912 Bacteria 7223
528 Ga0496109_0060351 3300048912 Bacteria 3465
529 Ga0496109_0072010 3300048912 Bacteria 3174
530 Ga0496109_0072933 3300048912 Bacteria 3154
531 Ga0496109_0130791 3300048912 Bacteria 2342
532 Ga0496109_0135357 3300048912 Bacteria 2302
533 Ga0496109_0173580 3300048912 Bacteria 2023
534 Ga0496110_0005414 3300048913 Bacteria 10012
535 Ga0496110_0009390 3300048913 Bacteria 7919
536 Ga0496110_0012297 3300048913 Bacteria 7036
537 Ga0496110_0041259 3300048913 Bacteria 4026
538 Ga0496111_0000782 3300048914 Bacteria 16994
539 Ga0496111_0004951 3300048914 Bacteria 8465
540 Ga0496111_0008972 3300048914 Bacteria 6652
541 Ga0496111_0033780 3300048914 Bacteria 3649
542 Ga0496112_0011111 3300048915 Bacteria 8206
543 Ga0496112_0016757 3300048915 Bacteria 6872
544 Ga0496112_0069327 3300048915 Bacteria 3483
545 Ga0496112_0071039 3300048915 Bacteria 3440
546 Ga0496112_0286829 3300048915 Bacteria 1592
547 Ga0496112_0465808 3300048915 Bacteria 1201
548 Ga0496113_0010228 3300048916 Bacteria 6194
549 Ga0496113_0055823 3300048916 Bacteria 2962
550 Ga0496113_0118539 3300048916 Bacteria 2067
551 Ga0496113_0156730 3300048916 Bacteria 1799
552 Ga0496113_0171471 3300048916 Bacteria 1718
553 Ga0496114_0006322 3300048917 Bacteria 9322
554 Ga0496114_0071835 3300048917 Bacteria 2909
555 Ga0496114_0089144 3300048917 Bacteria 2618
556 Ga0496115_0000750 3300048918 Bacteria 23896
557 Ga0496115_0005663 3300048918 Bacteria 9089
558 Ga0496119_0028366 3300048922 Bacteria 3821
559 Ga0496121_0002470 3300048924 Bacteria 28202
560 Ga0495678_000620 3300049459 Bacteria 33056
561 Ga0501032_0062454 3300049569 Bacteria 2496
562 Ga0501037_0020911 3300049573 Bacteria 4832
563 Ga0501038_0045412 3300049574 Bacteria 3814
564 Ga0501039_0003903 3300049575 Bacteria 11198
565 Ga0501041_0013312 3300049577 Bacteria 4875
566 Ga0501042_0010695 3300049578 Bacteria 6166
567 Ga0501048_0022984 3300049582 Bacteria 4557
568 Ga0501071_0063950 3300049587 Bacteria 2669
569 Ga0501071_0225021 3300049587 Bacteria 1413
570 Ga0501077_0049553 3300049593 Bacteria 2669
571 Ga0501079_0047416 3300049741 Bacteria 3315
572 Ga0501079_0090451 3300049741 Bacteria 2371
573 Ga0501035_0037013 3300049822 Bacteria 4420
574 Ga0501044_0057398 3300049823 Bacteria 3995
575 Ga0501045_0074608 3300049824 Bacteria 2498
576 nmdc:mga09592_20168_c1 3300050508 Bacteria 5478
577 Ga0500647_0013311 3300053091 Bacteria 3719
578 Ga0500555_012929 3300053103 Bacteria 2404
579 Ga0500556_0000870 3300053104 Bacteria 17074
580 Ga0500645_001019 3300053730 Bacteria 15706
581 Ga0530510_0108524 3300061734 Bacteria 2032

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100134896 Ga0070713_1001348962 271
2 3300025928 Ga0207700_10085153 Ga0207700_100851532 276
3 3300037466 Ga0395898_0013078 Ga0395898_0013078_1652_2617 278
4 3300037471 Ga0395905_0079273 Ga0395905_0079273_1393_2358 278
5 3300038443 Ga0395901_0208881 Ga0395901_0208881_627_1592 278
6 3300053091 Ga0500647_0013311 Ga0500647_0013311_2512_3495 278
7 3300006175 Ga0070712_100112069 Ga0070712_1001120691 280
8 3300048910 Ga0496107_0429236 Ga0496107_0429236_125_967 280
9 3300048916 Ga0496113_0171471 Ga0496113_0171471_752_1594 280
10 3300025908 Ga0207643_10245719 Ga0207643_102457192 284
11 3300005614 Ga0068856_100317584 Ga0068856_1003175841 289
12 3300025915 Ga0207693_10327561 Ga0207693_103275611 289
13 3300032004 Ga0307414_10437709 Ga0307414_104377092 289
14 3300048909 Ga0496106_0246509 Ga0496106_0246509_383_1342 291
15 3300005331 Ga0070670_100163025 Ga0070670_1001630252 292
16 3300005335 Ga0070666_10003297 Ga0070666_100032975 292
17 3300005338 Ga0068868_100141245 Ga0068868_1001412453 292
18 3300005355 Ga0070671_100016988 Ga0070671_1000169882 292
19 3300005364 Ga0070673_100026432 Ga0070673_1000264322 292
20 3300005367 Ga0070667_100014598 Ga0070667_1000145984 292
21 3300005457 Ga0070662_100011838 Ga0070662_1000118382 292
22 3300005466 Ga0070685_10120290 Ga0070685_101202902 292
23 3300005543 Ga0070672_100002941 Ga0070672_1000029413 292
24 3300005564 Ga0070664_100500666 Ga0070664_1005006662 292
25 3300005618 Ga0068864_100010436 Ga0068864_1000104362 292
26 3300005841 Ga0068863_100013452 Ga0068863_1000134524 292
27 3300005842 Ga0068858_100439317 Ga0068858_1004393171 292
28 3300006237 Ga0097621_100013044 Ga0097621_1000130443 292
29 3300006358 Ga0068871_100075801 Ga0068871_1000758012 292
30 3300006881 Ga0068865_100083834 Ga0068865_1000838342 292
31 3300009177 Ga0105248_10017754 Ga0105248_100177543 292
32 3300013297 Ga0157378_10267822 Ga0157378_102678222 292
33 3300013306 Ga0163162_10011425 Ga0163162_100114255 292
34 3300013308 Ga0157375_10007360 Ga0157375_100073605 292
35 3300014325 Ga0163163_10120025 Ga0163163_101200253 292
36 3300025903 Ga0207680_10048496 Ga0207680_100484962 292
37 3300025920 Ga0207649_10230736 Ga0207649_102307362 292
38 3300025925 Ga0207650_10062493 Ga0207650_100624932 292
39 3300025926 Ga0207659_10068366 Ga0207659_100683662 292
40 3300025931 Ga0207644_10000652 Ga0207644_1000065210 292
41 3300025938 Ga0207704_10037238 Ga0207704_100372382 292
42 3300025940 Ga0207691_10018251 Ga0207691_100182514 292
43 3300025941 Ga0207711_10009303 Ga0207711_100093035 292
44 3300025945 Ga0207679_10446966 Ga0207679_104469661 292
45 3300025960 Ga0207651_10202003 Ga0207651_102020032 292
46 3300025986 Ga0207658_10060602 Ga0207658_100606022 292
47 3300026035 Ga0207703_10413942 Ga0207703_104139422 292
48 3300026095 Ga0207676_10005392 Ga0207676_100053922 292
49 3300028381 Ga0268264_10070330 Ga0268264_100703302 292
50 3300036401 Ga0373937_0400066 Ga0373937_0400066_141_1106 292
51 3300046681 Ga0495647_0060154 Ga0495647_0060154_505_1476 292
52 3300048904 Ga0496101_0086014 Ga0496101_0086014_104_1075 292
53 3300048912 Ga0496109_0060351 Ga0496109_0060351_198_1169 292
54 3300048916 Ga0496113_0118539 Ga0496113_0118539_31_1002 292
55 3300046518 Ga0495631_0014171 Ga0495631_0014171_1551_2492 293
56 3300046519 Ga0495632_0000259 Ga0495632_0000259_30727_31662 293
57 3300046616 Ga0495668_0038244 Ga0495668_0038244_495_1436 293
58 3300046665 Ga0495661_0009304 Ga0495661_0009304_3182_4123 293
59 3300046810 Ga0495660_0039423 Ga0495660_0039423_410_1345 293
60 3300049459 Ga0495678_000620 Ga0495678_000620_30727_31662 293
61 3300025893 Ga0207682_10102251 Ga0207682_101022512 294
62 3300046528 Ga0495642_0013299 Ga0495642_0013299_2103_3038 294
63 3300041413 Ga0439465_0077687 Ga0439465_0077687_104_1060 295
64 3300042139 Ga0450904_000904 Ga0450904_000904_1563_2498 295
65 3300044706 Ga0466964_0135032 Ga0466964_0135032_31_966 295
66 3300046474 Ga0495605_0021870 Ga0495605_0021870_1870_2805 295
67 3300046520 Ga0495637_0002410 Ga0495637_0002410_958_1944 295
68 3300048091 Ga0495626_0011207 Ga0495626_0011207_1830_2765 295
69 3300048909 Ga0496106_0002280 Ga0496106_0002280_11329_12321 295
70 3300048910 Ga0496107_0000848 Ga0496107_0000848_472_1464 295
71 3300048924 Ga0496121_0002470 Ga0496121_0002470_6056_7048 295
72 3300053104 Ga0500556_0000870 Ga0500556_0000870_12191_13177 295
73 3300053730 Ga0500645_001019 Ga0500645_001019_10979_11965 295
74 3300005457 Ga0070662_100009297 Ga0070662_1000092974 296
75 3300005458 Ga0070681_10234716 Ga0070681_102347162 296
76 3300025933 Ga0207706_10023001 Ga0207706_100230014 296
77 3300006175 Ga0070712_100213507 Ga0070712_1002135072 298
78 3300031901 Ga0307406_10098487 Ga0307406_100984872 298
79 3300031903 Ga0307407_10233713 Ga0307407_102337132 298
80 3300031995 Ga0307409_100051178 Ga0307409_1000511782 298
81 3300032002 Ga0307416_100033284 Ga0307416_1000332841 298
82 3300032004 Ga0307414_10023815 Ga0307414_100238152 298
83 3300013308 Ga0157375_10139321 Ga0157375_101393212 299
84 3300048922 Ga0496119_0028366 Ga0496119_0028366_2890_3798 299
85 3300005331 Ga0070670_100000038 Ga0070670_10000003830 300
86 3300005335 Ga0070666_10013709 Ga0070666_100137094 300
87 3300005347 Ga0070668_100000224 Ga0070668_10000022420 300
88 3300005367 Ga0070667_100000106 Ga0070667_10000010678 300
89 3300005548 Ga0070665_100000294 Ga0070665_10000029440 300
90 3300005618 Ga0068864_100000065 Ga0068864_10000006522 300
91 3300005841 Ga0068863_100000226 Ga0068863_10000022630 300
92 3300005842 Ga0068858_100010061 Ga0068858_1000100616 300
93 3300005843 Ga0068860_100000191 Ga0068860_10000019130 300
94 3300005844 Ga0068862_100000351 Ga0068862_10000035130 300
95 3300009553 Ga0105249_10000982 Ga0105249_100009826 300
96 3300025903 Ga0207680_10007728 Ga0207680_100077282 300
97 3300025920 Ga0207649_10006237 Ga0207649_100062372 300
98 3300025925 Ga0207650_10000032 Ga0207650_10000032136 300
99 3300025931 Ga0207644_10054428 Ga0207644_100544282 300
100 3300025972 Ga0207668_10001250 Ga0207668_100012505 300
101 3300025986 Ga0207658_10000473 Ga0207658_1000047330 300
102 3300026023 Ga0207677_10056105 Ga0207677_100561052 300
103 3300026035 Ga0207703_10000524 Ga0207703_1000052427 300
104 3300026088 Ga0207641_10002207 Ga0207641_1000220716 300
105 3300026089 Ga0207648_10313431 Ga0207648_103134312 300
106 3300026095 Ga0207676_10001189 Ga0207676_1000118917 300
107 3300028379 Ga0268266_10006858 Ga0268266_100068584 300
108 3300028380 Ga0268265_10001945 Ga0268265_1000194515 300
109 3300028381 Ga0268264_10000266 Ga0268264_1000026671 300
110 3300005438 Ga0070701_10054270 Ga0070701_100542703 301
111 3300005543 Ga0070672_100016004 Ga0070672_1000160042 301
112 3300036401 Ga0373937_0021650 Ga0373937_0021650_1292_2230 303
113 3300037068 Ga0373925_0122722 Ga0373925_0122722_36_974 303
114 3300046491 Ga0495584_0037459 Ga0495584_0037459_854_1792 303
115 3300046492 Ga0495585_0000822 Ga0495585_0000822_10216_11154 303
116 3300046512 Ga0495610_0115919 Ga0495610_0115919_149_1087 303
117 3300046513 Ga0495616_0031881 Ga0495616_0031881_684_1622 303
118 3300046518 Ga0495631_0000822 Ga0495631_0000822_9866_10804 303
119 3300046558 Ga0495633_0003965 Ga0495633_0003965_1275_2213 303
120 3300046665 Ga0495661_0000721 Ga0495661_0000721_9980_10918 303
121 3300046683 Ga0495658_0023119 Ga0495658_0023119_1278_2216 303
122 3300046691 Ga0495670_0000118 Ga0495670_0000118_10125_11063 303
123 3300047323 Ga0495683_0009631 Ga0495683_0009631_1450_2388 303
124 3300047470 Ga0495681_0000492 Ga0495681_0000492_10469_11407 303
125 3300050508 nmdc:mga09592_20168_c1 nmdc:mga09592_20168_c1_2926_3867 303
126 3300026075 Ga0207708_10330195 Ga0207708_103301952 305
127 3300005329 Ga0070683_100124783 Ga0070683_1001247832 306
128 3300005535 Ga0070684_100276264 Ga0070684_1002762642 306
129 3300025944 Ga0207661_10124671 Ga0207661_101246712 306
130 3300053103 Ga0500555_012929 Ga0500555_012929_537_1496 307
131 3300003215 JGI25153J46596_10023647 JGI25153J46596_100236472 310
132 3300003773 Ga0055537_1001075 Ga0055537_10010756 310
133 3300003775 Ga0055524_1003687 Ga0055524_10036872 310
134 3300003790 Ga0055528_1002814 Ga0055528_10028142 310
135 3300025263 Ga0209565_1000429 Ga0209565_100042911 310
136 3300025273 Ga0209673_1000895 Ga0209673_100089513 310
137 3300025295 Ga0209564_1021950 Ga0209564_10219502 310
138 3300025297 Ga0209758_1012668 Ga0209758_10126682 310
139 3300025299 Ga0209256_1001309 Ga0209256_10013093 310
140 3300025299 Ga0209256_1003185 Ga0209256_10031856 310
141 3300031852 Ga0307410_10139843 Ga0307410_101398431 310
142 3300046512 Ga0495610_0034485 Ga0495610_0034485_1008_1994 310
143 3300048918 Ga0496115_0005663 Ga0496115_0005663_7235_8218 310
144 iso_pu_bacteria 2643221545 2643746968 310
145 iso_pu_bacteria 2643221663 2644351941 310
146 iso_pu_bacteria 2643221691 2644507825 310
147 3300005841 Ga0068863_100390971 Ga0068863_1003909712 311
148 3300046528 Ga0495642_0010782 Ga0495642_0010782_1399_2334 311
149 3300049569 Ga0501032_0062454 Ga0501032_0062454_1283_2251 311
150 3300049573 Ga0501037_0020911 Ga0501037_0020911_3424_4392 311
151 3300049574 Ga0501038_0045412 Ga0501038_0045412_1639_2607 311
152 3300049575 Ga0501039_0003903 Ga0501039_0003903_1363_2331 311
153 3300049577 Ga0501041_0013312 Ga0501041_0013312_2118_3086 311
154 3300049578 Ga0501042_0010695 Ga0501042_0010695_1433_2401 311
155 3300049582 Ga0501048_0022984 Ga0501048_0022984_1098_2066 311
156 3300049587 Ga0501071_0063950 Ga0501071_0063950_1181_2149 311
157 3300049587 Ga0501071_0225021 Ga0501071_0225021_272_1240 311
158 3300049593 Ga0501077_0049553 Ga0501077_0049553_1143_2111 311
159 3300049741 Ga0501079_0047416 Ga0501079_0047416_1464_2432 311
160 3300049741 Ga0501079_0090451 Ga0501079_0090451_929_1897 311
161 3300049822 Ga0501035_0037013 Ga0501035_0037013_1960_2928 311
162 3300049824 Ga0501045_0074608 Ga0501045_0074608_418_1386 311
163 3300061734 Ga0530510_0108524 Ga0530510_0108524_441_1409 311
164 3300003544 Ga0007417J51691_1018961 Ga0007417J51691_10189612 312
165 3300003579 Ga0007429J51699_1032193 Ga0007429J51699_10321932 312
166 3300003693 Ga0032354_1009780 Ga0032354_10097802 312
167 3300003735 Ga0006780_1034692 Ga0006780_10346922 312
168 3300005293 Ga0065715_10142795 Ga0065715_101427952 312
169 3300005327 Ga0070658_10008251 Ga0070658_100082515 312
170 3300005328 Ga0070676_10064858 Ga0070676_100648582 312
171 3300005330 Ga0070690_100003185 Ga0070690_1000031852 312
172 3300005335 Ga0070666_10006841 Ga0070666_100068416 312
173 3300005338 Ga0068868_100022702 Ga0068868_1000227021 312
174 3300005339 Ga0070660_100025931 Ga0070660_1000259313 312
175 3300005344 Ga0070661_100043849 Ga0070661_1000438492 312
176 3300005356 Ga0070674_100366179 Ga0070674_1003661791 312
177 3300005367 Ga0070667_100010153 Ga0070667_1000101531 312
178 3300005456 Ga0070678_100047649 Ga0070678_1000476492 312
179 3300005457 Ga0070662_100058817 Ga0070662_1000588171 312
180 3300005459 Ga0068867_100038272 Ga0068867_1000382722 312
181 3300005543 Ga0070672_100020844 Ga0070672_1000208442 312
182 3300005544 Ga0070686_100025720 Ga0070686_1000257202 312
183 3300005578 Ga0068854_100025193 Ga0068854_1000251932 312
184 3300005616 Ga0068852_100012269 Ga0068852_1000122693 312
185 3300005617 Ga0068859_100313446 Ga0068859_1003134462 312
186 3300005618 Ga0068864_100025311 Ga0068864_1000253113 312
187 3300005719 Ga0068861_100429171 Ga0068861_1004291711 312
188 3300005834 Ga0068851_10020008 Ga0068851_100200082 312
189 3300005841 Ga0068863_100011300 Ga0068863_1000113003 312
190 3300005843 Ga0068860_100023182 Ga0068860_1000231821 312
191 3300006237 Ga0097621_100107302 Ga0097621_1001073022 312
192 3300006358 Ga0068871_100052468 Ga0068871_1000524683 312
193 3300006881 Ga0068865_100080157 Ga0068865_1000801572 312
194 3300006931 Ga0097620_100313439 Ga0097620_1003134392 312
195 3300009093 Ga0105240_10273920 Ga0105240_102739201 312
196 3300009098 Ga0105245_10026405 Ga0105245_100264054 312
197 3300009176 Ga0105242_10068003 Ga0105242_100680032 312
198 3300009551 Ga0105238_10058255 Ga0105238_100582552 312
199 3300010375 Ga0105239_10289122 Ga0105239_102891222 312
200 3300013297 Ga0157378_10092217 Ga0157378_100922172 312
201 3300014968 Ga0157379_10063427 Ga0157379_100634272 312
202 3300014969 Ga0157376_10060483 Ga0157376_100604833 312
203 3300025903 Ga0207680_10111604 Ga0207680_101116041 312
204 3300025907 Ga0207645_10026740 Ga0207645_100267404 312
205 3300025909 Ga0207705_10008872 Ga0207705_100088724 312
206 3300025919 Ga0207657_10012932 Ga0207657_100129322 312
207 3300025920 Ga0207649_10032483 Ga0207649_100324832 312
208 3300025927 Ga0207687_10227762 Ga0207687_102277622 312
209 3300025931 Ga0207644_10052433 Ga0207644_100524332 312
210 3300025932 Ga0207690_10092728 Ga0207690_100927282 312
211 3300025933 Ga0207706_10006242 Ga0207706_100062422 312
212 3300025937 Ga0207669_10136055 Ga0207669_101360551 312
213 3300025940 Ga0207691_10009106 Ga0207691_1000910616 312
214 3300025940 Ga0207691_10185542 Ga0207691_101855422 312
215 3300025981 Ga0207640_10079255 Ga0207640_100792552 312
216 3300026023 Ga0207677_10031297 Ga0207677_100312972 312
217 3300026035 Ga0207703_10017170 Ga0207703_100171702 312
218 3300026088 Ga0207641_10018158 Ga0207641_100181586 312
219 3300026089 Ga0207648_10004248 Ga0207648_1000424821 312
220 3300026118 Ga0207675_100499586 Ga0207675_1004995862 312
221 3300026121 Ga0207683_10002371 Ga0207683_100023715 312
222 3300035691 Ga0373931_0112614 Ga0373931_0112614_222_1196 312
223 3300046475 Ga0495639_0075590 Ga0495639_0075590_252_1190 312
224 3300046491 Ga0495584_0000001 Ga0495584_0000001_72266_73204 312
225 3300046492 Ga0495585_0005245 Ga0495585_0005245_3279_4217 312
226 3300046499 Ga0495594_0000106 Ga0495594_0000106_19110_20051 312
227 3300046499 Ga0495594_0003633 Ga0495594_0003633_3897_4835 312
228 3300046542 Ga0495597_0041329 Ga0495597_0041329_502_1440 312
229 3300046542 Ga0495597_0113386 Ga0495597_0113386_60_998 312
230 3300046558 Ga0495633_0009662 Ga0495633_0009662_2841_3779 312
231 3300046665 Ga0495661_0007342 Ga0495661_0007342_3809_4747 312
232 3300046674 Ga0495588_0002703 Ga0495588_0002703_2287_3225 312
233 3300046674 Ga0495588_0036521 Ga0495588_0036521_806_1756 312
234 3300046691 Ga0495670_0006064 Ga0495670_0006064_935_1873 312
235 3300047318 Ga0495636_0010746 Ga0495636_0010746_997_1935 312
236 3300047320 Ga0495672_0000656 Ga0495672_0000656_23397_24335 312
237 3300047470 Ga0495681_0044824 Ga0495681_0044824_855_1793 312
238 3300048904 Ga0496101_0135536 Ga0496101_0135536_777_1751 312
239 3300048905 Ga0496102_0084553 Ga0496102_0084553_132_1106 312
240 3300048907 Ga0496104_0179144 Ga0496104_0179144_600_1574 312
241 3300048910 Ga0496107_0053489 Ga0496107_0053489_1459_2433 312
242 3300048913 Ga0496110_0012297 Ga0496110_0012297_1977_2951 312
243 3300048914 Ga0496111_0004951 Ga0496111_0004951_3826_4800 312
244 3300048915 Ga0496112_0071039 Ga0496112_0071039_2276_3250 312
245 3300048916 Ga0496113_0055823 Ga0496113_0055823_1872_2846 312
246 3300001991 JGI24743J22301_10011860 JGI24743J22301_100118602 313
247 3300003659 JGI25404J52841_10010491 JGI25404J52841_100104911 313
248 3300005290 Ga0065712_10072445 Ga0065712_100724452 313
249 3300005327 Ga0070658_10012543 Ga0070658_100125433 313
250 3300005327 Ga0070658_10087173 Ga0070658_100871732 313
251 3300005327 Ga0070658_10456593 Ga0070658_104565931 313
252 3300005331 Ga0070670_100000333 Ga0070670_10000033319 313
253 3300005331 Ga0070670_100004518 Ga0070670_1000045185 313
254 3300005331 Ga0070670_100005006 Ga0070670_1000050063 313
255 3300005331 Ga0070670_100029590 Ga0070670_1000295904 313
256 3300005331 Ga0070670_100036812 Ga0070670_1000368122 313
257 3300005331 Ga0070670_100056676 Ga0070670_1000566762 313
258 3300005331 Ga0070670_100064443 Ga0070670_1000644433 313
259 3300005331 Ga0070670_100100501 Ga0070670_1001005012 313
260 3300005331 Ga0070670_100112649 Ga0070670_1001126492 313
261 3300005331 Ga0070670_100177569 Ga0070670_1001775692 313
262 3300005331 Ga0070670_100371759 Ga0070670_1003717592 313
263 3300005333 Ga0070677_10001797 Ga0070677_100017972 313
264 3300005333 Ga0070677_10076333 Ga0070677_100763331 313
265 3300005339 Ga0070660_100031481 Ga0070660_1000314812 313
266 3300005339 Ga0070660_100082475 Ga0070660_1000824752 313
267 3300005340 Ga0070689_100007475 Ga0070689_1000074753 313
268 3300005343 Ga0070687_100002574 Ga0070687_1000025742 313
269 3300005343 Ga0070687_100216966 Ga0070687_1002169662 313
270 3300005344 Ga0070661_100000545 Ga0070661_10000054518 313
271 3300005344 Ga0070661_100011423 Ga0070661_1000114238 313
272 3300005344 Ga0070661_100059618 Ga0070661_1000596184 313
273 3300005347 Ga0070668_100037144 Ga0070668_1000371442 313
274 3300005353 Ga0070669_100004592 Ga0070669_1000045926 313
275 3300005353 Ga0070669_100012310 Ga0070669_1000123104 313
276 3300005353 Ga0070669_100085162 Ga0070669_1000851622 313
277 3300005353 Ga0070669_100131406 Ga0070669_1001314062 313
278 3300005353 Ga0070669_100195412 Ga0070669_1001954121 313
279 3300005354 Ga0070675_100001409 Ga0070675_1000014094 313
280 3300005354 Ga0070675_100017025 Ga0070675_1000170253 313
281 3300005355 Ga0070671_100001770 Ga0070671_10000177013 313
282 3300005355 Ga0070671_100009558 Ga0070671_1000095583 313
283 3300005355 Ga0070671_100009655 Ga0070671_1000096553 313
284 3300005355 Ga0070671_100021172 Ga0070671_1000211722 313
285 3300005355 Ga0070671_100037871 Ga0070671_1000378712 313
286 3300005355 Ga0070671_100050603 Ga0070671_1000506033 313
287 3300005355 Ga0070671_100060715 Ga0070671_1000607152 313
288 3300005355 Ga0070671_100066803 Ga0070671_1000668033 313
289 3300005355 Ga0070671_100122423 Ga0070671_1001224232 313
290 3300005355 Ga0070671_100194281 Ga0070671_1001942812 313
291 3300005356 Ga0070674_100013581 Ga0070674_1000135812 313
292 3300005356 Ga0070674_100079318 Ga0070674_1000793182 313
293 3300005364 Ga0070673_100000300 Ga0070673_1000003003 313
294 3300005364 Ga0070673_100039479 Ga0070673_1000394792 313
295 3300005364 Ga0070673_100114494 Ga0070673_1001144942 313
296 3300005366 Ga0070659_100002628 Ga0070659_1000026284 313
297 3300005366 Ga0070659_100276291 Ga0070659_1002762911 313
298 3300005436 Ga0070713_100010826 Ga0070713_1000108262 313
299 3300005437 Ga0070710_10016878 Ga0070710_100168782 313
300 3300005440 Ga0070705_100002258 Ga0070705_1000022582 313
301 3300005455 Ga0070663_100016283 Ga0070663_1000162835 313
302 3300005455 Ga0070663_100020564 Ga0070663_1000205646 313
303 3300005455 Ga0070663_100178664 Ga0070663_1001786642 313
304 3300005456 Ga0070678_100007469 Ga0070678_1000074695 313
305 3300005456 Ga0070678_100131068 Ga0070678_1001310682 313
306 3300005457 Ga0070662_100010863 Ga0070662_1000108638 313
307 3300005457 Ga0070662_100016370 Ga0070662_1000163706 313
308 3300005457 Ga0070662_100039751 Ga0070662_1000397512 313
309 3300005457 Ga0070662_100051656 Ga0070662_1000516562 313
310 3300005457 Ga0070662_100086952 Ga0070662_1000869523 313
311 3300005457 Ga0070662_100091954 Ga0070662_1000919541 313
312 3300005457 Ga0070662_100099363 Ga0070662_1000993632 313
313 3300005457 Ga0070662_100176156 Ga0070662_1001761562 313
314 3300005457 Ga0070662_100242281 Ga0070662_1002422812 313
315 3300005458 Ga0070681_10186457 Ga0070681_101864574 313
316 3300005530 Ga0070679_100042606 Ga0070679_1000426062 313
317 3300005535 Ga0070684_100084908 Ga0070684_1000849082 313
318 3300005539 Ga0068853_100165091 Ga0068853_1001650912 313
319 3300005543 Ga0070672_100012862 Ga0070672_1000128623 313
320 3300005543 Ga0070672_100024407 Ga0070672_1000244072 313
321 3300005543 Ga0070672_100095935 Ga0070672_1000959353 313
322 3300005544 Ga0070686_100001982 Ga0070686_1000019824 313
323 3300005564 Ga0070664_100000558 Ga0070664_10000055814 313
324 3300005564 Ga0070664_100005749 Ga0070664_1000057496 313
325 3300005564 Ga0070664_100064312 Ga0070664_1000643122 313
326 3300005564 Ga0070664_100082862 Ga0070664_1000828622 313
327 3300005564 Ga0070664_100083601 Ga0070664_1000836012 313
328 3300005564 Ga0070664_100154814 Ga0070664_1001548141 313
329 3300005564 Ga0070664_100200865 Ga0070664_1002008652 313
330 3300005577 Ga0068857_100011361 Ga0068857_1000113612 313
331 3300005577 Ga0068857_100208162 Ga0068857_1002081621 313
332 3300005578 Ga0068854_100010732 Ga0068854_1000107322 313
333 3300005614 Ga0068856_100378877 Ga0068856_1003788771 313
334 3300005618 Ga0068864_100000487 Ga0068864_1000004873 313
335 3300005618 Ga0068864_100004640 Ga0068864_1000046405 313
336 3300005618 Ga0068864_100068693 Ga0068864_1000686932 313
337 3300005618 Ga0068864_100199075 Ga0068864_1001990752 313
338 3300005618 Ga0068864_100343726 Ga0068864_1003437262 313
339 3300005718 Ga0068866_10081486 Ga0068866_100814862 313
340 3300005841 Ga0068863_100053573 Ga0068863_1000535735 313
341 3300005843 Ga0068860_100020147 Ga0068860_1000201477 313
342 3300005843 Ga0068860_100076617 Ga0068860_1000766172 313
343 3300005843 Ga0068860_100370068 Ga0068860_1003700682 313
344 3300005983 Ga0081540_1001103 Ga0081540_10011035 313
345 3300005983 Ga0081540_1002217 Ga0081540_10022178 313
346 3300006175 Ga0070712_100009973 Ga0070712_1000099733 313
347 3300006358 Ga0068871_100238791 Ga0068871_1002387912 313
348 3300006844 Ga0075428_100024288 Ga0075428_1000242885 313
349 3300006881 Ga0068865_100020904 Ga0068865_1000209042 313
350 3300009093 Ga0105240_10001450 Ga0105240_100014504 313
351 3300009093 Ga0105240_10021752 Ga0105240_100217522 313
352 3300009094 Ga0111539_10230394 Ga0111539_102303942 313
353 3300009094 Ga0111539_10239315 Ga0111539_102393152 313
354 3300009094 Ga0111539_10431339 Ga0111539_104313392 313
355 3300009098 Ga0105245_10050563 Ga0105245_100505632 313
356 3300009174 Ga0105241_10004888 Ga0105241_100048882 313
357 3300009174 Ga0105241_10126078 Ga0105241_101260782 313
358 3300009177 Ga0105248_10001528 Ga0105248_100015288 313
359 3300009177 Ga0105248_10002100 Ga0105248_1000210018 313
360 3300009177 Ga0105248_10009072 Ga0105248_100090723 313
361 3300009177 Ga0105248_10010223 Ga0105248_100102235 313
362 3300009177 Ga0105248_10060005 Ga0105248_100600053 313
363 3300009177 Ga0105248_10102106 Ga0105248_101021062 313
364 3300009177 Ga0105248_10216217 Ga0105248_102162172 313
365 3300009177 Ga0105248_10264893 Ga0105248_102648932 313
366 3300009553 Ga0105249_10000765 Ga0105249_100007652 313
367 3300010375 Ga0105239_10025535 Ga0105239_100255352 313
368 3300013100 Ga0157373_10031648 Ga0157373_100316483 313
369 3300013102 Ga0157371_10000585 Ga0157371_1000058540 313
370 3300013102 Ga0157371_10131138 Ga0157371_101311382 313
371 3300013297 Ga0157378_10001666 Ga0157378_1000166615 313
372 3300013306 Ga0163162_10000590 Ga0163162_1000059015 313
373 3300013306 Ga0163162_10129598 Ga0163162_101295982 313
374 3300013308 Ga0157375_10007958 Ga0157375_1000795812 313
375 3300013308 Ga0157375_10327805 Ga0157375_103278052 313
376 3300014325 Ga0163163_10122468 Ga0163163_101224682 313
377 3300014326 Ga0157380_10005457 Ga0157380_100054577 313
378 3300014326 Ga0157380_10015277 Ga0157380_100152773 313
379 3300014326 Ga0157380_10035011 Ga0157380_100350112 313
380 3300014326 Ga0157380_10059072 Ga0157380_100590723 313
381 3300014326 Ga0157380_10183039 Ga0157380_101830392 313
382 3300014326 Ga0157380_10245189 Ga0157380_102451892 313
383 3300014745 Ga0157377_10000555 Ga0157377_100005556 313
384 3300014969 Ga0157376_10000627 Ga0157376_1000062726 313
385 3300017792 Ga0163161_10002499 Ga0163161_100024994 313
386 3300017792 Ga0163161_10052637 Ga0163161_100526373 313
387 3300017792 Ga0163161_10063782 Ga0163161_100637822 313
388 3300017792 Ga0163161_10086768 Ga0163161_100867682 313
389 3300017792 Ga0163161_10088747 Ga0163161_100887472 313
390 3300025315 Ga0207697_10008313 Ga0207697_100083132 313
391 3300025893 Ga0207682_10000111 Ga0207682_1000011131 313
392 3300025893 Ga0207682_10000662 Ga0207682_100006628 313
393 3300025893 Ga0207682_10063210 Ga0207682_100632102 313
394 3300025898 Ga0207692_10071259 Ga0207692_100712592 313
395 3300025900 Ga0207710_10004942 Ga0207710_100049422 313
396 3300025901 Ga0207688_10000076 Ga0207688_100000763 313
397 3300025901 Ga0207688_10104369 Ga0207688_101043692 313
398 3300025903 Ga0207680_10083609 Ga0207680_100836091 313
399 3300025904 Ga0207647_10008421 Ga0207647_100084213 313
400 3300025907 Ga0207645_10000016 Ga0207645_1000001641 313
401 3300025908 Ga0207643_10000010 Ga0207643_1000001041 313
402 3300025909 Ga0207705_10023151 Ga0207705_100231513 313
403 3300025913 Ga0207695_10275582 Ga0207695_102755823 313
404 3300025915 Ga0207693_10033175 Ga0207693_100331753 313
405 3300025917 Ga0207660_10066237 Ga0207660_100662371 313
406 3300025918 Ga0207662_10000014 Ga0207662_1000001432 313
407 3300025919 Ga0207657_10000060 Ga0207657_1000006089 313
408 3300025919 Ga0207657_10062553 Ga0207657_100625532 313
409 3300025919 Ga0207657_10242271 Ga0207657_102422712 313
410 3300025920 Ga0207649_10001207 Ga0207649_100012078 313
411 3300025920 Ga0207649_10014785 Ga0207649_100147855 313
412 3300025920 Ga0207649_10018547 Ga0207649_100185475 313
413 3300025920 Ga0207649_10139753 Ga0207649_101397532 313
414 3300025920 Ga0207649_10206749 Ga0207649_102067491 313
415 3300025923 Ga0207681_10002071 Ga0207681_100020714 313
416 3300025923 Ga0207681_10044015 Ga0207681_100440152 313
417 3300025923 Ga0207681_10345386 Ga0207681_103453861 313
418 3300025923 Ga0207681_10373089 Ga0207681_103730892 313
419 3300025925 Ga0207650_10003050 Ga0207650_100030503 313
420 3300025925 Ga0207650_10003575 Ga0207650_100035756 313
421 3300025925 Ga0207650_10005549 Ga0207650_100055493 313
422 3300025925 Ga0207650_10025063 Ga0207650_100250633 313
423 3300025925 Ga0207650_10046824 Ga0207650_100468242 313
424 3300025925 Ga0207650_10070085 Ga0207650_100700852 313
425 3300025925 Ga0207650_10318172 Ga0207650_103181722 313
426 3300025926 Ga0207659_10003360 Ga0207659_100033605 313
427 3300025926 Ga0207659_10009623 Ga0207659_100096237 313
428 3300025926 Ga0207659_10030155 Ga0207659_100301552 313
429 3300025929 Ga0207664_10023845 Ga0207664_100238452 313
430 3300025931 Ga0207644_10001325 Ga0207644_100013257 313
431 3300025931 Ga0207644_10006562 Ga0207644_100065625 313
432 3300025931 Ga0207644_10014305 Ga0207644_100143053 313
433 3300025931 Ga0207644_10017574 Ga0207644_100175744 313
434 3300025931 Ga0207644_10018466 Ga0207644_100184663 313
435 3300025931 Ga0207644_10031962 Ga0207644_100319622 313
436 3300025931 Ga0207644_10048636 Ga0207644_100486363 313
437 3300025931 Ga0207644_10057431 Ga0207644_100574312 313
438 3300025931 Ga0207644_10070036 Ga0207644_100700362 313
439 3300025931 Ga0207644_10160304 Ga0207644_101603042 313
440 3300025931 Ga0207644_10292657 Ga0207644_102926571 313
441 3300025932 Ga0207690_10035242 Ga0207690_100352422 313
442 3300025932 Ga0207690_10136473 Ga0207690_101364732 313
443 3300025933 Ga0207706_10000132 Ga0207706_100001322 313
444 3300025933 Ga0207706_10011039 Ga0207706_100110394 313
445 3300025933 Ga0207706_10027737 Ga0207706_100277376 313
446 3300025933 Ga0207706_10029078 Ga0207706_100290783 313
447 3300025933 Ga0207706_10059993 Ga0207706_100599934 313
448 3300025933 Ga0207706_10124348 Ga0207706_101243482 313
449 3300025933 Ga0207706_10276120 Ga0207706_102761202 313
450 3300025935 Ga0207709_10005096 Ga0207709_100050968 313
451 3300025936 Ga0207670_10031047 Ga0207670_100310475 313
452 3300025937 Ga0207669_10018286 Ga0207669_100182862 313
453 3300025937 Ga0207669_10022376 Ga0207669_100223762 313
454 3300025937 Ga0207669_10183439 Ga0207669_101834392 313
455 3300025938 Ga0207704_10219408 Ga0207704_102194082 313
456 3300025940 Ga0207691_10000011 Ga0207691_1000001185 313
457 3300025940 Ga0207691_10004037 Ga0207691_100040376 313
458 3300025940 Ga0207691_10063321 Ga0207691_100633213 313
459 3300025940 Ga0207691_10077666 Ga0207691_100776662 313
460 3300025940 Ga0207691_10109835 Ga0207691_101098353 313
461 3300025941 Ga0207711_10000345 Ga0207711_1000034536 313
462 3300025941 Ga0207711_10005958 Ga0207711_100059585 313
463 3300025941 Ga0207711_10012804 Ga0207711_100128042 313
464 3300025941 Ga0207711_10035389 Ga0207711_100353892 313
465 3300025941 Ga0207711_10070869 Ga0207711_100708692 313
466 3300025941 Ga0207711_10108521 Ga0207711_101085212 313
467 3300025942 Ga0207689_10000011 Ga0207689_1000001141 313
468 3300025945 Ga0207679_10000250 Ga0207679_100002506 313
469 3300025945 Ga0207679_10023018 Ga0207679_100230183 313
470 3300025945 Ga0207679_10042792 Ga0207679_100427922 313
471 3300025945 Ga0207679_10092253 Ga0207679_100922532 313
472 3300025945 Ga0207679_10215982 Ga0207679_102159822 313
473 3300025960 Ga0207651_10001464 Ga0207651_100014649 313
474 3300025960 Ga0207651_10037502 Ga0207651_100375022 313
475 3300025960 Ga0207651_10146454 Ga0207651_101464541 313
476 3300025960 Ga0207651_10333455 Ga0207651_103334552 313
477 3300025961 Ga0207712_10000795 Ga0207712_1000079515 313
478 3300025981 Ga0207640_10008148 Ga0207640_100081482 313
479 3300025986 Ga0207658_10010621 Ga0207658_100106213 313
480 3300025986 Ga0207658_10157177 Ga0207658_101571772 313
481 3300026023 Ga0207677_10000219 Ga0207677_100002198 313
482 3300026035 Ga0207703_10000434 Ga0207703_100004344 313
483 3300026035 Ga0207703_10259400 Ga0207703_102594002 313
484 3300026041 Ga0207639_10149166 Ga0207639_101491662 313
485 3300026067 Ga0207678_10002515 Ga0207678_100025156 313
486 3300026067 Ga0207678_10029231 Ga0207678_100292313 313
487 3300026067 Ga0207678_10260109 Ga0207678_102601092 313
488 3300026088 Ga0207641_10007924 Ga0207641_100079243 313
489 3300026088 Ga0207641_10079950 Ga0207641_100799502 313
490 3300026089 Ga0207648_10000258 Ga0207648_100002582 313
491 3300026089 Ga0207648_10026314 Ga0207648_100263142 313
492 3300026095 Ga0207676_10007059 Ga0207676_100070593 313
493 3300026095 Ga0207676_10020930 Ga0207676_100209303 313
494 3300026095 Ga0207676_10037419 Ga0207676_100374192 313
495 3300026095 Ga0207676_10108198 Ga0207676_101081982 313
496 3300026095 Ga0207676_10161850 Ga0207676_101618502 313
497 3300026116 Ga0207674_10001589 Ga0207674_100015896 313
498 3300026116 Ga0207674_10006098 Ga0207674_1000609812 313
499 3300026116 Ga0207674_10141597 Ga0207674_101415971 313
500 3300026118 Ga0207675_100000164 Ga0207675_1000001643 313
501 3300026121 Ga0207683_10000080 Ga0207683_1000008020 313
502 3300026121 Ga0207683_10008588 Ga0207683_100085889 313
503 3300026121 Ga0207683_10074002 Ga0207683_100740022 313
504 3300026121 Ga0207683_10100350 Ga0207683_101003501 313
505 3300026121 Ga0207683_10233435 Ga0207683_102334352 313
506 3300026142 Ga0207698_10267424 Ga0207698_102674242 313
507 3300028379 Ga0268266_10022945 Ga0268266_100229453 313
508 3300028380 Ga0268265_10001169 Ga0268265_100011694 313
509 3300028380 Ga0268265_10088422 Ga0268265_100884222 313
510 3300028381 Ga0268264_10001259 Ga0268264_100012596 313
511 3300031731 Ga0307405_10301344 Ga0307405_103013442 313
512 3300031852 Ga0307410_10000425 Ga0307410_100004253 313
513 3300031852 Ga0307410_10023180 Ga0307410_100231803 313
514 3300031852 Ga0307410_10153613 Ga0307410_101536132 313
515 3300031852 Ga0307410_10349586 Ga0307410_103495862 313
516 3300031901 Ga0307406_10424455 Ga0307406_104244551 313
517 3300031995 Ga0307409_100021116 Ga0307409_1000211163 313
518 3300031995 Ga0307409_100095503 Ga0307409_1000955032 313
519 3300032002 Ga0307416_100038095 Ga0307416_1000380952 313
520 3300032002 Ga0307416_100074064 Ga0307416_1000740642 313
521 3300032002 Ga0307416_100147399 Ga0307416_1001473992 313
522 3300032004 Ga0307414_10004523 Ga0307414_1000452310 313
523 3300032004 Ga0307414_10172241 Ga0307414_101722412 313
524 3300032004 Ga0307414_10339400 Ga0307414_103394002 313
525 3300032005 Ga0307411_10001130 Ga0307411_100011309 313
526 3300032005 Ga0307411_10029154 Ga0307411_100291545 313
527 3300032005 Ga0307411_10114470 Ga0307411_101144702 313
528 3300032005 Ga0307411_10220984 Ga0307411_102209842 313
529 3300035170 Ga0373943_0001816 Ga0373943_0001816_5152_6123 313
530 3300037068 Ga0373925_0010421 Ga0373925_0010421_4950_5921 313
531 3300037312 Ga0395899_0011101 Ga0395899_0011101_934_1905 313
532 3300037312 Ga0395899_0069849 Ga0395899_0069849_156_1127 313
533 3300037418 Ga0395900_0054480 Ga0395900_0054480_1053_2024 313
534 3300037466 Ga0395898_0182456 Ga0395898_0182456_692_1663 313
535 3300037471 Ga0395905_0001203 Ga0395905_0001203_11188_12159 313
536 3300037471 Ga0395905_0112163 Ga0395905_0112163_546_1517 313
537 3300037471 Ga0395905_0165738 Ga0395905_0165738_406_1377 313
538 3300039450 Ga0436363_0864307 Ga0436363_0864307_248_1189 313
539 3300042005 Ga0439448_0001486 Ga0439448_0001486_2426_3367 313
540 3300046515 Ga0495620_0071687 Ga0495620_0071687_155_1126 313
541 3300046539 Ga0495621_0002100 Ga0495621_0002100_3406_4377 313
542 3300046684 Ga0495669_0001409 Ga0495669_0001409_3394_4431 313
543 3300046684 Ga0495669_0007425 Ga0495669_0007425_1109_2089 313
544 3300046684 Ga0495669_0024398 Ga0495669_0024398_799_1770 313
545 3300046684 Ga0495669_0061416 Ga0495669_0061416_483_1469 313
546 3300046691 Ga0495670_0120943 Ga0495670_0120943_184_1155 313
547 3300048903 Ga0496100_0009086 Ga0496100_0009086_527_1498 313
548 3300048904 Ga0496101_0003840 Ga0496101_0003840_2435_3421 313
549 3300048904 Ga0496101_0024562 Ga0496101_0024562_10_981 313
550 3300048904 Ga0496101_0087878 Ga0496101_0087878_834_1811 313
551 3300048905 Ga0496102_0006567 Ga0496102_0006567_1543_2484 313
552 3300048907 Ga0496104_0030451 Ga0496104_0030451_2294_3271 313
553 3300048907 Ga0496104_0207376 Ga0496104_0207376_507_1493 313
554 3300048909 Ga0496106_0001460 Ga0496106_0001460_7396_8382 313
555 3300048909 Ga0496106_0019355 Ga0496106_0019355_10_951 313
556 3300048910 Ga0496107_0008863 Ga0496107_0008863_5776_6717 313
557 3300048910 Ga0496107_0016472 Ga0496107_0016472_531_1517 313
558 3300048910 Ga0496107_0045793 Ga0496107_0045793_1523_2503 313
559 3300048911 Ga0496108_0180403 Ga0496108_0180403_705_1646 313
560 3300048912 Ga0496109_0001761 Ga0496109_0001761_164_1150 313
561 3300048912 Ga0496109_0012908 Ga0496109_0012908_4100_5041 313
562 3300048912 Ga0496109_0072010 Ga0496109_0072010_1185_2156 313
563 3300048912 Ga0496109_0072933 Ga0496109_0072933_1533_2504 313
564 3300048912 Ga0496109_0130791 Ga0496109_0130791_729_1706 313
565 3300048912 Ga0496109_0135357 Ga0496109_0135357_101_1075 313
566 3300048912 Ga0496109_0173580 Ga0496109_0173580_779_1759 313
567 3300048913 Ga0496110_0005414 Ga0496110_0005414_3363_4343 313
568 3300048913 Ga0496110_0009390 Ga0496110_0009390_5900_6886 313
569 3300048913 Ga0496110_0041259 Ga0496110_0041259_1904_2875 313
570 3300048914 Ga0496111_0000782 Ga0496111_0000782_6678_7658 313
571 3300048914 Ga0496111_0008972 Ga0496111_0008972_170_1150 313
572 3300048914 Ga0496111_0033780 Ga0496111_0033780_1696_2673 313
573 3300048915 Ga0496112_0011111 Ga0496112_0011111_3108_4049 313
574 3300048915 Ga0496112_0016757 Ga0496112_0016757_4670_5656 313
575 3300048915 Ga0496112_0069327 Ga0496112_0069327_277_1248 313
576 3300048915 Ga0496112_0286829 Ga0496112_0286829_361_1338 313
577 3300048915 Ga0496112_0465808 Ga0496112_0465808_58_1029 313
578 3300048916 Ga0496113_0010228 Ga0496113_0010228_1425_2396 313
579 3300048916 Ga0496113_0156730 Ga0496113_0156730_498_1469 313
580 3300048917 Ga0496114_0006322 Ga0496114_0006322_5275_6255 313
581 3300048917 Ga0496114_0071835 Ga0496114_0071835_1759_2730 313
582 3300048917 Ga0496114_0089144 Ga0496114_0089144_949_1920 313
583 3300048918 Ga0496115_0000750 Ga0496115_0000750_1034_2005 313
584 3300049823 Ga0501044_0057398 Ga0501044_0057398_2096_3046 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01515

PTA_PTB

Phosphate acetyl/butaryl transferase

109

330

0.95

PF01515

PTA_PTB

Phosphate acetyl/butaryl transferase

39

119

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vg9-assembly1.cif.gz_A crystal structure of phosphotransbutyrylase from clostridium acetobutylicum 0.953 8 300
7vg9-assembly1.cif.gz_A crystal structure of phosphotransbutyrylase from clostridium acetobutylicum 0.9255 8 300
3u9e-assembly1.cif.gz_B the crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa. 0.9141 20 299
1yco-assembly1.cif.gz_A crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583 0.8936 21 299
1yco-assembly1.cif.gz_B crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583 0.8897 21 300
ID Description Score Start End Superfamily
3u9eA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9151 20 299 3.40.718.10
1ycoB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8897 21 300 3.40.718.10
1ycoB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8803 21 300 3.40.718.10
3u9eA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8714 20 299 3.40.718.10
af_Q2G0J0_17_327_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8409 22 298 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A536WXC6-F1-model_v4 Phosphate acetyltransferase (EC 2.3.1.8) 0.9901 5 104 GO:0008959
AF-T0YYQ8-F1-model_v4 Bifunctional enoyl-CoA hydratase/phosphate acetyltransferase 0.9752 1 137 GO:0016740
AF-A0A3N5YH57-F1-model_v4 Bifunctional enoyl-CoA hydratase/phosphate acetyltransferase 0.9743 1 142 GO:0005524
GO:0006633
GO:0019171
GO:0047761
AF-A0A7T4R738-F1-model_v4 deleted 0.9725 5 299
AF-A0A6A7RYE1-F1-model_v4 Enoyl-CoA hydratase 0.9703 4 178 GO:0016746

Feature Viewer

pLDDT pTM Quality
91.68 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map