F466145

General Info

Members Datasets Scaffolds Average Seq Length
582 238 582 176

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100695225|Ga0070694_1006952251
Length 194
Sequence LAAASSALKSMRKSRLTLVGAFIVLLVYVTVPGQETVGTVRLAKSTTAPAMPTNVEPIDTAGLKDLISKPKDKPLLVNFWATYCDPCRDEFPDLVKVDRDFRPKSLDFVTVSLDDLSDIKTKVPQFLAQMKATMPAYLLNVTDPEPAINAVDPKWQGDLPATFLYNAKGEIVFKAFGRVNTAALREAIERLAKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
183 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
197 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
198 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
201 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
202 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
203 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
213 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
214 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
215 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
216 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
217 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
218 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
223 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
224 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
227 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
228 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
229 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
230 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.23
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3401432 2162886007 Bacteria 5226
2 MBSR1b_contig_7380138 2162886012 Unclassified 982
3 JGI24751J29686_10000057 3300002459 Bacteria 62893
4 JGI25406J46586_10012282 3300003203 Unclassified 3724
5 Ga0065714_10002185 3300005288 Bacteria 199213
6 Ga0065704_10002583 3300005289 Bacteria 13219
7 Ga0065704_10146127 3300005289 Bacteria 1470
8 Ga0065712_10001844 3300005290 Bacteria 5582
9 Ga0065712_10067739 3300005290 Bacteria 87070
10 Ga0065712_10068489 3300005290 Bacteria 10327
11 Ga0065712_10113835 3300005290 Bacteria 1776
12 Ga0065715_10089805 3300005293 Bacteria 8464
13 Ga0065715_10156764 3300005293 Bacteria 1668
14 Ga0065715_10206567 3300005293 Bacteria 1334
15 Ga0065715_10273682 3300005293 Bacteria 1104
16 Ga0065715_10588096 3300005293 Unclassified 715
17 Ga0065707_10000877 3300005295 Bacteria 10561
18 Ga0065707_10146828 3300005295 Bacteria 1688
19 Ga0065707_10191648 3300005295 Unclassified 1358
20 Ga0065707_10242198 3300005295 Bacteria 1140
21 Ga0070690_100061012 3300005330 Unclassified 2428
22 Ga0070670_100000055 3300005331 Bacteria 120693
23 Ga0070670_100087533 3300005331 Bacteria 2677
24 Ga0070670_100138258 3300005331 Bacteria 2106
25 Ga0070670_100578441 3300005331 Bacteria 1004
26 Ga0070670_100708423 3300005331 Unclassified 905
27 Ga0068869_100005198 3300005334 Bacteria 8172
28 Ga0068869_100026623 3300005334 Bacteria 4027
29 Ga0068869_100172689 3300005334 Bacteria 1689
30 Ga0068869_100301572 3300005334 Bacteria 1294
31 Ga0068869_100509321 3300005334 Bacteria 1006
32 Ga0068869_101132007 3300005334 Unclassified 686
33 Ga0070666_10059019 3300005335 Bacteria 2595
34 Ga0070680_100018016 3300005336 Bacteria 5577
35 Ga0070682_100024872 3300005337 Bacteria 3568
36 Ga0070682_100029163 3300005337 Bacteria 3321
37 Ga0068868_100038834 3300005338 Bacteria 3695
38 Ga0068868_100087824 3300005338 Bacteria 2501
39 Ga0068868_100430732 3300005338 Unclassified 1144
40 Ga0068868_100433771 3300005338 Bacteria 1140
41 Ga0070689_100126120 3300005340 Bacteria 2048
42 Ga0070689_100553875 3300005340 Bacteria 991
43 Ga0070689_100983901 3300005340 Bacteria 750
44 Ga0070691_10227598 3300005341 Bacteria 991
45 Ga0070687_100014601 3300005343 Bacteria 3531
46 Ga0070687_100035076 3300005343 Bacteria 2488
47 Ga0070687_100323076 3300005343 Bacteria 987
48 Ga0070661_100670725 3300005344 Bacteria 843
49 Ga0070692_10001576 3300005345 Bacteria 8371
50 Ga0070692_10016268 3300005345 Bacteria 3537
51 Ga0070692_10438200 3300005345 Bacteria 833
52 Ga0070669_100009868 3300005353 Bacteria 6800
53 Ga0070669_100068611 3300005353 Bacteria 2618
54 Ga0070669_100754093 3300005353 Bacteria 825
55 Ga0070671_100012540 3300005355 Bacteria 6825
56 Ga0070671_100817391 3300005355 Unclassified 812
57 Ga0070671_101095092 3300005355 Unclassified 699
58 Ga0070673_100298199 3300005364 Bacteria 1418
59 Ga0070673_100373943 3300005364 Bacteria 1269
60 Ga0070673_100568394 3300005364 Bacteria 1031
61 Ga0070673_100639945 3300005364 Bacteria 972
62 Ga0070659_100044476 3300005366 Bacteria 3477
63 Ga0070667_100067800 3300005367 Bacteria 3035
64 Ga0070701_10230768 3300005438 Bacteria 1108
65 Ga0070701_10826611 3300005438 Unclassified 634
66 Ga0070705_100124090 3300005440 Bacteria 1673
67 Ga0070705_100590083 3300005440 Bacteria 858
68 Ga0070700_100000539 3300005441 Bacteria 18983
69 Ga0070700_100220464 3300005441 Bacteria 1344
70 Ga0070700_100317332 3300005441 Unclassified 1143
71 Ga0070700_100504956 3300005441 Unclassified 931
72 Ga0070694_100024824 3300005444 Bacteria 3872
73 Ga0070694_100036538 3300005444 Bacteria 3254
74 Ga0070694_100073419 3300005444 Bacteria 2362
75 Ga0070694_100082604 3300005444 Bacteria 2237
76 Ga0070694_100284992 3300005444 Unclassified 1261
77 Ga0070694_100652424 3300005444 Bacteria 852
78 Ga0070694_100695225 3300005444 Unclassified 826
79 Ga0070694_100748229 3300005444 Unclassified 798
80 Ga0070694_101243222 3300005444 Bacteria 625
81 Ga0070708_100000628 3300005445 Bacteria 26714
82 Ga0070678_100125384 3300005456 Bacteria 2032
83 Ga0070678_100551954 3300005456 Bacteria 1023
84 Ga0070662_100157288 3300005457 Bacteria 1775
85 Ga0070681_10070797 3300005458 Bacteria 3452
86 Ga0070681_10086972 3300005458 Bacteria 3079
87 Ga0070681_10198313 3300005458 Bacteria 1926
88 Ga0068867_100440475 3300005459 Unclassified 1108
89 Ga0068867_100984908 3300005459 Bacteria 764
90 Ga0070706_100000126 3300005467 Bacteria 94634
91 Ga0070706_100037817 3300005467 Bacteria 4456
92 Ga0070706_101419261 3300005467 Bacteria 635
93 Ga0070707_100012529 3300005468 Bacteria 7920
94 Ga0070707_100297125 3300005468 Bacteria 1569
95 Ga0070707_100371596 3300005468 Bacteria 1389
96 Ga0070698_100005022 3300005471 Bacteria 14496
97 Ga0070698_100052462 3300005471 Bacteria 4148
98 Ga0070698_100162177 3300005471 Bacteria 2179
99 Ga0070698_100168682 3300005471 Bacteria 2130
100 Ga0070698_100356291 3300005471 Bacteria 1395
101 Ga0070699_100003193 3300005518 Bacteria 14497
102 Ga0070699_100198495 3300005518 Bacteria 1783
103 Ga0070699_100223174 3300005518 Bacteria 1679
104 Ga0070699_100239937 3300005518 Bacteria 1617
105 Ga0070679_100000416 3300005530 Bacteria 36273
106 Ga0070697_100600503 3300005536 Bacteria 967
107 Ga0068853_100066846 3300005539 Bacteria 3122
108 Ga0068853_100189169 3300005539 Bacteria 1869
109 Ga0068853_100214425 3300005539 Bacteria 1756
110 Ga0068853_100290946 3300005539 Bacteria 1508
111 Ga0068853_100294347 3300005539 Bacteria 1499
112 Ga0070672_100073998 3300005543 Bacteria 2716
113 Ga0070686_100010079 3300005544 Bacteria 5317
114 Ga0070686_101166213 3300005544 Unclassified 639
115 Ga0070695_100053146 3300005545 Bacteria 2604
116 Ga0070695_100172454 3300005545 Bacteria 1527
117 Ga0070695_100191594 3300005545 Bacteria 1455
118 Ga0070695_100278625 3300005545 Bacteria 1228
119 Ga0070695_100411714 3300005545 Bacteria 1027
120 Ga0070696_100064723 3300005546 Bacteria 2562
121 Ga0070696_100319553 3300005546 Bacteria 1194
122 Ga0070693_100014568 3300005547 Bacteria 4032
123 Ga0070693_100085317 3300005547 Bacteria 1892
124 Ga0070693_100104322 3300005547 Bacteria 1732
125 Ga0070693_100121431 3300005547 Bacteria 1621
126 Ga0070693_100667922 3300005547 Bacteria 757
127 Ga0070665_100382337 3300005548 Bacteria 1415
128 Ga0070704_100165508 3300005549 Bacteria 1753
129 Ga0070704_100175746 3300005549 Bacteria 1708
130 Ga0070704_100718022 3300005549 Bacteria 888
131 Ga0068855_100486321 3300005563 Bacteria 1343
132 Ga0068855_100488940 3300005563 Unclassified 1339
133 Ga0070664_100326759 3300005564 Unclassified 1391
134 Ga0070664_100384455 3300005564 Bacteria 1282
135 Ga0070664_101060872 3300005564 Bacteria 762
136 Ga0068857_100066162 3300005577 Bacteria 3215
137 Ga0068857_100285099 3300005577 Bacteria 1520
138 Ga0068857_100552603 3300005577 Bacteria 1085
139 Ga0068856_100230984 3300005614 Bacteria 1865
140 Ga0070702_100052515 3300005615 Bacteria 2338
141 Ga0070702_100502578 3300005615 Bacteria 890
142 Ga0070702_100669083 3300005615 Unclassified 787
143 Ga0068852_100493210 3300005616 Bacteria 1219
144 Ga0068859_100006782 3300005617 Bacteria 11632
145 Ga0068859_100006814 3300005617 Bacteria 11608
146 Ga0068859_100052889 3300005617 Bacteria 4084
147 Ga0068859_100206625 3300005617 Bacteria 2049
148 Ga0068859_100213919 3300005617 Bacteria 2014
149 Ga0068859_100283534 3300005617 Bacteria 1749
150 Ga0068859_100459113 3300005617 Bacteria 1370
151 Ga0068859_100465498 3300005617 Bacteria 1360
152 Ga0068859_100522608 3300005617 Bacteria 1282
153 Ga0068859_100813281 3300005617 Bacteria 1022
154 Ga0068859_101047461 3300005617 Bacteria 897
155 Ga0068859_101061345 3300005617 Bacteria 891
156 Ga0068859_101167696 3300005617 Bacteria 847
157 Ga0068859_101595725 3300005617 Bacteria 720
158 Ga0068859_101715737 3300005617 Bacteria 694
159 Ga0068864_100008974 3300005618 Bacteria 8244
160 Ga0068864_100024680 3300005618 Bacteria 5057
161 Ga0068864_100086094 3300005618 Bacteria 2764
162 Ga0068864_100263314 3300005618 Bacteria 1604
163 Ga0068864_100392145 3300005618 Bacteria 1318
164 Ga0068864_100411106 3300005618 Bacteria 1287
165 Ga0068864_100477206 3300005618 Bacteria 1196
166 Ga0068864_100884149 3300005618 Unclassified 882
167 Ga0068866_10074576 3300005718 Bacteria 1804
168 Ga0068861_100001140 3300005719 Bacteria 16543
169 Ga0068861_100871465 3300005719 Bacteria 850
170 Ga0068851_10053357 3300005834 Bacteria 2058
171 Ga0068870_10015396 3300005840 Bacteria 3628
172 Ga0068870_10029521 3300005840 Bacteria 2763
173 Ga0068870_10040964 3300005840 Bacteria 2404
174 Ga0068870_10355738 3300005840 Unclassified 941
175 Ga0068863_100027152 3300005841 Bacteria 5460
176 Ga0068863_100174220 3300005841 Bacteria 2064
177 Ga0068858_100033679 3300005842 Bacteria 4752
178 Ga0068858_100178319 3300005842 Bacteria 2005
179 Ga0068858_100246525 3300005842 Unclassified 1696
180 Ga0068858_100319494 3300005842 Bacteria 1483
181 Ga0068858_100431730 3300005842 Bacteria 1268
182 Ga0068858_100820463 3300005842 Bacteria 908
183 Ga0068858_101272494 3300005842 Bacteria 724
184 Ga0068860_100031693 3300005843 Bacteria 5082
185 Ga0068860_100247242 3300005843 Bacteria 1736
186 Ga0068860_100314692 3300005843 Bacteria 1535
187 Ga0068860_100520207 3300005843 Bacteria 1190
188 Ga0068860_100883385 3300005843 Bacteria 909
189 Ga0068860_102000107 3300005843 Unclassified 601
190 Ga0068862_100053405 3300005844 Bacteria 3459
191 Ga0068862_100593392 3300005844 Bacteria 1062
192 Ga0068862_100628517 3300005844 Bacteria 1034
193 Ga0081539_10000067 3300005985 Bacteria 246361
194 Ga0081539_10000600 3300005985 Bacteria 73358
195 Ga0081539_10027674 3300005985 Bacteria 3584
196 Ga0075432_10073999 3300006058 Bacteria 1227
197 Ga0070716_100401135 3300006173 Bacteria 986
198 Ga0097621_100006102 3300006237 Bacteria 8528
199 Ga0097621_100036145 3300006237 Bacteria 3951
200 Ga0097621_100607102 3300006237 Unclassified 1000
201 Ga0068871_100002538 3300006358 Bacteria 12464
202 Ga0068871_100019457 3300006358 Bacteria 5184
203 Ga0068871_100091314 3300006358 Bacteria 2538
204 Ga0068871_100229927 3300006358 Bacteria 1609
205 Ga0068871_100411190 3300006358 Unclassified 1206
206 Ga0075428_100104393 3300006844 Bacteria 3090
207 Ga0075431_100022432 3300006847 Bacteria 6453
208 Ga0075431_100089873 3300006847 Bacteria 3170
209 Ga0075433_10059411 3300006852 Bacteria 3345
210 Ga0075433_10446659 3300006852 Bacteria 1140
211 Ga0075434_100116445 3300006871 Bacteria 2685
212 Ga0075434_100134127 3300006871 Bacteria 2496
213 Ga0075434_100182090 3300006871 Bacteria 2121
214 Ga0075434_100221272 3300006871 Bacteria 1913
215 Ga0075434_100319299 3300006871 Bacteria 1574
216 Ga0075429_100008105 3300006880 Bacteria 9134
217 Ga0075429_100248775 3300006880 Bacteria 1557
218 Ga0075429_100874588 3300006880 Bacteria 787
219 Ga0068865_100013078 3300006881 Bacteria 5236
220 Ga0075436_100108760 3300006914 Bacteria 1934
221 Ga0097620_100006783 3300006931 Bacteria 11632
222 Ga0097620_100006813 3300006931 Bacteria 11608
223 Ga0097620_100052882 3300006931 Bacteria 4084
224 Ga0097620_100206618 3300006931 Bacteria 2049
225 Ga0097620_100213913 3300006931 Bacteria 2014
226 Ga0097620_100283526 3300006931 Bacteria 1749
227 Ga0097620_100459112 3300006931 Bacteria 1370
228 Ga0097620_100465489 3300006931 Bacteria 1360
229 Ga0097620_100522597 3300006931 Bacteria 1282
230 Ga0097620_100813182 3300006931 Bacteria 1022
231 Ga0097620_101047518 3300006931 Bacteria 897
232 Ga0097620_101061383 3300006931 Bacteria 891
233 Ga0097620_101167776 3300006931 Bacteria 847
234 Ga0097620_101595754 3300006931 Bacteria 720
235 Ga0097620_101715683 3300006931 Bacteria 694
236 Ga0075435_100146654 3300007076 Bacteria 1982
237 Ga0075435_100270354 3300007076 Bacteria 1450
238 Ga0105240_10122683 3300009093 Bacteria 3127
239 Ga0105240_10436121 3300009093 Bacteria 1469
240 Ga0111539_10006275 3300009094 Bacteria 15348
241 Ga0105245_10173641 3300009098 Bacteria 2054
242 Ga0105247_10002738 3300009101 Bacteria 11812
243 Ga0105247_10159266 3300009101 Bacteria 1493
244 Ga0105247_10367997 3300009101 Unclassified 1016
245 Ga0105247_10482305 3300009101 Bacteria 900
246 Ga0114129_10009410 3300009147 Bacteria 13926
247 Ga0114129_10022736 3300009147 Bacteria 8890
248 Ga0114129_10074746 3300009147 Bacteria 4720
249 Ga0114129_10303944 3300009147 Bacteria 2125
250 Ga0114129_10717593 3300009147 Bacteria 1283
251 Ga0114129_11144286 3300009147 Bacteria 972
252 Ga0114129_11642556 3300009147 Unclassified 786
253 Ga0105243_10015747 3300009148 Bacteria 5719
254 Ga0105243_10329760 3300009148 Bacteria 1394
255 Ga0105243_10639591 3300009148 Unclassified 1029
256 Ga0105243_10743712 3300009148 Bacteria 961
257 Ga0105243_11847608 3300009148 Unclassified 636
258 Ga0105241_10130528 3300009174 Unclassified 2034
259 Ga0105241_10150886 3300009174 Bacteria 1901
260 Ga0105241_10393868 3300009174 Bacteria 1213
261 Ga0105241_10874946 3300009174 Unclassified 833
262 Ga0105241_11467665 3300009174 Unclassified 655
263 Ga0105242_10061168 3300009176 Bacteria 3097
264 Ga0105242_10098469 3300009176 Bacteria 2473
265 Ga0105242_10218679 3300009176 Unclassified 1701
266 Ga0105242_10291339 3300009176 Bacteria 1486
267 Ga0105248_10004360 3300009177 Bacteria 15654
268 Ga0105248_10007893 3300009177 Bacteria 11695
269 Ga0105248_10140865 3300009177 Bacteria 2720
270 Ga0105248_10264453 3300009177 Bacteria 1936
271 Ga0105248_10549721 3300009177 Bacteria 1302
272 Ga0105248_10555718 3300009177 Bacteria 1295
273 Ga0105248_10960336 3300009177 Unclassified 965
274 Ga0105248_11579756 3300009177 Bacteria 743
275 Ga0105237_10000493 3300009545 Bacteria 55867
276 Ga0105237_10234704 3300009545 Bacteria 1835
277 Ga0105238_10068907 3300009551 Bacteria 3538
278 Ga0105238_11285911 3300009551 Unclassified 757
279 Ga0105249_10058097 3300009553 Bacteria 3545
280 Ga0105249_10115656 3300009553 Bacteria 2542
281 Ga0105249_10411578 3300009553 Bacteria 1384
282 Ga0105249_10534177 3300009553 Bacteria 1222
283 Ga0105239_10148439 3300010375 Bacteria 2616
284 Ga0105239_10293244 3300010375 Bacteria 1832
285 Ga0105246_10044375 3300011119 Bacteria 3021
286 Ga0105246_10364891 3300011119 Unclassified 1188
287 Ga0105246_10436964 3300011119 Bacteria 1096
288 Ga0157373_10026425 3300013100 Bacteria 4193
289 Ga0157373_10326256 3300013100 Bacteria 1092
290 Ga0157373_10627553 3300013100 Unclassified 784
291 Ga0157374_10016683 3300013296 Bacteria 6460
292 Ga0157374_10303726 3300013296 Bacteria 1579
293 Ga0157378_10021417 3300013297 Bacteria 5684
294 Ga0157378_10330355 3300013297 Unclassified 1484
295 Ga0157378_10468303 3300013297 Bacteria 1253
296 Ga0157378_10552401 3300013297 Bacteria 1157
297 Ga0157378_10639326 3300013297 Bacteria 1079
298 Ga0157378_10721132 3300013297 Unclassified 1018
299 Ga0163162_10016677 3300013306 Bacteria 7180
300 Ga0163162_10045148 3300013306 Bacteria 4414
301 Ga0163162_10405328 3300013306 Bacteria 1496
302 Ga0163162_11070459 3300013306 Unclassified 913
303 Ga0157372_10668734 3300013307 Bacteria 1209
304 Ga0157375_10095946 3300013308 Bacteria 3037
305 Ga0157375_10171749 3300013308 Unclassified 2316
306 Ga0157375_10416013 3300013308 Bacteria 1510
307 Ga0163163_10000370 3300014325 Bacteria 43137
308 Ga0163163_10018513 3300014325 Bacteria 6523
309 Ga0163163_10064973 3300014325 Bacteria 3621
310 Ga0163163_10067602 3300014325 Bacteria 3553
311 Ga0163163_10111276 3300014325 Bacteria 2767
312 Ga0163163_10345186 3300014325 Bacteria 1544
313 Ga0163163_10683340 3300014325 Bacteria 1090
314 Ga0163163_10742890 3300014325 Unclassified 1045
315 Ga0163163_11271763 3300014325 Unclassified 798
316 Ga0157380_10052238 3300014326 Bacteria 3235
317 Ga0157380_10156565 3300014326 Bacteria 1975
318 Ga0157380_11883945 3300014326 Unclassified 658
319 Ga0157377_10011915 3300014745 Bacteria 4356
320 Ga0157377_10176286 3300014745 Bacteria 1341
321 Ga0157377_10208524 3300014745 Bacteria 1245
322 Ga0157379_10073779 3300014968 Bacteria 3054
323 Ga0157379_10234479 3300014968 Bacteria 1664
324 Ga0157379_10260736 3300014968 Bacteria 1575
325 Ga0157376_10156884 3300014969 Unclassified 2059
326 Ga0157376_10415964 3300014969 Unclassified 1303
327 Ga0163161_10005470 3300017792 Bacteria 8819
328 Ga0207697_10005719 3300025315 Bacteria 5732
329 Ga0207697_10079652 3300025315 Unclassified 1380
330 Ga0207656_10035367 3300025321 Bacteria 2091
331 Ga0207713_1177381 3300025735 Unclassified 668
332 Ga0207653_10020355 3300025885 Bacteria 2099
333 Ga0207642_10398361 3300025899 Unclassified 823
334 Ga0207710_10160707 3300025900 Bacteria 1094
335 Ga0207680_10024709 3300025903 Bacteria 3302
336 Ga0207680_10150600 3300025903 Bacteria 1551
337 Ga0207647_10045045 3300025904 Bacteria 2754
338 Ga0207647_10128399 3300025904 Bacteria 1491
339 Ga0207643_10002029 3300025908 Bacteria 11178
340 Ga0207643_10021356 3300025908 Bacteria 3555
341 Ga0207643_10150738 3300025908 Bacteria 1394
342 Ga0207684_10000023 3300025910 Bacteria 334838
343 Ga0207684_10098678 3300025910 Bacteria 2495
344 Ga0207684_10475372 3300025910 Bacteria 1072
345 Ga0207654_10118069 3300025911 Bacteria 1661
346 Ga0207654_10264503 3300025911 Unclassified 1158
347 Ga0207707_10001036 3300025912 Bacteria 26610
348 Ga0207707_10383026 3300025912 Bacteria 1209
349 Ga0207695_10235387 3300025913 Bacteria 1734
350 Ga0207695_10465874 3300025913 Bacteria 1146
351 Ga0207671_10035976 3300025914 Bacteria 3672
352 Ga0207671_10153990 3300025914 Bacteria 1777
353 Ga0207662_10059937 3300025918 Bacteria 2282
354 Ga0207652_10000943 3300025921 Bacteria 27345
355 Ga0207646_10068866 3300025922 Bacteria 3161
356 Ga0207681_10032781 3300025923 Bacteria 3403
357 Ga0207694_10004263 3300025924 Bacteria 11194
358 Ga0207694_10042233 3300025924 Bacteria 3517
359 Ga0207650_10000001 3300025925 Bacteria 1545726
360 Ga0207650_10012318 3300025925 Bacteria 5902
361 Ga0207650_10121214 3300025925 Bacteria 2036
362 Ga0207650_10379388 3300025925 Bacteria 1167
363 Ga0207650_10420984 3300025925 Bacteria 1108
364 Ga0207659_11138040 3300025926 Unclassified 671
365 Ga0207687_10334212 3300025927 Unclassified 1230
366 Ga0207690_10040150 3300025932 Bacteria 3058
367 Ga0207690_10936900 3300025932 Unclassified 719
368 Ga0207686_10215696 3300025934 Bacteria 1382
369 Ga0207686_10223422 3300025934 Unclassified 1361
370 Ga0207709_10006205 3300025935 Bacteria 6730
371 Ga0207670_10000739 3300025936 Bacteria 17122
372 Ga0207670_10057268 3300025936 Bacteria 2643
373 Ga0207670_10451579 3300025936 Bacteria 1036
374 Ga0207704_10023778 3300025938 Bacteria 3309
375 Ga0207704_10078961 3300025938 Bacteria 2119
376 Ga0207704_10156986 3300025938 Bacteria 1614
377 Ga0207704_10392568 3300025938 Bacteria 1093
378 Ga0207665_10401724 3300025939 Bacteria 1044
379 Ga0207691_10001943 3300025940 Bacteria 20178
380 Ga0207711_10001428 3300025941 Bacteria 22372
381 Ga0207711_10051884 3300025941 Bacteria 3514
382 Ga0207711_10240348 3300025941 Unclassified 1660
383 Ga0207689_10006216 3300025942 Bacteria 10577
384 Ga0207689_10041884 3300025942 Bacteria 3789
385 Ga0207689_10167730 3300025942 Bacteria 1809
386 Ga0207689_10532365 3300025942 Bacteria 986
387 Ga0207689_10682199 3300025942 Bacteria 866
388 Ga0207689_10727972 3300025942 Unclassified 837
389 Ga0207661_10228040 3300025944 Bacteria 1649
390 Ga0207679_10060891 3300025945 Bacteria 2807
391 Ga0207679_10233126 3300025945 Bacteria 1555
392 Ga0207679_10248145 3300025945 Bacteria 1512
393 Ga0207679_11146766 3300025945 Bacteria 713
394 Ga0207667_10308491 3300025949 Bacteria 1616
395 Ga0207651_10122035 3300025960 Bacteria 1978
396 Ga0207651_11191069 3300025960 Bacteria 684
397 Ga0207712_10009399 3300025961 Bacteria 6186
398 Ga0207712_10072508 3300025961 Bacteria 2480
399 Ga0207712_10259507 3300025961 Bacteria 1409
400 Ga0207640_10624123 3300025981 Bacteria 915
401 Ga0207658_10266441 3300025986 Bacteria 1462
402 Ga0207658_10504280 3300025986 Bacteria 1078
403 Ga0207677_10428016 3300026023 Bacteria 1129
404 Ga0207677_10789443 3300026023 Unclassified 849
405 Ga0207703_10041369 3300026035 Bacteria 3692
406 Ga0207703_10241084 3300026035 Unclassified 1625
407 Ga0207703_10289968 3300026035 Unclassified 1489
408 Ga0207703_10485870 3300026035 Bacteria 1157
409 Ga0207703_10747338 3300026035 Bacteria 932
410 Ga0207703_10836921 3300026035 Bacteria 880
411 Ga0207639_10132389 3300026041 Unclassified 2066
412 Ga0207639_10455143 3300026041 Unclassified 1162
413 Ga0207639_10567729 3300026041 Bacteria 1043
414 Ga0207708_10000140 3300026075 Bacteria 57251
415 Ga0207708_10164692 3300026075 Bacteria 1753
416 Ga0207708_10168452 3300026075 Bacteria 1733
417 Ga0207708_10399409 3300026075 Bacteria 1136
418 Ga0207708_10486588 3300026075 Bacteria 1032
419 Ga0207708_10585532 3300026075 Unclassified 944
420 Ga0207702_10042148 3300026078 Bacteria 3828
421 Ga0207641_10103330 3300026088 Bacteria 2514
422 Ga0207641_10126598 3300026088 Bacteria 2288
423 Ga0207641_10200234 3300026088 Bacteria 1840
424 Ga0207641_10666460 3300026088 Bacteria 1023
425 Ga0207641_10710294 3300026088 Unclassified 990
426 Ga0207641_11609116 3300026088 Unclassified 651
427 Ga0207648_10009734 3300026089 Bacteria 9189
428 Ga0207648_10022864 3300026089 Bacteria 5608
429 Ga0207648_10039086 3300026089 Bacteria 4172
430 Ga0207648_10096298 3300026089 Bacteria 2590
431 Ga0207648_10717251 3300026089 Unclassified 927
432 Ga0207648_10838047 3300026089 Bacteria 857
433 Ga0207676_10017552 3300026095 Bacteria 5188
434 Ga0207676_10230824 3300026095 Bacteria 1654
435 Ga0207676_10312870 3300026095 Bacteria 1438
436 Ga0207676_10376934 3300026095 Bacteria 1319
437 Ga0207676_10747369 3300026095 Bacteria 951
438 Ga0207676_11176362 3300026095 Bacteria 759
439 Ga0207674_10061657 3300026116 Bacteria 3788
440 Ga0207674_10078398 3300026116 Bacteria 3308
441 Ga0207674_10113299 3300026116 Bacteria 2685
442 Ga0207675_100033069 3300026118 Bacteria 4818
443 Ga0207675_100054768 3300026118 Bacteria 3721
444 Ga0207675_100117253 3300026118 Bacteria 2517
445 Ga0207675_101046817 3300026118 Bacteria 835
446 Ga0207683_10036699 3300026121 Bacteria 4269
447 Ga0207698_10475436 3300026142 Bacteria 1211
448 Ga0207698_10495746 3300026142 Bacteria 1188
449 Ga0207698_10512179 3300026142 Bacteria 1169
450 Ga0207428_10007525 3300027907 Bacteria 9923
451 Ga0268266_10161429 3300028379 Bacteria 2028
452 Ga0268265_10219426 3300028380 Bacteria 1663
453 Ga0268264_10075755 3300028381 Bacteria 2861
454 Ga0268264_10093813 3300028381 Bacteria 2594
455 Ga0268264_10174541 3300028381 Bacteria 1947
456 Ga0268264_10218085 3300028381 Bacteria 1755
457 Ga0268264_10389951 3300028381 Bacteria 1336
458 Ga0268264_10546826 3300028381 Bacteria 1135
459 Ga0268264_10891537 3300028381 Bacteria 892
460 Ga0268264_11735397 3300028381 Unclassified 635
461 Ga0307408_100163353 3300031548 Bacteria 1771
462 Ga0307408_100596244 3300031548 Bacteria 981
463 Ga0307405_10024825 3300031731 Bacteria 3431
464 Ga0307413_10329590 3300031824 Bacteria 1170
465 Ga0307410_10329289 3300031852 Bacteria 1214
466 Ga0307406_10028124 3300031901 Bacteria 3394
467 Ga0307407_10017780 3300031903 Bacteria 3578
468 Ga0307412_10005292 3300031911 Bacteria 7242
469 Ga0307412_10808277 3300031911 Bacteria 814
470 Ga0307409_100506344 3300031995 Bacteria 1177
471 Ga0307409_100819183 3300031995 Bacteria 940
472 Ga0307416_100081956 3300032002 Bacteria 2730
473 Ga0307416_100383881 3300032002 Bacteria 1436
474 Ga0307414_10026678 3300032004 Bacteria 3721
475 Ga0307414_10311497 3300032004 Bacteria 1336
476 Ga0307411_10025971 3300032005 Bacteria 3518
477 Ga0307411_10368797 3300032005 Bacteria 1177
478 Ga0307415_100008088 3300032126 Bacteria 5807
479 Ga0307415_100060688 3300032126 Bacteria 2614
480 Ga0307415_100135561 3300032126 Bacteria 1872
481 Ga0373951_0003431 3300035091 Bacteria 3845
482 Ga0373939_0111069 3300035114 Bacteria 955
483 Ga0373941_0014620 3300035115 Bacteria 2101
484 Ga0373962_0102974 3300035242 Bacteria 893
485 Ga0373931_0059035 3300035691 Bacteria 2062
486 Ga0395899_0052513 3300037312 Bacteria 3021
487 Ga0395900_0103746 3300037418 Bacteria 2921
488 Ga0395898_0365633 3300037466 Bacteria 1376
489 Ga0395905_0544482 3300037471 Bacteria 1062
490 Ga0395901_0180080 3300038443 Bacteria 2217
491 Ga0395901_0291940 3300038443 Bacteria 1692
492 Ga0242419_011686 3300038698 Unclassified 680
493 Ga0242422_02138 3300038699 Bacteria 1345
494 Ga0242420_004715 3300038996 Bacteria 2075
495 Ga0439455_0020777 3300042012 Bacteria 1559
496 Ga0453683_0528051 3300044673 Bacteria 767
497 Ga0495580_0129312 3300046472 Bacteria 1752
498 Ga0495582_0082525 3300046473 Bacteria 1786
499 Ga0496103_0208981 3300048906 Bacteria 1255
500 Ga0496104_1071784 3300048907 Unclassified 709
501 Ga0496106_0025710 3300048909 Bacteria 4383
502 Ga0496106_0194929 3300048909 Bacteria 1611
503 Ga0496107_0032476 3300048910 Bacteria 3731
504 Ga0496107_0466157 3300048910 Bacteria 938
505 Ga0496108_0194631 3300048911 Bacteria 1758
506 Ga0496112_0213016 3300048915 Bacteria 1889
507 Ga0496112_0278980 3300048915 Bacteria 1619
508 Ga0496112_0709712 3300048915 Bacteria 933
509 Ga0496113_0159773 3300048916 Bacteria 1781
510 Ga0496113_0222063 3300048916 Bacteria 1506
511 Ga0496113_0378666 3300048916 Bacteria 1136
512 Ga0501292_002892 3300049515 Bacteria 2249
513 Ga0501296_004970 3300049519 Bacteria 1468
514 Ga0501296_020531 3300049519 Bacteria 842
515 Ga0501298_008144 3300049521 Bacteria 1753
516 Ga0501298_096973 3300049521 Bacteria 668
517 Ga0501038_0000099 3300049574 Bacteria 73289
518 Ga0501198_004592 3300049649 Bacteria 1921
519 Ga0501199_042717 3300049650 Bacteria 592
520 Ga0501202_015714 3300049652 Bacteria 1461
521 Ga0501202_021829 3300049652 Bacteria 1283
522 Ga0501206_066857 3300049653 Unclassified 601
523 Ga0501207_000534 3300049654 Bacteria 4327
524 Ga0501209_002166 3300049656 Bacteria 2958
525 Ga0501216_002714 3300049660 Bacteria 2535
526 Ga0501217_002698 3300049661 Unclassified 3520
527 Ga0501217_008494 3300049661 Bacteria 2219
528 Ga0501223_003230 3300049663 Bacteria 3564
529 Ga0501230_028232 3300049667 Bacteria 1030
530 Ga0501233_000433 3300049668 Bacteria 6608
531 Ga0501233_003716 3300049668 Bacteria 2758
532 Ga0501235_010923 3300049669 Bacteria 1987
533 Ga0501235_017463 3300049669 Bacteria 1588
534 Ga0501235_088213 3300049669 Bacteria 747
535 Ga0501236_002888 3300049670 Bacteria 1989
536 Ga0501240_023597 3300049673 Bacteria 944
537 Ga0501243_005070 3300049675 Bacteria 1978
538 Ga0501247_024300 3300049677 Bacteria 801
539 Ga0501249_120396 3300049679 Unclassified 640
540 Ga0501250_033750 3300049680 Bacteria 722
541 Ga0501255_007148 3300049684 Bacteria 1175
542 Ga0501257_086846 3300049686 Bacteria 811
543 Ga0501221_011611 3300049704 Bacteria 1589
544 Ga0501225_0002382 3300049705 Bacteria 5803
545 Ga0501225_0029769 3300049705 Bacteria 1501
546 Ga0501225_0062476 3300049705 Bacteria 1049
547 Ga0501229_034061 3300049706 Bacteria 707
548 Ga0501234_017815 3300049707 Unclassified 1124
549 Ga0501245_015852 3300049708 Bacteria 1137
550 Ga0501268_017739 3300049765 Bacteria 1190
551 Ga0501273_008412 3300049770 Bacteria 1236
552 Ga0501279_021664 3300049775 Bacteria 919
553 Ga0501283_049353 3300049779 Unclassified 743
554 Ga0501212_008375 3300049851 Bacteria 1437
555 Ga0501212_011943 3300049851 Bacteria 1257
556 Ga0501226_003411 3300049853 Bacteria 1884
557 nmdc:mga05p37_142871_c1 3300050507 Bacteria 2931
558 nmdc:mga05p37_183096_c1 3300050507 Bacteria 2548
559 nmdc:mga05p37_266604_c1 3300050507 Bacteria 2048
560 nmdc:mga05p37_289491_c1 3300050507 Bacteria 1950
561 nmdc:mga09592_356306_c1 3300050508 Bacteria 1266
562 nmdc:mga09592_38848_c1 3300050508 Bacteria 3996
563 nmdc:mga09592_64090_c1 3300050508 Bacteria 3111
564 nmdc:mga06r32_142251_c1 3300050510 Bacteria 2376
565 nmdc:mga06r32_356967_c1 3300050510 Bacteria 1446
566 nmdc:mga08y16_2690_c1 3300050511 Bacteria 18250
567 nmdc:mga0n895_294606_c1 3300050512 Bacteria 1645
568 nmdc:mga0n895_693436_c1 3300050512 Bacteria 1015
569 nmdc:mga0n895_811104_c1 3300050512 Bacteria 926
570 nmdc:mga0n895_848239_c1 3300050512 Bacteria 902
571 nmdc:mga0rr50_118283_c1 3300050513 Bacteria 2105
572 nmdc:mga0rr50_157801_c1 3300050513 Bacteria 1839
573 nmdc:mga0rr50_225862_c1 3300050513 Bacteria 1548
574 nmdc:mga08x19_5028_c1 3300050514 Bacteria 7821
575 nmdc:mga0a205_1141683_c1 3300050515 Bacteria 627
576 nmdc:mga0a205_185636_c1 3300050515 Bacteria 1972
577 nmdc:mga0a205_23830_c1 3300050515 Bacteria 5808
578 nmdc:mga0a205_240551_c1 3300050515 Bacteria 1691
579 nmdc:mga0a205_272774_c1 3300050515 Bacteria 1568
580 nmdc:mga0a205_31376_c1 3300050515 Unclassified 2434
581 nmdc:mga0a205_338580_c1 3300050515 Bacteria 1373
582 nmdc:mga0a205_344441_c1 3300050515 Bacteria 1359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005840 Ga0068870_10029521 Ga0068870_100295212 133
2 3300009147 Ga0114129_10009410 Ga0114129_100094109 148
3 3300050507 nmdc:mga05p37_266604_c1 nmdc:mga05p37_266604_c1_224_778 148
4 3300049521 Ga0501298_008144 Ga0501298_008144_61_576 149
5 3300049661 Ga0501217_002698 Ga0501217_002698_113_628 149
6 3300049669 Ga0501235_017463 Ga0501235_017463_863_1378 149
7 3300049707 Ga0501234_017815 Ga0501234_017815_452_967 149
8 3300049770 Ga0501273_008412 Ga0501273_008412_147_662 149
9 3300005290 Ga0065712_10001844 Ga0065712_100018447 155
10 3300005330 Ga0070690_100061012 Ga0070690_1000610122 155
11 3300005334 Ga0068869_100172689 Ga0068869_1001726892 155
12 3300005335 Ga0070666_10059019 Ga0070666_100590192 155
13 3300005338 Ga0068868_100038834 Ga0068868_1000388342 155
14 3300005340 Ga0070689_100126120 Ga0070689_1001261201 155
15 3300005343 Ga0070687_100014601 Ga0070687_1000146012 155
16 3300005353 Ga0070669_100009868 Ga0070669_1000098681 155
17 3300005355 Ga0070671_100012540 Ga0070671_1000125403 155
18 3300005364 Ga0070673_100298199 Ga0070673_1002981992 155
19 3300005438 Ga0070701_10230768 Ga0070701_102307682 155
20 3300005441 Ga0070700_100504956 Ga0070700_1005049562 155
21 3300005444 Ga0070694_100284992 Ga0070694_1002849922 155
22 3300005457 Ga0070662_100157288 Ga0070662_1001572882 155
23 3300005543 Ga0070672_100073998 Ga0070672_1000739982 155
24 3300005544 Ga0070686_100010079 Ga0070686_1000100792 155
25 3300005618 Ga0068864_100411106 Ga0068864_1004111062 155
26 3300005718 Ga0068866_10074576 Ga0068866_100745762 155
27 3300005840 Ga0068870_10015396 Ga0068870_100153963 155
28 3300005841 Ga0068863_100027152 Ga0068863_1000271524 155
29 3300005842 Ga0068858_100178319 Ga0068858_1001783192 155
30 3300005843 Ga0068860_100031693 Ga0068860_1000316932 155
31 3300006237 Ga0097621_100607102 Ga0097621_1006071021 155
32 3300006358 Ga0068871_100411190 Ga0068871_1004111902 155
33 3300006881 Ga0068865_100013078 Ga0068865_1000130784 155
34 3300009098 Ga0105245_10173641 Ga0105245_101736412 155
35 3300009148 Ga0105243_10015747 Ga0105243_100157472 155
36 3300009174 Ga0105241_10130528 Ga0105241_101305282 155
37 3300009176 Ga0105242_10218679 Ga0105242_102186792 155
38 3300009177 Ga0105248_10555718 Ga0105248_105557182 155
39 3300009553 Ga0105249_10411578 Ga0105249_104115782 155
40 3300010375 Ga0105239_10148439 Ga0105239_101484392 155
41 3300013100 Ga0157373_10627553 Ga0157373_106275532 155
42 3300013297 Ga0157378_10721132 Ga0157378_107211321 155
43 3300014325 Ga0163163_10683340 Ga0163163_106833401 155
44 3300014326 Ga0157380_10052238 Ga0157380_100522382 155
45 3300014745 Ga0157377_10011915 Ga0157377_100119154 155
46 3300017792 Ga0163161_10005470 Ga0163161_100054706 155
47 3300025315 Ga0207697_10005719 Ga0207697_100057194 155
48 3300025899 Ga0207642_10398361 Ga0207642_103983611 155
49 3300025903 Ga0207680_10024709 Ga0207680_100247092 155
50 3300025908 Ga0207643_10021356 Ga0207643_100213562 155
51 3300025911 Ga0207654_10264503 Ga0207654_102645032 155
52 3300025926 Ga0207659_11138040 Ga0207659_111380401 155
53 3300025927 Ga0207687_10334212 Ga0207687_103342122 155
54 3300025934 Ga0207686_10223422 Ga0207686_102234221 155
55 3300025936 Ga0207670_10057268 Ga0207670_100572682 155
56 3300025938 Ga0207704_10023778 Ga0207704_100237782 155
57 3300025940 Ga0207691_10001943 Ga0207691_100019435 155
58 3300025941 Ga0207711_10240348 Ga0207711_102403483 155
59 3300025942 Ga0207689_10006216 Ga0207689_100062166 155
60 3300025961 Ga0207712_10259507 Ga0207712_102595072 155
61 3300025986 Ga0207658_10266441 Ga0207658_102664412 155
62 3300026023 Ga0207677_10789443 Ga0207677_107894431 155
63 3300026088 Ga0207641_11609116 Ga0207641_116091162 155
64 3300026089 Ga0207648_10009734 Ga0207648_100097343 155
65 3300026095 Ga0207676_10376934 Ga0207676_103769342 155
66 3300026118 Ga0207675_100033069 Ga0207675_1000330693 155
67 3300028381 Ga0268264_10075755 Ga0268264_100757552 155
68 3300005471 Ga0070698_100356291 Ga0070698_1003562912 156
69 3300026088 Ga0207641_10710294 Ga0207641_107102941 156
70 3300005563 Ga0068855_100488940 Ga0068855_1004889402 157
71 3300005444 Ga0070694_100073419 Ga0070694_1000734193 158
72 3300005539 Ga0068853_100294347 Ga0068853_1002943472 158
73 3300005614 Ga0068856_100230984 Ga0068856_1002309841 158
74 3300009148 Ga0105243_10743712 Ga0105243_107437122 158
75 3300026041 Ga0207639_10567729 Ga0207639_105677292 158
76 3300026078 Ga0207702_10042148 Ga0207702_100421482 158
77 3300048910 Ga0496107_0466157 Ga0496107_0466157_309_863 158
78 2162886012 MBSR1b_contig_7380138 MBSR1b_0489.00005060 160
79 3300005334 Ga0068869_100005198 Ga0068869_1000051982 160
80 3300005338 Ga0068868_100087824 Ga0068868_1000878242 160
81 3300005340 Ga0070689_100553875 Ga0070689_1005538752 160
82 3300005353 Ga0070669_100754093 Ga0070669_1007540932 160
83 3300005367 Ga0070667_100067800 Ga0070667_1000678002 160
84 3300005456 Ga0070678_100125384 Ga0070678_1001253842 160
85 3300005545 Ga0070695_100411714 Ga0070695_1004117142 160
86 3300005548 Ga0070665_100382337 Ga0070665_1003823372 160
87 3300005564 Ga0070664_100384455 Ga0070664_1003844552 160
88 3300005615 Ga0070702_100669083 Ga0070702_1006690831 160
89 3300005617 Ga0068859_100006782 Ga0068859_1000067824 160
90 3300005618 Ga0068864_100008974 Ga0068864_1000089744 160
91 3300005842 Ga0068858_100033679 Ga0068858_1000336795 160
92 3300005843 Ga0068860_100247242 Ga0068860_1002472422 160
93 3300006237 Ga0097621_100006102 Ga0097621_1000061027 160
94 3300006358 Ga0068871_100019457 Ga0068871_1000194572 160
95 3300006931 Ga0097620_100006783 Ga0097620_1000067834 160
96 3300009093 Ga0105240_10436121 Ga0105240_104361212 160
97 3300009176 Ga0105242_10098469 Ga0105242_100984692 160
98 3300009177 Ga0105248_10007893 Ga0105248_100078935 160
99 3300009553 Ga0105249_10115656 Ga0105249_101156563 160
100 3300009553 Ga0105249_10534177 Ga0105249_105341772 160
101 3300013296 Ga0157374_10016683 Ga0157374_100166833 160
102 3300013297 Ga0157378_10021417 Ga0157378_100214174 160
103 3300013306 Ga0163162_10045148 Ga0163162_100451483 160
104 3300013308 Ga0157375_10095946 Ga0157375_100959462 160
105 3300014325 Ga0163163_10067602 Ga0163163_100676022 160
106 3300014969 Ga0157376_10415964 Ga0157376_104159642 160
107 3300025315 Ga0207697_10079652 Ga0207697_100796522 160
108 3300025903 Ga0207680_10150600 Ga0207680_101506002 160
109 3300025913 Ga0207695_10235387 Ga0207695_102353872 160
110 3300025936 Ga0207670_10451579 Ga0207670_104515792 160
111 3300025941 Ga0207711_10051884 Ga0207711_100518842 160
112 3300025945 Ga0207679_10060891 Ga0207679_100608913 160
113 3300025961 Ga0207712_10072508 Ga0207712_100725082 160
114 3300025986 Ga0207658_10504280 Ga0207658_105042802 160
115 3300026035 Ga0207703_10041369 Ga0207703_100413694 160
116 3300026088 Ga0207641_10126598 Ga0207641_101265982 160
117 3300026089 Ga0207648_10022864 Ga0207648_100228642 160
118 3300026121 Ga0207683_10036699 Ga0207683_100366992 160
119 3300028379 Ga0268266_10161429 Ga0268266_101614292 160
120 3300028381 Ga0268264_10218085 Ga0268264_102180852 160
121 3300038443 Ga0395901_0291940 Ga0395901_0291940_510_1058 160
122 3300038996 Ga0242420_004715 Ga0242420_004715_137_691 160
123 3300048907 Ga0496104_1071784 Ga0496104_1071784_64_612 160
124 3300048915 Ga0496112_0278980 Ga0496112_0278980_459_1007 160
125 3300050512 nmdc:mga0n895_294606_c1 nmdc:mga0n895_294606_c1_114_668 160
126 3300050513 nmdc:mga0rr50_157801_c1 nmdc:mga0rr50_157801_c1_544_1098 160
127 3300050515 nmdc:mga0a205_31376_c1 nmdc:mga0a205_31376_c1_56_610 160
128 3300009147 Ga0114129_10717593 Ga0114129_107175932 161
129 3300005617 Ga0068859_100465498 Ga0068859_1004654982 162
130 3300006931 Ga0097620_100465489 Ga0097620_1004654892 162
131 3300014969 Ga0157376_10156884 Ga0157376_101568843 162
132 3300031548 Ga0307408_100163353 Ga0307408_1001633532 162
133 3300031731 Ga0307405_10024825 Ga0307405_100248253 162
134 3300031824 Ga0307413_10329590 Ga0307413_103295902 162
135 3300031903 Ga0307407_10017780 Ga0307407_100177803 162
136 3300031911 Ga0307412_10005292 Ga0307412_100052922 162
137 3300031995 Ga0307409_100506344 Ga0307409_1005063442 162
138 3300032002 Ga0307416_100081956 Ga0307416_1000819562 162
139 3300032126 Ga0307415_100008088 Ga0307415_1000080881 162
140 3300044673 Ga0453683_0528051 Ga0453683_0528051_242_742 162
141 3300005355 Ga0070671_101095092 Ga0070671_1010950921 163
142 3300005549 Ga0070704_100175746 Ga0070704_1001757463 163
143 3300014325 Ga0163163_10064973 Ga0163163_100649732 163
144 3300046472 Ga0495580_0129312 Ga0495580_0129312_762_1307 163
145 3300046473 Ga0495582_0082525 Ga0495582_0082525_258_803 163
146 3300050515 nmdc:mga0a205_1141683_c1 nmdc:mga0a205_1141683_c1_17_511 163
147 3300013297 Ga0157378_10468303 Ga0157378_104683032 164
148 3300013308 Ga0157375_10171749 Ga0157375_101717493 164
149 3300050512 nmdc:mga0n895_848239_c1 nmdc:mga0n895_848239_c1_18_521 164
150 3300005844 Ga0068862_100628517 Ga0068862_1006285172 165
151 3300009147 Ga0114129_10074746 Ga0114129_100747464 165
152 3300009177 Ga0105248_10549721 Ga0105248_105497211 165
153 3300014745 Ga0157377_10208524 Ga0157377_102085242 165
154 3300026116 Ga0207674_10078398 Ga0207674_100783982 165
155 3300031548 Ga0307408_100596244 Ga0307408_1005962442 165
156 3300031852 Ga0307410_10329289 Ga0307410_103292891 165
157 3300031995 Ga0307409_100819183 Ga0307409_1008191831 165
158 3300032002 Ga0307416_100383881 Ga0307416_1003838812 165
159 3300032004 Ga0307414_10311497 Ga0307414_103114972 165
160 3300032005 Ga0307411_10368797 Ga0307411_103687972 165
161 3300032126 Ga0307415_100135561 Ga0307415_1001355612 165
162 3300048916 Ga0496113_0159773 Ga0496113_0159773_142_645 165
163 3300049515 Ga0501292_002892 Ga0501292_002892_1193_1699 165
164 3300049519 Ga0501296_004970 Ga0501296_004970_908_1414 165
165 3300049521 Ga0501298_096973 Ga0501298_096973_12_518 165
166 3300049652 Ga0501202_015714 Ga0501202_015714_259_765 165
167 3300049667 Ga0501230_028232 Ga0501230_028232_94_600 165
168 3300049669 Ga0501235_088213 Ga0501235_088213_105_611 165
169 3300049677 Ga0501247_024300 Ga0501247_024300_248_754 165
170 3300049680 Ga0501250_033750 Ga0501250_033750_195_698 165
171 3300049684 Ga0501255_007148 Ga0501255_007148_463_969 165
172 3300049686 Ga0501257_086846 Ga0501257_086846_298_801 165
173 3300049765 Ga0501268_017739 Ga0501268_017739_671_1177 165
174 3300049775 Ga0501279_021664 Ga0501279_021664_63_569 165
175 3300049851 Ga0501212_008375 Ga0501212_008375_63_569 165
176 3300050507 nmdc:mga05p37_289491_c1 nmdc:mga05p37_289491_c1_1048_1596 165
177 3300037312 Ga0395899_0052513 Ga0395899_0052513_1450_1959 166
178 3300037471 Ga0395905_0544482 Ga0395905_0544482_171_680 166
179 3300038443 Ga0395901_0180080 Ga0395901_0180080_1268_1777 166
180 3300005617 Ga0068859_100522608 Ga0068859_1005226082 167
181 3300006931 Ga0097620_100522597 Ga0097620_1005225972 167
182 3300013100 Ga0157373_10026425 Ga0157373_100264252 168
183 3300005546 Ga0070696_100319553 Ga0070696_1003195532 169
184 3300006173 Ga0070716_100401135 Ga0070716_1004011351 170
185 3300025939 Ga0207665_10401724 Ga0207665_104017241 170
186 3300025981 Ga0207640_10624123 Ga0207640_106241231 170
187 3300009093 Ga0105240_10122683 Ga0105240_101226831 171
188 3300025913 Ga0207695_10465874 Ga0207695_104658741 171
189 3300005843 Ga0068860_102000107 Ga0068860_1020001071 172
190 3300009551 Ga0105238_11285911 Ga0105238_112859112 172
191 3300025924 Ga0207694_10042233 Ga0207694_100422332 172
192 3300026035 Ga0207703_10289968 Ga0207703_102899683 172
193 3300005331 Ga0070670_100087533 Ga0070670_1000875332 173
194 3300025925 Ga0207650_10012318 Ga0207650_100123182 173
195 3300005618 Ga0068864_100392145 Ga0068864_1003921451 174
196 3300013296 Ga0157374_10303726 Ga0157374_103037262 174
197 3300014325 Ga0163163_10018513 Ga0163163_100185134 174
198 3300026095 Ga0207676_10230824 Ga0207676_102308242 174
199 3300005336 Ga0070680_100018016 Ga0070680_1000180162 175
200 3300005444 Ga0070694_100695225 Ga0070694_1006952251 175
201 3300005458 Ga0070681_10070797 Ga0070681_100707972 175
202 3300005468 Ga0070707_100297125 Ga0070707_1002971253 175
203 3300005530 Ga0070679_100000416 Ga0070679_1000004164 175
204 3300005546 Ga0070696_100064723 Ga0070696_1000647232 175
205 3300005842 Ga0068858_100246525 Ga0068858_1002465252 175
206 3300006871 Ga0075434_100116445 Ga0075434_1001164452 175
207 3300007076 Ga0075435_100270354 Ga0075435_1002703542 175
208 3300011119 Ga0105246_10364891 Ga0105246_103648912 175
209 3300013297 Ga0157378_10330355 Ga0157378_103303552 175
210 3300025912 Ga0207707_10001036 Ga0207707_100010364 175
211 3300025921 Ga0207652_10000943 Ga0207652_100009437 175
212 3300026035 Ga0207703_10241084 Ga0207703_102410842 175
213 3300050512 nmdc:mga0n895_693436_c1 nmdc:mga0n895_693436_c1_273_827 175
214 3300050513 nmdc:mga0rr50_118283_c1 nmdc:mga0rr50_118283_c1_1241_1795 175
215 3300050515 nmdc:mga0a205_240551_c1 nmdc:mga0a205_240551_c1_362_916 175
216 3300005289 Ga0065704_10146127 Ga0065704_101461271 176
217 3300005295 Ga0065707_10191648 Ga0065707_101916481 176
218 3300005438 Ga0070701_10826611 Ga0070701_108266111 176
219 3300005444 Ga0070694_100652424 Ga0070694_1006524241 176
220 3300005445 Ga0070708_100000628 Ga0070708_1000006287 176
221 3300005467 Ga0070706_100037817 Ga0070706_1000378172 176
222 3300005468 Ga0070707_100012529 Ga0070707_1000125295 176
223 3300005471 Ga0070698_100005022 Ga0070698_1000050223 176
224 3300005518 Ga0070699_100003193 Ga0070699_10000319310 176
225 3300025910 Ga0207684_10098678 Ga0207684_100986782 176
226 3300025922 Ga0207646_10068866 Ga0207646_100688663 176
227 3300026075 Ga0207708_10486588 Ga0207708_104865881 176
228 3300026089 Ga0207648_10838047 Ga0207648_108380471 176
229 3300048915 Ga0496112_0709712 Ga0496112_0709712_321_869 176
230 3300005290 Ga0065712_10068489 Ga0065712_100684893 177
231 3300005295 Ga0065707_10146828 Ga0065707_101468283 177
232 3300005340 Ga0070689_100983901 Ga0070689_1009839012 177
233 3300005341 Ga0070691_10227598 Ga0070691_102275982 177
234 3300005343 Ga0070687_100323076 Ga0070687_1003230761 177
235 3300005344 Ga0070661_100670725 Ga0070661_1006707252 177
236 3300005353 Ga0070669_100068611 Ga0070669_1000686113 177
237 3300005364 Ga0070673_100373943 Ga0070673_1003739432 177
238 3300005364 Ga0070673_100639945 Ga0070673_1006399452 177
239 3300005440 Ga0070705_100590083 Ga0070705_1005900831 177
240 3300005441 Ga0070700_100317332 Ga0070700_1003173322 177
241 3300005444 Ga0070694_100024824 Ga0070694_1000248244 177
242 3300005459 Ga0068867_100984908 Ga0068867_1009849082 177
243 3300005471 Ga0070698_100052462 Ga0070698_1000524623 177
244 3300005471 Ga0070698_100168682 Ga0070698_1001686822 177
245 3300005518 Ga0070699_100239937 Ga0070699_1002399372 177
246 3300005536 Ga0070697_100600503 Ga0070697_1006005032 177
247 3300005545 Ga0070695_100053146 Ga0070695_1000531463 177
248 3300005545 Ga0070695_100278625 Ga0070695_1002786252 177
249 3300005547 Ga0070693_100104322 Ga0070693_1001043221 177
250 3300005577 Ga0068857_100552603 Ga0068857_1005526032 177
251 3300005615 Ga0070702_100502578 Ga0070702_1005025782 177
252 3300005616 Ga0068852_100493210 Ga0068852_1004932102 177
253 3300005617 Ga0068859_100283534 Ga0068859_1002835342 177
254 3300005617 Ga0068859_101047461 Ga0068859_1010474612 177
255 3300005617 Ga0068859_101061345 Ga0068859_1010613452 177
256 3300005617 Ga0068859_101167696 Ga0068859_1011676961 177
257 3300005617 Ga0068859_101715737 Ga0068859_1017157371 177
258 3300005618 Ga0068864_100477206 Ga0068864_1004772062 177
259 3300005618 Ga0068864_100884149 Ga0068864_1008841491 177
260 3300005719 Ga0068861_100001140 Ga0068861_1000011402 177
261 3300005840 Ga0068870_10355738 Ga0068870_103557382 177
262 3300005842 Ga0068858_100319494 Ga0068858_1003194942 177
263 3300005843 Ga0068860_100314692 Ga0068860_1003146922 177
264 3300005843 Ga0068860_100883385 Ga0068860_1008833852 177
265 3300005844 Ga0068862_100593392 Ga0068862_1005933922 177
266 3300006871 Ga0075434_100134127 Ga0075434_1001341273 177
267 3300006880 Ga0075429_100008105 Ga0075429_1000081053 177
268 3300006931 Ga0097620_100283526 Ga0097620_1002835263 177
269 3300006931 Ga0097620_101047518 Ga0097620_1010475182 177
270 3300006931 Ga0097620_101061383 Ga0097620_1010613832 177
271 3300006931 Ga0097620_101167776 Ga0097620_1011677762 177
272 3300006931 Ga0097620_101715683 Ga0097620_1017156832 177
273 3300009101 Ga0105247_10002738 Ga0105247_1000273811 177
274 3300009101 Ga0105247_10159266 Ga0105247_101592662 177
275 3300009148 Ga0105243_10329760 Ga0105243_103297602 177
276 3300009177 Ga0105248_10264453 Ga0105248_102644533 177
277 3300009177 Ga0105248_11579756 Ga0105248_115797562 177
278 3300009545 Ga0105237_10234704 Ga0105237_102347043 177
279 3300011119 Ga0105246_10044375 Ga0105246_100443752 177
280 3300013100 Ga0157373_10326256 Ga0157373_103262562 177
281 3300013297 Ga0157378_10639326 Ga0157378_106393262 177
282 3300013306 Ga0163162_10016677 Ga0163162_100166774 177
283 3300013306 Ga0163162_11070459 Ga0163162_110704592 177
284 3300014325 Ga0163163_10345186 Ga0163163_103451862 177
285 3300014326 Ga0157380_10156565 Ga0157380_101565652 177
286 3300014326 Ga0157380_11883945 Ga0157380_118839451 177
287 3300025735 Ga0207713_1177381 Ga0207713_11773812 177
288 3300025910 Ga0207684_10475372 Ga0207684_104753721 177
289 3300025923 Ga0207681_10032781 Ga0207681_100327812 177
290 3300025925 Ga0207650_10420984 Ga0207650_104209842 177
291 3300025934 Ga0207686_10215696 Ga0207686_102156962 177
292 3300025935 Ga0207709_10006205 Ga0207709_100062054 177
293 3300025938 Ga0207704_10392568 Ga0207704_103925682 177
294 3300025942 Ga0207689_10167730 Ga0207689_101677302 177
295 3300025945 Ga0207679_10233126 Ga0207679_102331262 177
296 3300025960 Ga0207651_11191069 Ga0207651_111910691 177
297 3300026035 Ga0207703_10836921 Ga0207703_108369211 177
298 3300026075 Ga0207708_10164692 Ga0207708_101646922 177
299 3300026089 Ga0207648_10039086 Ga0207648_100390863 177
300 3300026089 Ga0207648_10096298 Ga0207648_100962982 177
301 3300026089 Ga0207648_10717251 Ga0207648_107172512 177
302 3300026095 Ga0207676_10312870 Ga0207676_103128702 177
303 3300026095 Ga0207676_11176362 Ga0207676_111763621 177
304 3300026116 Ga0207674_10113299 Ga0207674_101132992 177
305 3300026118 Ga0207675_100054768 Ga0207675_1000547685 177
306 3300026142 Ga0207698_10475436 Ga0207698_104754362 177
307 3300028380 Ga0268265_10219426 Ga0268265_102194262 177
308 3300028381 Ga0268264_10174541 Ga0268264_101745412 177
309 3300028381 Ga0268264_10389951 Ga0268264_103899512 177
310 3300038698 Ga0242419_011686 Ga0242419_011686_61_603 177
311 3300048915 Ga0496112_0213016 Ga0496112_0213016_887_1429 177
312 3300049705 Ga0501225_0029769 Ga0501225_0029769_688_1230 177
313 3300050508 nmdc:mga09592_38848_c1 nmdc:mga09592_38848_c1_2067_2618 177
314 3300050512 nmdc:mga0n895_811104_c1 nmdc:mga0n895_811104_c1_183_728 177
315 3300050515 nmdc:mga0a205_185636_c1 nmdc:mga0a205_185636_c1_816_1355 177
316 3300050515 nmdc:mga0a205_344441_c1 nmdc:mga0a205_344441_c1_252_797 177
317 3300003203 JGI25406J46586_10012282 JGI25406J46586_100122824 178
318 3300005288 Ga0065714_10002185 Ga0065714_1000218543 178
319 3300005290 Ga0065712_10067739 Ga0065712_1006773941 178
320 3300005293 Ga0065715_10089805 Ga0065715_100898058 178
321 3300005293 Ga0065715_10273682 Ga0065715_102736822 178
322 3300005293 Ga0065715_10588096 Ga0065715_105880961 178
323 3300005295 Ga0065707_10242198 Ga0065707_102421982 178
324 3300005331 Ga0070670_100138258 Ga0070670_1001382583 178
325 3300005331 Ga0070670_100578441 Ga0070670_1005784412 178
326 3300005331 Ga0070670_100708423 Ga0070670_1007084231 178
327 3300005334 Ga0068869_100026623 Ga0068869_1000266235 178
328 3300005334 Ga0068869_101132007 Ga0068869_1011320071 178
329 3300005338 Ga0068868_100430732 Ga0068868_1004307322 178
330 3300005440 Ga0070705_100124090 Ga0070705_1001240902 178
331 3300005444 Ga0070694_101243222 Ga0070694_1012432221 178
332 3300005456 Ga0070678_100551954 Ga0070678_1005519542 178
333 3300005459 Ga0068867_100440475 Ga0068867_1004404751 178
334 3300005539 Ga0068853_100189169 Ga0068853_1001891692 178
335 3300005545 Ga0070695_100172454 Ga0070695_1001724542 178
336 3300005577 Ga0068857_100285099 Ga0068857_1002850992 178
337 3300005615 Ga0070702_100052515 Ga0070702_1000525153 178
338 3300005617 Ga0068859_100052889 Ga0068859_1000528893 178
339 3300005617 Ga0068859_100459113 Ga0068859_1004591132 178
340 3300005618 Ga0068864_100086094 Ga0068864_1000860942 178
341 3300005842 Ga0068858_100820463 Ga0068858_1008204632 178
342 3300005842 Ga0068858_101272494 Ga0068858_1012724942 178
343 3300005843 Ga0068860_100520207 Ga0068860_1005202072 178
344 3300005985 Ga0081539_10000067 Ga0081539_1000006735 178
345 3300006931 Ga0097620_100052882 Ga0097620_1000528823 178
346 3300006931 Ga0097620_100459112 Ga0097620_1004591122 178
347 3300009177 Ga0105248_10960336 Ga0105248_109603361 178
348 3300014968 Ga0157379_10234479 Ga0157379_102344792 178
349 3300014968 Ga0157379_10260736 Ga0157379_102607362 178
350 3300025904 Ga0207647_10045045 Ga0207647_100450453 178
351 3300025925 Ga0207650_10121214 Ga0207650_101212142 178
352 3300025925 Ga0207650_10379388 Ga0207650_103793882 178
353 3300025938 Ga0207704_10156986 Ga0207704_101569863 178
354 3300025942 Ga0207689_10041884 Ga0207689_100418842 178
355 3300025942 Ga0207689_10727972 Ga0207689_107279721 178
356 3300026035 Ga0207703_10747338 Ga0207703_107473381 178
357 3300026041 Ga0207639_10455143 Ga0207639_104551432 178
358 3300026075 Ga0207708_10168452 Ga0207708_101684522 178
359 3300026075 Ga0207708_10399409 Ga0207708_103994092 178
360 3300026095 Ga0207676_10747369 Ga0207676_107473692 178
361 3300026118 Ga0207675_101046817 Ga0207675_1010468171 178
362 3300026142 Ga0207698_10495746 Ga0207698_104957462 178
363 3300028381 Ga0268264_10546826 Ga0268264_105468262 178
364 3300028381 Ga0268264_11735397 Ga0268264_117353971 178
365 3300038699 Ga0242422_02138 Ga0242422_02138_138_683 178
366 3300048906 Ga0496103_0208981 Ga0496103_0208981_30_575 178
367 3300048909 Ga0496106_0194929 Ga0496106_0194929_18_563 178
368 3300048911 Ga0496108_0194631 Ga0496108_0194631_1172_1717 178
369 3300048916 Ga0496113_0222063 Ga0496113_0222063_562_1107 178
370 3300049574 Ga0501038_0000099 Ga0501038_0000099_23915_24475 178
371 3300005290 Ga0065712_10113835 Ga0065712_101138352 179
372 3300005293 Ga0065715_10206567 Ga0065715_102065672 179
373 3300005334 Ga0068869_100301572 Ga0068869_1003015722 179
374 3300005334 Ga0068869_100509321 Ga0068869_1005093212 179
375 3300005337 Ga0070682_100029163 Ga0070682_1000291635 179
376 3300005338 Ga0068868_100433771 Ga0068868_1004337712 179
377 3300005343 Ga0070687_100035076 Ga0070687_1000350762 179
378 3300005345 Ga0070692_10001576 Ga0070692_100015764 179
379 3300005345 Ga0070692_10016268 Ga0070692_100162682 179
380 3300005364 Ga0070673_100568394 Ga0070673_1005683942 179
381 3300005444 Ga0070694_100036538 Ga0070694_1000365382 179
382 3300005444 Ga0070694_100748229 Ga0070694_1007482291 179
383 3300005458 Ga0070681_10086972 Ga0070681_100869722 179
384 3300005458 Ga0070681_10198313 Ga0070681_101983132 179
385 3300005467 Ga0070706_101419261 Ga0070706_1014192611 179
386 3300005468 Ga0070707_100371596 Ga0070707_1003715962 179
387 3300005539 Ga0068853_100214425 Ga0068853_1002144252 179
388 3300005539 Ga0068853_100290946 Ga0068853_1002909462 179
389 3300005545 Ga0070695_100191594 Ga0070695_1001915942 179
390 3300005547 Ga0070693_100014568 Ga0070693_1000145682 179
391 3300005547 Ga0070693_100085317 Ga0070693_1000853172 179
392 3300005549 Ga0070704_100165508 Ga0070704_1001655082 179
393 3300005549 Ga0070704_100718022 Ga0070704_1007180222 179
394 3300005563 Ga0068855_100486321 Ga0068855_1004863212 179
395 3300005577 Ga0068857_100066162 Ga0068857_1000661622 179
396 3300005617 Ga0068859_100206625 Ga0068859_1002066252 179
397 3300005617 Ga0068859_100813281 Ga0068859_1008132811 179
398 3300005618 Ga0068864_100024680 Ga0068864_1000246802 179
399 3300005719 Ga0068861_100871465 Ga0068861_1008714652 179
400 3300005834 Ga0068851_10053357 Ga0068851_100533572 179
401 3300005840 Ga0068870_10040964 Ga0068870_100409642 179
402 3300005841 Ga0068863_100174220 Ga0068863_1001742202 179
403 3300005842 Ga0068858_100431730 Ga0068858_1004317302 179
404 3300005844 Ga0068862_100053405 Ga0068862_1000534053 179
405 3300005985 Ga0081539_10000600 Ga0081539_100006004 179
406 3300006847 Ga0075431_100022432 Ga0075431_1000224323 179
407 3300006871 Ga0075434_100221272 Ga0075434_1002212723 179
408 3300006931 Ga0097620_100206618 Ga0097620_1002066182 179
409 3300006931 Ga0097620_100813182 Ga0097620_1008131822 179
410 3300009101 Ga0105247_10367997 Ga0105247_103679972 179
411 3300009147 Ga0114129_11144286 Ga0114129_111442862 179
412 3300009147 Ga0114129_11642556 Ga0114129_116425561 179
413 3300009148 Ga0105243_10639591 Ga0105243_106395912 179
414 3300009174 Ga0105241_10874946 Ga0105241_108749461 179
415 3300009174 Ga0105241_11467665 Ga0105241_114676651 179
416 3300009177 Ga0105248_10140865 Ga0105248_101408653 179
417 3300009545 Ga0105237_10000493 Ga0105237_1000049330 179
418 3300009553 Ga0105249_10058097 Ga0105249_100580973 179
419 3300011119 Ga0105246_10436964 Ga0105246_104369642 179
420 3300013297 Ga0157378_10552401 Ga0157378_105524012 179
421 3300013306 Ga0163162_10405328 Ga0163162_104053282 179
422 3300013308 Ga0157375_10416013 Ga0157375_104160132 179
423 3300014325 Ga0163163_10111276 Ga0163163_101112762 179
424 3300014325 Ga0163163_11271763 Ga0163163_112717632 179
425 3300014745 Ga0157377_10176286 Ga0157377_101762861 179
426 3300014968 Ga0157379_10073779 Ga0157379_100737792 179
427 3300025321 Ga0207656_10035367 Ga0207656_100353672 179
428 3300025885 Ga0207653_10020355 Ga0207653_100203552 179
429 3300025904 Ga0207647_10128399 Ga0207647_101283992 179
430 3300025908 Ga0207643_10002029 Ga0207643_100020292 179
431 3300025912 Ga0207707_10383026 Ga0207707_103830262 179
432 3300025914 Ga0207671_10035976 Ga0207671_100359762 179
433 3300025914 Ga0207671_10153990 Ga0207671_101539902 179
434 3300025918 Ga0207662_10059937 Ga0207662_100599372 179
435 3300025932 Ga0207690_10936900 Ga0207690_109369001 179
436 3300025936 Ga0207670_10000739 Ga0207670_100007398 179
437 3300025938 Ga0207704_10078961 Ga0207704_100789613 179
438 3300025942 Ga0207689_10532365 Ga0207689_105323652 179
439 3300025942 Ga0207689_10682199 Ga0207689_106821992 179
440 3300025944 Ga0207661_10228040 Ga0207661_102280402 179
441 3300025945 Ga0207679_10248145 Ga0207679_102481452 179
442 3300025949 Ga0207667_10308491 Ga0207667_103084912 179
443 3300025960 Ga0207651_10122035 Ga0207651_101220352 179
444 3300025961 Ga0207712_10009399 Ga0207712_100093992 179
445 3300026035 Ga0207703_10485870 Ga0207703_104858702 179
446 3300026088 Ga0207641_10200234 Ga0207641_102002342 179
447 3300026095 Ga0207676_10017552 Ga0207676_100175525 179
448 3300026116 Ga0207674_10061657 Ga0207674_100616573 179
449 3300026118 Ga0207675_100117253 Ga0207675_1001172533 179
450 3300026142 Ga0207698_10512179 Ga0207698_105121792 179
451 3300028381 Ga0268264_10891537 Ga0268264_108915372 179
452 3300035242 Ga0373962_0102974 Ga0373962_0102974_141_689 179
453 3300037418 Ga0395900_0103746 Ga0395900_0103746_1272_1820 179
454 3300048909 Ga0496106_0025710 Ga0496106_0025710_2371_2922 179
455 3300048910 Ga0496107_0032476 Ga0496107_0032476_489_1040 179
456 3300048916 Ga0496113_0378666 Ga0496113_0378666_224_778 179
457 3300049653 Ga0501206_066857 Ga0501206_066857_46_591 179
458 3300049668 Ga0501233_003716 Ga0501233_003716_1772_2317 179
459 3300049673 Ga0501240_023597 Ga0501240_023597_71_616 179
460 3300049679 Ga0501249_120396 Ga0501249_120396_63_608 179
461 3300049705 Ga0501225_0062476 Ga0501225_0062476_123_668 179
462 3300049779 Ga0501283_049353 Ga0501283_049353_89_634 179
463 3300050508 nmdc:mga09592_64090_c1 nmdc:mga09592_64090_c1_601_1146 179
464 3300050510 nmdc:mga06r32_142251_c1 nmdc:mga06r32_142251_c1_1135_1680 179
465 3300050515 nmdc:mga0a205_272774_c1 nmdc:mga0a205_272774_c1_663_1214 179
466 3300002459 JGI24751J29686_10000057 JGI24751J29686_1000005741 180
467 3300005293 Ga0065715_10156764 Ga0065715_101567642 180
468 3300005331 Ga0070670_100000055 Ga0070670_10000005531 180
469 3300005337 Ga0070682_100024872 Ga0070682_1000248723 180
470 3300005345 Ga0070692_10438200 Ga0070692_104382002 180
471 3300005355 Ga0070671_100817391 Ga0070671_1008173911 180
472 3300005366 Ga0070659_100044476 Ga0070659_1000444763 180
473 3300005441 Ga0070700_100000539 Ga0070700_1000005393 180
474 3300005441 Ga0070700_100220464 Ga0070700_1002204642 180
475 3300005444 Ga0070694_100082604 Ga0070694_1000826043 180
476 3300005467 Ga0070706_100000126 Ga0070706_10000012648 180
477 3300005518 Ga0070699_100198495 Ga0070699_1001984952 180
478 3300005539 Ga0068853_100066846 Ga0068853_1000668462 180
479 3300005544 Ga0070686_101166213 Ga0070686_1011662131 180
480 3300005547 Ga0070693_100667922 Ga0070693_1006679221 180
481 3300005564 Ga0070664_101060872 Ga0070664_1010608722 180
482 3300005617 Ga0068859_100006814 Ga0068859_1000068146 180
483 3300005617 Ga0068859_100213919 Ga0068859_1002139192 180
484 3300005617 Ga0068859_101595725 Ga0068859_1015957252 180
485 3300006058 Ga0075432_10073999 Ga0075432_100739992 180
486 3300006237 Ga0097621_100036145 Ga0097621_1000361454 180
487 3300006358 Ga0068871_100002538 Ga0068871_1000025386 180
488 3300006358 Ga0068871_100229927 Ga0068871_1002299272 180
489 3300006844 Ga0075428_100104393 Ga0075428_1001043934 180
490 3300006847 Ga0075431_100089873 Ga0075431_1000898733 180
491 3300006852 Ga0075433_10059411 Ga0075433_100594114 180
492 3300006852 Ga0075433_10446659 Ga0075433_104466592 180
493 3300006871 Ga0075434_100182090 Ga0075434_1001820902 180
494 3300006880 Ga0075429_100248775 Ga0075429_1002487752 180
495 3300006880 Ga0075429_100874588 Ga0075429_1008745882 180
496 3300006914 Ga0075436_100108760 Ga0075436_1001087603 180
497 3300006931 Ga0097620_100006813 Ga0097620_1000068136 180
498 3300006931 Ga0097620_100213913 Ga0097620_1002139132 180
499 3300006931 Ga0097620_101595754 Ga0097620_1015957542 180
500 3300007076 Ga0075435_100146654 Ga0075435_1001466542 180
501 3300009147 Ga0114129_10022736 Ga0114129_100227362 180
502 3300009147 Ga0114129_10303944 Ga0114129_103039443 180
503 3300009148 Ga0105243_11847608 Ga0105243_118476081 180
504 3300009174 Ga0105241_10150886 Ga0105241_101508861 180
505 3300009176 Ga0105242_10061168 Ga0105242_100611682 180
506 3300009176 Ga0105242_10291339 Ga0105242_102913392 180
507 3300009177 Ga0105248_10004360 Ga0105248_100043605 180
508 3300009551 Ga0105238_10068907 Ga0105238_100689072 180
509 3300010375 Ga0105239_10293244 Ga0105239_102932442 180
510 3300013307 Ga0157372_10668734 Ga0157372_106687342 180
511 3300014325 Ga0163163_10000370 Ga0163163_1000037028 180
512 3300014325 Ga0163163_10742890 Ga0163163_107428902 180
513 3300025900 Ga0207710_10160707 Ga0207710_101607072 180
514 3300025908 Ga0207643_10150738 Ga0207643_101507382 180
515 3300025910 Ga0207684_10000023 Ga0207684_10000023222 180
516 3300025924 Ga0207694_10004263 Ga0207694_100042637 180
517 3300025925 Ga0207650_10000001 Ga0207650_10000001590 180
518 3300025932 Ga0207690_10040150 Ga0207690_100401501 180
519 3300025941 Ga0207711_10001428 Ga0207711_100014288 180
520 3300025945 Ga0207679_11146766 Ga0207679_111467661 180
521 3300026023 Ga0207677_10428016 Ga0207677_104280162 180
522 3300026041 Ga0207639_10132389 Ga0207639_101323893 180
523 3300026075 Ga0207708_10000140 Ga0207708_1000014033 180
524 3300026088 Ga0207641_10103330 Ga0207641_101033302 180
525 3300026088 Ga0207641_10666460 Ga0207641_106664602 180
526 3300028381 Ga0268264_10093813 Ga0268264_100938132 180
527 3300031901 Ga0307406_10028124 Ga0307406_100281245 180
528 3300031911 Ga0307412_10808277 Ga0307412_108082772 180
529 3300032004 Ga0307414_10026678 Ga0307414_100266783 180
530 3300032005 Ga0307411_10025971 Ga0307411_100259712 180
531 3300032126 Ga0307415_100060688 Ga0307415_1000606883 180
532 3300035091 Ga0373951_0003431 Ga0373951_0003431_2105_2656 180
533 3300035114 Ga0373939_0111069 Ga0373939_0111069_251_802 180
534 3300035115 Ga0373941_0014620 Ga0373941_0014620_671_1222 180
535 3300035691 Ga0373931_0059035 Ga0373931_0059035_993_1544 180
536 3300037466 Ga0395898_0365633 Ga0395898_0365633_523_1074 180
537 3300042012 Ga0439455_0020777 Ga0439455_0020777_875_1426 180
538 3300049519 Ga0501296_020531 Ga0501296_020531_57_608 180
539 3300049649 Ga0501198_004592 Ga0501198_004592_145_696 180
540 3300049650 Ga0501199_042717 Ga0501199_042717_31_582 180
541 3300049652 Ga0501202_021829 Ga0501202_021829_609_1160 180
542 3300049654 Ga0501207_000534 Ga0501207_000534_3175_3726 180
543 3300049656 Ga0501209_002166 Ga0501209_002166_411_962 180
544 3300049660 Ga0501216_002714 Ga0501216_002714_1525_2076 180
545 3300049661 Ga0501217_008494 Ga0501217_008494_102_653 180
546 3300049663 Ga0501223_003230 Ga0501223_003230_1272_1823 180
547 3300049668 Ga0501233_000433 Ga0501233_000433_3128_3679 180
548 3300049669 Ga0501235_010923 Ga0501235_010923_31_582 180
549 3300049670 Ga0501236_002888 Ga0501236_002888_748_1299 180
550 3300049675 Ga0501243_005070 Ga0501243_005070_829_1380 180
551 3300049704 Ga0501221_011611 Ga0501221_011611_138_689 180
552 3300049705 Ga0501225_0002382 Ga0501225_0002382_2161_2712 180
553 3300049706 Ga0501229_034061 Ga0501229_034061_12_563 180
554 3300049708 Ga0501245_015852 Ga0501245_015852_422_973 180
555 3300049851 Ga0501212_011943 Ga0501212_011943_462_1013 180
556 3300049853 Ga0501226_003411 Ga0501226_003411_179_730 180
557 3300050507 nmdc:mga05p37_142871_c1 nmdc:mga05p37_142871_c1_2170_2721 180
558 3300050507 nmdc:mga05p37_183096_c1 nmdc:mga05p37_183096_c1_634_1182 180
559 3300050508 nmdc:mga09592_356306_c1 nmdc:mga09592_356306_c1_452_1000 180
560 3300050510 nmdc:mga06r32_356967_c1 nmdc:mga06r32_356967_c1_444_995 180
561 3300050513 nmdc:mga0rr50_225862_c1 nmdc:mga0rr50_225862_c1_227_778 180
562 3300050514 nmdc:mga08x19_5028_c1 nmdc:mga08x19_5028_c1_7011_7574 180
563 3300050515 nmdc:mga0a205_23830_c1 nmdc:mga0a205_23830_c1_4049_4600 180
564 3300050515 nmdc:mga0a205_338580_c1 nmdc:mga0a205_338580_c1_443_994 180
565 2162886007 SwRhRL2b_contig_3401432 SwRhRL2b_0799.00010320 181
566 3300005289 Ga0065704_10002583 Ga0065704_100025836 181
567 3300005295 Ga0065707_10000877 Ga0065707_100008774 181
568 3300005471 Ga0070698_100162177 Ga0070698_1001621772 181
569 3300005518 Ga0070699_100223174 Ga0070699_1002231742 181
570 3300005547 Ga0070693_100121431 Ga0070693_1001214312 181
571 3300005564 Ga0070664_100326759 Ga0070664_1003267592 181
572 3300005618 Ga0068864_100263314 Ga0068864_1002633142 181
573 3300005985 Ga0081539_10027674 Ga0081539_100276742 181
574 3300006358 Ga0068871_100091314 Ga0068871_1000913142 181
575 3300006871 Ga0075434_100319299 Ga0075434_1003192992 181
576 3300009094 Ga0111539_10006275 Ga0111539_100062756 181
577 3300009101 Ga0105247_10482305 Ga0105247_104823052 181
578 3300009174 Ga0105241_10393868 Ga0105241_103938682 181
579 3300025911 Ga0207654_10118069 Ga0207654_101180692 181
580 3300026075 Ga0207708_10585532 Ga0207708_105855322 181
581 3300027907 Ga0207428_10007525 Ga0207428_100075255 181
582 3300050511 nmdc:mga08y16_2690_c1 nmdc:mga08y16_2690_c1_6312_6857 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

45

174

0.89

PF00085

Thioredoxin

Thioredoxin

54

132

0.85

PF13905

Thioredoxin_8

Thioredoxin-like

72

170

0.83

PF08534

Redoxin

Redoxin

47

188

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8549 49 174
3lwa-assembly1.cif.gz_A the crystal structure of a secreted thiol-disulfide isomerase from corynebacterium glutamicum to 1.75a 0.8505 55 175
5um7-assembly2.cif.gz_B crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.844 51 173
5um7-assembly1.cif.gz_A crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.8365 51 171
3c73-assembly1.cif.gz_A structure of cehc variant resa 0.8353 49 174
ID Description Score Start End Superfamily
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8683 55 175 3.40.30.10
af_I6XYM2_34_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8347 55 175 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8279 55 173 3.40.30.10
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8257 43 174 3.40.30.10
af_Q653R4_3_92_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8148 55 175 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7X9HHY6-F1-model_v4 TlpA family protein disulfide reductase 0.9515 54 174 GO:0016491
GO:0017004
AF-A0A7Y1YQY2-F1-model_v4 Redoxin domain-containing protein 0.9501 37 172 GO:0016209
GO:0016491
AF-A0A5B9PA55-F1-model_v4 Peroxiredoxin (EC 1.11.1.15) 0.9477 37 170 GO:0004601
GO:0030313
AF-A0A0F8YYB3-F1-model_v4 Thioredoxin domain-containing protein 0.9476 37 172 GO:0016491
GO:0030313
AF-A0A3D4P1W6-F1-model_v4 Redoxin 0.9466 35 174 GO:0016209
GO:0016491
GO:0030313

Feature Viewer

pLDDT pTM Quality
84.88 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map