F465007

General Info

Members Datasets Scaffolds Average Seq Length
571 343 519 173

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_198301_c1|nmdc:mga07m45_198301_c1_321_917
Length 198
Sequence MCGRLPGTRRAWHIEDNEAPSHERMNPGDNNTAYPPETPLDERDGRYLRKAIGWSHAAARRGNRPFGAIIVSARNEVICEAYNNTAETGDCTGHAETNAVRALAGKGLSREDLASATLYSSGEPCVMCAGAIFWSNIGRVVFGIDAARLRVFRGERQDQRDAELSCRDVFRASPHAIECIGPALVDEASAPHVGAWKG

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2738541277 Variovorax sp. GV051 Isolate Unclassified
17 2738541307 Variovorax sp. GV008 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2738543013 Variovorax sp. BT01 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2818991446 Variovorax sp. 1180 Isolate Unclassified
23 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
24 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
25 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
26 2842677519 Variovorax sp. R-72495 Isolate Unclassified
27 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
28 2842733646 Variovorax sp. R-72446 Isolate Unclassified
29 2842747753 Variovorax sp. R-72060 Isolate Unclassified
30 2885198086 Variovorax sp. 679 Isolate Unclassified
31 2885211737 Variovorax sp. 553 Isolate Unclassified
32 2899924645 Variovorax sp. 369 Isolate Unclassified
33 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
34 2904456579 Variovorax sp. 2002 Isolate Unclassified
35 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
36 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
37 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
38 2928037797 Variovorax sp. 1126 Isolate Unclassified
39 2928044640 Variovorax sp. 1128 Isolate Unclassified
40 2928051484 Variovorax sp. 1133 Isolate Unclassified
41 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
42 2928070936 Variovorax gossypii 1167 Isolate Unclassified
43 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
44 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2929520902 Variovorax beijingensis 502 Isolate Unclassified
47 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
48 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
51 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
52 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
62 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
188 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
189 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
190 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
209 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
212 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
223 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
224 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
225 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
226 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
233 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
306 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
320 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
321 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
322 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
323 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
324 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
325 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
326 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
327 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
328 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
329 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
332 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
337 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
342 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
343 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.19
Metatranscriptomes 0.7
Isolates 9.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.33
Nodule 0.88
Rhizoplane 4.9
Rhizosphere 44.31
Stem 0
Stem Tuber 0
Unclassified 15.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011757 3300001979 Bacteria 3321
2 JGI25152J39213_1002329 3300002773 Bacteria 7292
3 JGI25152J39213_1016824 3300002773 Bacteria 1397
4 JGI25150J39212_1009812 3300002774 Bacteria 1807
5 JGI25159J45721_1001905 3300002987 Bacteria 8341
6 JGI25159J45721_1025557 3300002987 Bacteria 1033
7 JGI25151J46595_10002951 3300003187 Bacteria 9715
8 JGI25151J46595_10003724 3300003187 Bacteria 8281
9 JGI25151J46595_10020576 3300003187 Bacteria 2778
10 JGI25151J46595_10057752 3300003187 Bacteria 1262
11 JGI25153J46596_10001657 3300003215 Bacteria 13197
12 rootH2_10096142 3300003320 Bacteria 5603
13 rootH2_10123516 3300003320 Bacteria 1883
14 JGI25160J50197_1001991 3300003354 Bacteria 9745
15 JGI25161J50226_1002482 3300003374 Bacteria 4700
16 JGI25161J50226_1004114 3300003374 Bacteria 3122
17 Ga0006562J51391_1093197 3300003578 Bacteria 2205
18 Ga0006562J51391_1093198 3300003578 Bacteria 5410
19 Ga0006562J51391_1185878 3300003578 Bacteria 1970
20 Ga0006562J51391_1185879 3300003578 Bacteria 2016
21 Ga0055527_1003577 3300003760 Bacteria 2272
22 Ga0055535_1000075 3300003761 Bacteria 111667
23 Ga0055542_1000059 3300003762 Bacteria 162670
24 Ga0055526_1002846 3300003771 Bacteria 11424
25 Ga0055526_1002969 3300003771 Bacteria 11106
26 Ga0055537_1000209 3300003773 Bacteria 43625
27 Ga0055537_1001136 3300003773 Bacteria 11424
28 Ga0055524_1002030 3300003775 Bacteria 10806
29 Ga0055524_1015150 3300003775 Bacteria 2823
30 Ga0055536_1002541 3300003781 Bacteria 10206
31 Ga0055536_1002962 3300003781 Bacteria 9311
32 Ga0055536_1009517 3300003781 Bacteria 4006
33 Ga0055536_1041020 3300003781 Bacteria 1096
34 Ga0055534_1000204 3300003784 Bacteria 43602
35 Ga0055534_1000804 3300003784 Bacteria 14567
36 Ga0055534_1002254 3300003784 Bacteria 6817
37 Ga0055528_1002005 3300003790 Bacteria 11424
38 Ga0055528_1003427 3300003790 Bacteria 7964
39 Ga0055528_1003539 3300003790 Bacteria 7790
40 Ga0055530_10002967 3300003791 Bacteria 10210
41 Ga0055530_10004579 3300003791 Bacteria 7053
42 Ga0055540_1001679 3300003792 Bacteria 12791
43 Ga0055540_1001999 3300003792 Bacteria 11388
44 Ga0055540_1002578 3300003792 Bacteria 9438
45 Ga0055540_1003903 3300003792 Bacteria 6991
46 Ga0055540_1004405 3300003792 Bacteria 6367
47 Ga0055540_1015537 3300003792 Bacteria 2209
48 Ga0055531_10002821 3300003794 Bacteria 11388
49 Ga0055531_10004538 3300003794 Bacteria 8421
50 Ga0055531_10008029 3300003794 Bacteria 5642
51 Ga0055543_1000691 3300004625 Bacteria 17401
52 Ga0065165_1001721 3300005262 Bacteria 21925
53 Ga0065165_1020858 3300005262 Bacteria 2292
54 Ga0065165_1037071 3300005262 Bacteria 1481
55 Ga0065714_10216478 3300005288 Bacteria 852
56 Ga0065704_10079770 3300005289 Bacteria 4085
57 Ga0065704_10116658 3300005289 Bacteria 1849
58 Ga0070658_10248740 3300005327 Bacteria 1508
59 Ga0070670_101300129 3300005331 Bacteria 666
60 Ga0068869_100332973 3300005334 Bacteria 1234
61 Ga0070682_100123835 3300005337 Bacteria 1739
62 Ga0070661_100668913 3300005344 Bacteria 844
63 Ga0070669_100033019 3300005353 Bacteria 3741
64 Ga0070675_100209521 3300005354 Bacteria 1694
65 Ga0070674_100709060 3300005356 Bacteria 861
66 Ga0070659_100205417 3300005366 Bacteria 1622
67 Ga0070667_100035690 3300005367 Bacteria 4167
68 Ga0070678_100065515 3300005456 Bacteria 2698
69 Ga0070678_100606984 3300005456 Bacteria 977
70 Ga0070662_100006218 3300005457 Bacteria 7692
71 Ga0068867_100428174 3300005459 Bacteria 1123
72 Ga0070685_11113116 3300005466 Bacteria 597
73 Ga0068853_100034583 3300005539 Bacteria 4290
74 Ga0068853_100911312 3300005539 Bacteria 844
75 Ga0068853_101232279 3300005539 Bacteria 723
76 Ga0070672_100470347 3300005543 Bacteria 1084
77 Ga0070665_100089596 3300005548 Bacteria 3082
78 Ga0070665_100369734 3300005548 Bacteria 1441
79 Ga0070665_100639141 3300005548 Bacteria 1077
80 Ga0070665_100803497 3300005548 Bacteria 954
81 Ga0070665_100853263 3300005548 Bacteria 924
82 Ga0068855_100009804 3300005563 Bacteria 11555
83 Ga0068857_100191727 3300005577 Bacteria 1861
84 Ga0068857_100858486 3300005577 Bacteria 869
85 Ga0068854_100399625 3300005578 Bacteria 1137
86 Ga0068852_100577588 3300005616 Bacteria 1126
87 Ga0068866_10713808 3300005718 Bacteria 689
88 Ga0068861_100282004 3300005719 Bacteria 1431
89 Ga0068862_100052478 3300005844 Bacteria 3489
90 Ga0075365_10117633 3300006038 Bacteria 1831
91 Ga0075363_100012897 3300006048 Bacteria 4036
92 Ga0075363_100096748 3300006048 Bacteria 1630
93 Ga0075363_100150276 3300006048 Bacteria 1314
94 Ga0075364_10050438 3300006051 Bacteria 2716
95 Ga0075364_10137464 3300006051 Bacteria 1642
96 Ga0075364_10154921 3300006051 Bacteria 1545
97 Ga0075364_10207720 3300006051 Bacteria 1328
98 Ga0075364_10740151 3300006051 Bacteria 671
99 Ga0075362_10150991 3300006177 Bacteria 1114
100 Ga0075362_10200882 3300006177 Bacteria 970
101 Ga0075367_10073359 3300006178 Bacteria 2062
102 Ga0075367_10152817 3300006178 Bacteria 1433
103 Ga0075367_10369453 3300006178 Bacteria 906
104 Ga0075369_10023446 3300006186 Bacteria 2551
105 Ga0075366_10014761 3300006195 Bacteria 4467
106 Ga0075366_10021503 3300006195 Bacteria 3750
107 Ga0075366_10101276 3300006195 Bacteria 1728
108 Ga0075366_10111821 3300006195 Bacteria 1643
109 Ga0075370_10013978 3300006353 Bacteria 4273
110 Ga0075370_10019488 3300006353 Bacteria 3696
111 Ga0075370_10043316 3300006353 Bacteria 2544
112 Ga0075370_10562864 3300006353 Bacteria 690
113 Ga0075370_10600488 3300006353 Bacteria 667
114 Ga0079104_1000020 3300006946 Bacteria 256848
115 Ga0099826_10001202 3300006948 Bacteria 15043
116 Ga0105244_10000885 3300009036 Bacteria 25392
117 Ga0105244_10262804 3300009036 Bacteria 803
118 Ga0105250_10001195 3300009092 Bacteria 14490
119 Ga0105240_10229832 3300009093 Bacteria 2156
120 Ga0105240_10521870 3300009093 Bacteria 1318
121 Ga0105245_10460803 3300009098 Bacteria 1281
122 Ga0105243_10001924 3300009148 Bacteria 17707
123 Ga0105243_10009492 3300009148 Bacteria 7407
124 Ga0105243_10111349 3300009148 Bacteria 2291
125 Ga0105243_10228979 3300009148 Bacteria 1648
126 Ga0105242_10014235 3300009176 Bacteria 6159
127 Ga0105237_10002891 3300009545 Bacteria 20845
128 Ga0105238_10444580 3300009551 Bacteria 1293
129 Ga0105239_10016338 3300010375 Bacteria 8208
130 Ga0105246_10081219 3300011119 Bacteria 2310
131 Ga0105246_10288504 3300011119 Bacteria 1319
132 Ga0105246_10422143 3300011119 Bacteria 1113
133 Ga0157373_10016909 3300013100 Bacteria 5316
134 Ga0157371_10038348 3300013102 Bacteria 3428
135 Ga0157370_10004270 3300013104 Bacteria 16460
136 Ga0157370_10078782 3300013104 Bacteria 3103
137 Ga0157370_10506869 3300013104 Bacteria 1108
138 Ga0157369_10008062 3300013105 Bacteria 12078
139 Ga0157369_10252691 3300013105 Bacteria 1839
140 Ga0163162_10074037 3300013306 Bacteria 3463
141 Ga0163162_10297597 3300013306 Bacteria 1745
142 Ga0182008_10000692 3300014497 Bacteria 24293
143 Ga0182008_10002038 3300014497 Bacteria 12962
144 Ga0182008_10003759 3300014497 Bacteria 9042
145 Ga0182008_10015665 3300014497 Bacteria 3952
146 Ga0182008_10016000 3300014497 Bacteria 3905
147 Ga0182008_10253248 3300014497 Bacteria 909
148 Ga0157376_10540712 3300014969 Bacteria 1151
149 Ga0182006_1001611 3300015261 Bacteria 13346
150 Ga0182006_1109449 3300015261 Bacteria 971
151 Ga0182007_10000330 3300015262 Bacteria 29991
152 Ga0182007_10001131 3300015262 Bacteria 14464
153 Ga0182005_1040779 3300015265 Bacteria 1263
154 Ga0183362_10003 3300015683 Bacteria 977584
155 Ga0163161_10000118 3300017792 Bacteria 75123
156 Ga0163161_10025555 3300017792 Bacteria 4180
157 Ga0163161_10078880 3300017792 Bacteria 2421
158 Ga0163161_10197874 3300017792 Bacteria 1547
159 Ga0163161_10273335 3300017792 Bacteria 1323
160 Ga0163161_10383350 3300017792 Bacteria 1124
161 Ga0209436_105659 3300025208 Bacteria 2835
162 Ga0209672_100197 3300025228 Bacteria 48105
163 Ga0209147_101305 3300025229 Bacteria 9599
164 Ga0209258_100078 3300025242 Bacteria 263996
165 Ga0207425_1000191 3300025245 Bacteria 49767
166 Ga0207425_1006189 3300025245 Bacteria 3303
167 Ga0209148_1000086 3300025254 Bacteria 263996
168 Ga0209129_1000116 3300025258 Bacteria 140716
169 Ga0209129_1003340 3300025258 Bacteria 7069
170 Ga0209565_1000067 3300025263 Bacteria 171247
171 Ga0209565_1000133 3300025263 Bacteria 104054
172 Ga0209565_1003501 3300025263 Bacteria 5049
173 Ga0209565_1003507 3300025263 Bacteria 5044
174 Ga0209673_1000190 3300025273 Bacteria 123411
175 Ga0209673_1000315 3300025273 Bacteria 89120
176 Ga0209673_1000813 3300025273 Bacteria 41247
177 Ga0209673_1005029 3300025273 Bacteria 6824
178 Ga0209673_1024950 3300025273 Bacteria 1998
179 Ga0209673_1074393 3300025273 Bacteria 798
180 Ga0209130_1000159 3300025284 Bacteria 101007
181 Ga0209130_1000727 3300025284 Bacteria 29060
182 Ga0209130_1008939 3300025284 Bacteria 2904
183 Ga0209675_1000038 3300025291 Bacteria 250481
184 Ga0209675_1000282 3300025291 Bacteria 48505
185 Ga0209675_1004578 3300025291 Bacteria 6092
186 Ga0209675_1009540 3300025291 Bacteria 3419
187 Ga0209675_1062156 3300025291 Bacteria 735
188 Ga0209676_1000125 3300025292 Bacteria 191565
189 Ga0209676_1001150 3300025292 Bacteria 28948
190 Ga0209676_1001799 3300025292 Bacteria 17979
191 Ga0209676_1006734 3300025292 Bacteria 5589
192 Ga0209676_1021797 3300025292 Bacteria 2140
193 Ga0209025_1000256 3300025294 Bacteria 125758
194 Ga0209025_1000293 3300025294 Bacteria 111845
195 Ga0209025_1001146 3300025294 Bacteria 37744
196 Ga0209025_1008021 3300025294 Bacteria 7690
197 Ga0209025_1106519 3300025294 Bacteria 872
198 Ga0209564_1000201 3300025295 Bacteria 136907
199 Ga0209564_1000535 3300025295 Bacteria 61415
200 Ga0209758_1000034 3300025297 Bacteria 467637
201 Ga0209758_1009697 3300025297 Bacteria 5925
202 Ga0209050_1000012 3300025298 Bacteria 813717
203 Ga0209050_1001995 3300025298 Bacteria 19097
204 Ga0209050_1013990 3300025298 Bacteria 3504
205 Ga0209256_1000066 3300025299 Bacteria 247534
206 Ga0209256_1000270 3300025299 Bacteria 90996
207 Ga0209256_1033565 3300025299 Bacteria 1379
208 Ga0207426_1000244 3300025302 Bacteria 120371
209 Ga0207426_1000369 3300025302 Bacteria 79694
210 Ga0209051_1000134 3300025303 Bacteria 138380
211 Ga0209051_1000322 3300025303 Bacteria 72185
212 Ga0209051_1000524 3300025303 Bacteria 47751
213 Ga0209051_1002812 3300025303 Bacteria 12006
214 Ga0209051_1004969 3300025303 Bacteria 7946
215 Ga0209051_1041598 3300025303 Bacteria 1633
216 Ga0209257_1000024 3300025304 Bacteria 726068
217 Ga0209257_1000849 3300025304 Bacteria 43669
218 Ga0209257_1001178 3300025304 Bacteria 33080
219 Ga0209257_1006635 3300025304 Bacteria 7358
220 Ga0209257_1013860 3300025304 Bacteria 3531
221 Ga0209257_1015646 3300025304 Bacteria 3138
222 Ga0207696_1002283 3300025711 Bacteria 9527
223 Ga0207655_1011175 3300025728 Bacteria 5368
224 Ga0207682_10037023 3300025893 Bacteria 1976
225 Ga0207680_10628624 3300025903 Bacteria 768
226 Ga0207681_10116908 3300025923 Bacteria 1949
227 Ga0207694_10376305 3300025924 Bacteria 1178
228 Ga0207659_11004364 3300025926 Bacteria 718
229 Ga0207687_10611112 3300025927 Bacteria 919
230 Ga0207690_10395189 3300025932 Bacteria 1101
231 Ga0207706_10066902 3300025933 Bacteria 3162
232 Ga0207686_10049208 3300025934 Bacteria 2615
233 Ga0207709_10000055 3300025935 Bacteria 222373
234 Ga0207709_10000393 3300025935 Bacteria 43216
235 Ga0207709_10012050 3300025935 Bacteria 4767
236 Ga0207709_10019386 3300025935 Bacteria 3824
237 Ga0207669_10090407 3300025937 Bacteria 1991
238 Ga0207669_10246686 3300025937 Bacteria 1327
239 Ga0207691_10039194 3300025940 Bacteria 4383
240 Ga0207689_10267304 3300025942 Bacteria 1415
241 Ga0207667_10011022 3300025949 Bacteria 10532
242 Ga0207651_10502695 3300025960 Bacteria 1048
243 Ga0207640_10123126 3300025981 Bacteria 1862
244 Ga0207639_10700683 3300026041 Bacteria 939
245 Ga0207639_11221693 3300026041 Bacteria 705
246 Ga0207678_10741366 3300026067 Bacteria 866
247 Ga0207702_10802628 3300026078 Bacteria 930
248 Ga0207674_10245300 3300026116 Bacteria 1738
249 Ga0207674_10345131 3300026116 Bacteria 1439
250 Ga0207675_100348624 3300026118 Bacteria 1451
251 Ga0207683_10075219 3300026121 Bacteria 2989
252 Ga0207683_10087012 3300026121 Bacteria 2779
253 Ga0207683_10315514 3300026121 Bacteria 1431
254 Ga0207683_10687597 3300026121 Bacteria 948
255 Ga0207698_10204742 3300026142 Bacteria 1770
256 Ga0209281_1000002 3300027111 Bacteria 1924012
257 Ga0209282_1000783 3300027666 Bacteria 16121
258 Ga0209813_10048698 3300027866 Bacteria 1317
259 Ga0209813_10099177 3300027866 Bacteria 989
260 Ga0268266_10568052 3300028379 Bacteria 1088
261 Ga0268266_10679728 3300028379 Bacteria 991
262 Ga0268266_10909542 3300028379 Bacteria 851
263 Ga0268266_11360689 3300028379 Bacteria 685
264 Ga0268265_10046194 3300028380 Bacteria 3254
265 Ga0307515_10001910 3300028794 Bacteria 46279
266 Ga0307515_10003649 3300028794 Bacteria 32350
267 Ga0307515_10010929 3300028794 Bacteria 17310
268 Ga0307515_10267298 3300028794 Bacteria 1437
269 Ga0307515_10366861 3300028794 Bacteria 1078
270 Ga0307515_10460845 3300028794 Bacteria 885
271 Ga0307512_10055700 3300030522 Bacteria 3115
272 Ga0314311_1042926 3300030733 Bacteria 2148
273 Ga0316178_1167009 3300030735 Bacteria 2491
274 Ga0316183_1014268 3300030742 Bacteria 4402
275 Ga0316181_1028028 3300030744 Bacteria 1410
276 Ga0316182_1367254 3300030745 Bacteria 3499
277 Ga0316182_1441758 3300030745 Bacteria 4135
278 Ga0265327_10001501 3300031251 Bacteria 28923
279 Ga0265327_10007552 3300031251 Bacteria 8358
280 Ga0307513_10009552 3300031456 Bacteria 12262
281 Ga0307513_10066374 3300031456 Bacteria 3792
282 Ga0307513_10219972 3300031456 Bacteria 1721
283 Ga0307408_100112906 3300031548 Bacteria 2090
284 Ga0307408_100257025 3300031548 Bacteria 1443
285 Ga0307408_100306406 3300031548 Bacteria 1332
286 Ga0307514_10298404 3300031649 Bacteria 905
287 Ga0307405_10007333 3300031731 Bacteria 5503
288 Ga0307405_10125408 3300031731 Bacteria 1764
289 Ga0307405_10178765 3300031731 Bacteria 1521
290 Ga0307413_10511332 3300031824 Bacteria 966
291 Ga0307406_10001607 3300031901 Bacteria 12413
292 Ga0307406_10520917 3300031901 Bacteria 967
293 Ga0307406_11202309 3300031901 Bacteria 658
294 Ga0307407_10129642 3300031903 Bacteria 1611
295 Ga0307412_10021730 3300031911 Bacteria 3924
296 Ga0307412_10604546 3300031911 Bacteria 929
297 Ga0307409_101128296 3300031995 Bacteria 806
298 Ga0307416_100026006 3300032002 Bacteria 4305
299 Ga0307416_100288975 3300032002 Bacteria 1622
300 Ga0307414_10311315 3300032004 Bacteria 1336
301 Ga0307411_10080623 3300032005 Bacteria 2238
302 Ga0307415_100352880 3300032126 Bacteria 1239
303 Ga0439436_0011858 3300041404 Bacteria 2646
304 Ga0439466_0029330 3300041411 Bacteria 1893
305 Ga0451787_000468 3300041441 Bacteria 1758
306 Ga0451789_0398632 3300041443 Bacteria 1501
307 Ga0451793_1206373 3300041452 Bacteria 3345
308 Ga0451797_0444334 3300041453 Bacteria 1523
309 Ga0451795_1126528 3300041456 Bacteria 1406
310 Ga0451802_0251249 3300041460 Bacteria 891
311 Ga0451807_1433404 3300041486 Bacteria 1478
312 Ga0451835_0597254 3300041492 Bacteria 981
313 Ga0451843_0690356 3300041509 Bacteria 1006
314 Ga0439431_0025322 3300041997 Bacteria 1448
315 Ga0439433_0003971 3300041999 Bacteria 3182
316 Ga0439442_009764 3300042002 Bacteria 1941
317 Ga0439442_017627 3300042002 Bacteria 1474
318 Ga0439449_0007508 3300042007 Bacteria 4143
319 Ga0439457_061858 3300042014 Bacteria 848
320 Ga0450919_004238 3300042121 Bacteria 1758
321 Ga0450921_001266 3300042123 Bacteria 1487
322 Ga0450923_028841 3300042125 Bacteria 1122
323 Ga0450890_001380 3300042127 Bacteria 3500
324 Ga0450896_018697 3300042133 Bacteria 1006
325 Ga0450898_013417 3300042134 Bacteria 1365
326 Ga0450889_008887 3300042144 Bacteria 1026
327 Ga0450906_001304 3300042145 Bacteria 5472
328 Ga0450907_026086 3300042146 Bacteria 989
329 Ga0439446_0013416 3300042156 Bacteria 2249
330 Ga0450908_003863 3300042184 Bacteria 2900
331 Ga0450909_016111 3300042185 Bacteria 1103
332 Ga0439434_0001666 3300042435 Bacteria 6434
333 Ga0450918_000646 3300042531 Bacteria 7458
334 Ga0451577_0110077 3300042876 Bacteria 2463
335 Ga0466965_0035441 3300044683 Bacteria 2444
336 Ga0466960_0041700 3300044901 Bacteria 2175
337 Ga0451576_0000814 3300045051 Bacteria 61027
338 Ga0451576_0879942 3300045051 Bacteria 940
339 Ga0495627_010015 3300046453 Bacteria 3465
340 Ga0495629_0284945 3300046459 Bacteria 1133
341 Ga0495638_0004315 3300046460 Bacteria 10790
342 Ga0495653_0234778 3300046463 Bacteria 1226
343 Ga0495650_0010777 3300046471 Bacteria 5074
344 Ga0495582_0721911 3300046473 Bacteria 577
345 Ga0495639_0202700 3300046475 Bacteria 971
346 Ga0495610_0020156 3300046512 Bacteria 3709
347 Ga0495610_0147190 3300046512 Bacteria 1008
348 Ga0495616_0002082 3300046513 Bacteria 13440
349 Ga0495620_0016821 3300046515 Bacteria 3658
350 Ga0495620_0020745 3300046515 Bacteria 3203
351 Ga0495628_0337424 3300046516 Bacteria 1110
352 Ga0495631_0001376 3300046518 Bacteria 14820
353 Ga0495632_0097865 3300046519 Bacteria 1384
354 Ga0495637_0005086 3300046520 Bacteria 6745
355 Ga0495637_0089320 3300046520 Bacteria 1218
356 Ga0495643_0023928 3300046522 Bacteria 3467
357 Ga0495643_0382003 3300046522 Bacteria 624
358 Ga0495648_0163055 3300046524 Bacteria 1150
359 Ga0495642_0173769 3300046528 Bacteria 936
360 Ga0495654_0006829 3300046530 Bacteria 6441
361 Ga0495654_0015989 3300046530 Bacteria 3975
362 Ga0495587_0180076 3300046536 Bacteria 1199
363 Ga0495587_0270732 3300046536 Bacteria 953
364 Ga0495598_0205244 3300046537 Bacteria 713
365 Ga0495598_0304097 3300046537 Bacteria 604
366 Ga0495609_0067022 3300046538 Bacteria 1581
367 Ga0495621_0021595 3300046539 Bacteria 2123
368 Ga0495621_0029843 3300046539 Bacteria 1861
369 Ga0495622_0006311 3300046557 Bacteria 5504
370 Ga0495656_0000287 3300046615 Bacteria 17572
371 Ga0495668_0087054 3300046616 Bacteria 1713
372 Ga0495668_0528331 3300046616 Bacteria 651
373 Ga0495634_0255808 3300046642 Bacteria 1070
374 Ga0495625_0000317 3300046660 Bacteria 73568
375 Ga0495625_0001726 3300046660 Bacteria 25344
376 Ga0495625_0033029 3300046660 Bacteria 3830
377 Ga0495635_0061776 3300046663 Bacteria 2573
378 Ga0495635_0324827 3300046663 Bacteria 1029
379 Ga0495659_0106282 3300046664 Bacteria 1092
380 Ga0495661_0102383 3300046665 Bacteria 1610
381 Ga0495588_0069947 3300046674 Bacteria 1824
382 Ga0495588_0107293 3300046674 Bacteria 1470
383 Ga0495588_0157199 3300046674 Bacteria 1202
384 Ga0495588_0250622 3300046674 Bacteria 933
385 Ga0495646_0327926 3300046680 Bacteria 805
386 Ga0495658_0456305 3300046683 Bacteria 816
387 Ga0495670_0167138 3300046691 Bacteria 1158
388 Ga0495671_0004483 3300046692 Bacteria 8340
389 Ga0495600_0484382 3300046809 Bacteria 762
390 Ga0495676_0032709 3300047321 Bacteria 4387
391 Ga0495676_0287066 3300047321 Bacteria 1113
392 Ga0495680_0832524 3300047322 Bacteria 601
393 Ga0495681_0083925 3300047470 Bacteria 1417
394 Ga0495686_0289949 3300047472 Bacteria 907
395 Ga0495593_0019498 3300047673 Bacteria 3801
396 Ga0495614_0070830 3300048089 Bacteria 1503
397 Ga0495614_0129899 3300048089 Bacteria 1114
398 Ga0495615_0002527 3300048090 Bacteria 2944
399 Ga0496100_0034658 3300048903 Bacteria 3169
400 Ga0496100_0674745 3300048903 Bacteria 806
401 Ga0496101_0082797 3300048904 Bacteria 2374
402 Ga0496101_0150063 3300048904 Bacteria 1782
403 Ga0496102_0016208 3300048905 Bacteria 6512
404 Ga0496102_0062048 3300048905 Bacteria 3423
405 Ga0496102_0072379 3300048905 Bacteria 3167
406 Ga0496103_0038327 3300048906 Bacteria 2940
407 Ga0496104_0047021 3300048907 Bacteria 4066
408 Ga0496105_0083063 3300048908 Bacteria 2645
409 Ga0496106_0217389 3300048909 Bacteria 1523
410 Ga0496107_0137738 3300048910 Bacteria 1804
411 Ga0496108_0073687 3300048911 Bacteria 2882
412 Ga0496109_0503384 3300048912 Bacteria 1143
413 Ga0496110_0116309 3300048913 Bacteria 2407
414 Ga0496110_0139386 3300048913 Bacteria 2192
415 Ga0496113_0222033 3300048916 Bacteria 1506
416 Ga0496114_0075863 3300048917 Bacteria 2832
417 Ga0496116_0013383 3300048919 Bacteria 6620
418 Ga0496116_0047878 3300048919 Bacteria 2874
419 Ga0496116_0174389 3300048919 Bacteria 1160
420 Ga0496117_0010561 3300048920 Bacteria 8394
421 Ga0496117_0050980 3300048920 Bacteria 2930
422 Ga0496117_0098143 3300048920 Bacteria 1863
423 Ga0496118_0022115 3300048921 Bacteria 5571
424 Ga0496118_0066201 3300048921 Bacteria 2638
425 Ga0496118_0128312 3300048921 Bacteria 1634
426 Ga0496121_0004421 3300048924 Bacteria 18927
427 Ga0496121_0039097 3300048924 Bacteria 4188
428 Ga0496121_0077990 3300048924 Bacteria 2635
429 Ga0496122_0001678 3300048925 Bacteria 34323
430 Ga0496122_0004921 3300048925 Bacteria 16197
431 Ga0496122_0020254 3300048925 Bacteria 6023
432 Ga0496122_0119313 3300048925 Bacteria 1706
433 Ga0496122_0182590 3300048925 Bacteria 1249
434 Ga0496122_0265134 3300048925 Bacteria 950
435 Ga0496123_0000102 3300048926 Bacteria 169327
436 Ga0496123_0016510 3300048926 Bacteria 5992
437 Ga0496123_0018344 3300048926 Bacteria 5571
438 Ga0496123_0046335 3300048926 Bacteria 2950
439 Ga0496123_0088714 3300048926 Bacteria 1845
440 Ga0496123_0130368 3300048926 Bacteria 1394
441 Ga0496123_0171601 3300048926 Bacteria 1143
442 Ga0496123_0185864 3300048926 Bacteria 1080
443 Ga0496124_0000543 3300048927 Bacteria 63823
444 Ga0496124_0002373 3300048927 Bacteria 24822
445 Ga0496124_0030785 3300048927 Bacteria 4756
446 Ga0496124_0084641 3300048927 Bacteria 2600
447 Ga0496124_0114205 3300048927 Bacteria 2169
448 Ga0496125_0002144 3300048928 Bacteria 26440
449 Ga0496125_0002660 3300048928 Bacteria 22836
450 Ga0496125_0010225 3300048928 Bacteria 9511
451 Ga0496125_0125693 3300048928 Bacteria 1818
452 Ga0496125_0198342 3300048928 Bacteria 1317
453 Ga0496126_0177836 3300048929 Bacteria 1809
454 Ga0496126_0285165 3300048929 Bacteria 1367
455 Ga0501249_073185 3300049679 Bacteria 802
456 Ga0501257_027513 3300049686 Bacteria 1361
457 Ga0501225_0015128 3300049705 Bacteria 2152
458 Ga0501262_000018 3300049759 Bacteria 23886
459 nmdc:mga03683_12314_c1 3300050489 Bacteria 3120
460 nmdc:mga03n38_111081_c1 3300050490 Bacteria 1335
461 nmdc:mga03n38_7236_c1 3300050490 Bacteria 3916
462 nmdc:mga00v17_156201_c1 3300050491 Bacteria 1467
463 nmdc:mga00v17_219035_c1 3300050491 Bacteria 1232
464 nmdc:mga00v17_80172_c1 3300050491 Bacteria 2037
465 nmdc:mga00v17_84781_c1 3300050491 Bacteria 1984
466 nmdc:mga0yw44_43535_c1 3300050492 Bacteria 2681
467 nmdc:mga0k408_297233_c1 3300050493 Bacteria 964
468 nmdc:mga0k408_33143_c1 3300050493 Bacteria 1575
469 nmdc:mga0k408_480576_c1 3300050493 Bacteria 737
470 nmdc:mga0k408_571387_c1 3300050493 Bacteria 668
471 nmdc:mga06z11_130184_c1 3300050494 Bacteria 1412
472 nmdc:mga06z11_296053_c1 3300050494 Bacteria 961
473 nmdc:mga04h51_177562_c1 3300050495 Bacteria 827
474 nmdc:mga07m45_178504_c1 3300050496 Bacteria 1235
475 nmdc:mga07m45_198301_c1 3300050496 Bacteria 1167
476 nmdc:mga07m45_308583_c1 3300050496 Bacteria 920
477 nmdc:mga07m45_336883_c1 3300050496 Bacteria 877
478 nmdc:mga07m45_359_c1 3300050496 Bacteria 18601
479 nmdc:mga07m45_717_c1 3300050496 Bacteria 14101
480 nmdc:mga07m45_7194_c1 3300050496 Bacteria 5674
481 nmdc:mga07m45_82978_c1 3300050496 Bacteria 1831
482 Ga0500610_0001194 3300053079 Bacteria 8626
483 Ga0500610_0003828 3300053079 Bacteria 5854
484 Ga0500610_0014318 3300053079 Bacteria 3717
485 Ga0500610_0021251 3300053079 Bacteria 3181
486 Ga0500643_004563 3300053087 Bacteria 6204
487 Ga0500646_0147700 3300053090 Bacteria 776
488 Ga0500651_0000028 3300053093 Bacteria 114592
489 Ga0500566_0173588 3300053094 Bacteria 1112
490 Ga0500560_038198 3300053107 Bacteria 1493
491 Ga0500569_014646 3300053109 Bacteria 1946
492 Ga0500571_000016 3300053110 Bacteria 64989
493 Ga0500593_001511 3300053117 Bacteria 8354
494 Ga0500593_004698 3300053117 Bacteria 5322
495 Ga0500594_0000281 3300053118 Bacteria 11866
496 Ga0500594_0112560 3300053118 Bacteria 848
497 Ga0500597_010292 3300053120 Bacteria 3333
498 Ga0500607_001581 3300053121 Bacteria 20131
499 Ga0500608_021577 3300053122 Bacteria 2977
500 Ga0500618_008679 3300053125 Bacteria 2821
501 Ga0500618_017738 3300053125 Bacteria 1768
502 Ga0500626_011551 3300053128 Bacteria 3750
503 Ga0500658_0000298 3300053134 Bacteria 22523
504 Ga0500658_0002219 3300053134 Bacteria 7544
505 Ga0500658_0013838 3300053134 Bacteria 2984
506 Ga0500559_0003610 3300053136 Bacteria 7566
507 Ga0500559_0009248 3300053136 Bacteria 4277
508 Ga0500559_0019685 3300053136 Bacteria 2852
509 Ga0500564_057903 3300053138 Bacteria 1762
510 Ga0500568_0011841 3300053139 Bacteria 4028
511 Ga0500573_0009123 3300053140 Bacteria 5490
512 Ga0500574_000920 3300053141 Bacteria 4072
513 Ga0500616_0027735 3300053153 Bacteria 3125
514 Ga0500627_0002042 3300053158 Bacteria 5838
515 Ga0500634_0014871 3300053161 Bacteria 4117
516 Ga0500634_0035785 3300053161 Bacteria 2703
517 Ga0500567_078513 3300053723 Bacteria 1431
518 Ga0500565_006842 3300053734 Bacteria 1060
519 Ga0500587_000949 3300053739 Bacteria 3899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0382003 Ga0495643_0382003_16_447 143
2 3300046616 Ga0495668_0528331 Ga0495668_0528331_156_587 143
3 3300026121 Ga0207683_10687597 Ga0207683_106875971 158
4 3300046471 Ga0495650_0010777 Ga0495650_0010777_2472_2951 158
5 3300042876 Ga0451577_0110077 Ga0451577_0110077_1186_1671 160
6 3300045051 Ga0451576_0000814 Ga0451576_0000814_23982_24467 160
7 3300005548 Ga0070665_100639141 Ga0070665_1006391412 161
8 3300028379 Ga0268266_10909542 Ga0268266_109095421 161
9 iso_pu_bacteria 2585428062 2587757045 161
10 iso_pu_bacteria 2738543013 2739248924 162
11 3300025304 Ga0209257_1015646 Ga0209257_10156463 163
12 3300031456 Ga0307513_10066374 Ga0307513_100663742 163
13 3300046515 Ga0495620_0020745 Ga0495620_0020745_963_1487 163
14 3300046530 Ga0495654_0006829 Ga0495654_0006829_2135_2629 163
15 3300046660 Ga0495625_0033029 Ga0495625_0033029_2508_3032 163
16 3300053153 Ga0500616_0027735 Ga0500616_0027735_374_898 163
17 iso_pu_bacteria 2974320154 2974320187 163
18 3300011119 Ga0105246_10422143 Ga0105246_104221432 164
19 3300017792 Ga0163161_10025555 Ga0163161_100255552 164
20 3300045051 Ga0451576_0879942 Ga0451576_0879942_45_542 164
21 3300046460 Ga0495638_0004315 Ga0495638_0004315_5385_5912 164
22 3300046513 Ga0495616_0002082 Ga0495616_0002082_9061_9588 164
23 3300046518 Ga0495631_0001376 Ga0495631_0001376_1330_1857 164
24 3300046530 Ga0495654_0015989 Ga0495654_0015989_20_547 164
25 3300046557 Ga0495622_0006311 Ga0495622_0006311_1738_2265 164
26 3300046674 Ga0495588_0069947 Ga0495588_0069947_174_701 164
27 3300047321 Ga0495676_0032709 Ga0495676_0032709_3265_3792 164
28 3300047673 Ga0495593_0019498 Ga0495593_0019498_545_1072 164
29 3300048910 Ga0496107_0137738 Ga0496107_0137738_95_622 164
30 3300048924 Ga0496121_0077990 Ga0496121_0077990_1996_2523 164
31 3300048925 Ga0496122_0119313 Ga0496122_0119313_1099_1626 164
32 3300048926 Ga0496123_0088714 Ga0496123_0088714_1206_1733 164
33 3300048929 Ga0496126_0177836 Ga0496126_0177836_472_999 164
34 3300053087 Ga0500643_004563 Ga0500643_004563_2502_3029 164
35 3300053093 Ga0500651_0000028 Ga0500651_0000028_50798_51325 164
36 3300053107 Ga0500560_038198 Ga0500560_038198_76_603 164
37 3300053110 Ga0500571_000016 Ga0500571_000016_22404_22931 164
38 3300053118 Ga0500594_0000281 Ga0500594_0000281_9818_10345 164
39 3300053125 Ga0500618_008679 Ga0500618_008679_585_1112 164
40 3300053134 Ga0500658_0000298 Ga0500658_0000298_2140_2667 164
41 3300053134 Ga0500658_0002219 Ga0500658_0002219_4876_5403 164
42 3300053138 Ga0500564_057903 Ga0500564_057903_704_1231 164
43 3300053139 Ga0500568_0011841 Ga0500568_0011841_1030_1557 164
44 3300053161 Ga0500634_0035785 Ga0500634_0035785_1997_2524 164
45 3300003781 Ga0055536_1009517 Ga0055536_10095172 165
46 3300003791 Ga0055530_10004579 Ga0055530_100045793 165
47 3300003792 Ga0055540_1001999 Ga0055540_10019999 165
48 3300003794 Ga0055531_10002821 Ga0055531_100028213 165
49 3300006178 Ga0075367_10152817 Ga0075367_101528172 165
50 3300006195 Ga0075366_10111821 Ga0075366_101118212 165
51 3300011119 Ga0105246_10081219 Ga0105246_100812191 165
52 3300025292 Ga0209676_1001799 Ga0209676_10017999 165
53 3300025298 Ga0209050_1001995 Ga0209050_100199516 165
54 3300025303 Ga0209051_1000322 Ga0209051_100032223 165
55 3300025304 Ga0209257_1000849 Ga0209257_100084921 165
56 3300028794 Ga0307515_10003649 Ga0307515_1000364929 165
57 3300028794 Ga0307515_10010929 Ga0307515_100109299 165
58 3300028794 Ga0307515_10460845 Ga0307515_104608451 165
59 3300030522 Ga0307512_10055700 Ga0307512_100557004 165
60 3300031456 Ga0307513_10009552 Ga0307513_100095524 165
61 3300041441 Ga0451787_000468 Ga0451787_000468_676_1173 165
62 3300041452 Ga0451793_1206373 Ga0451793_1206373_1622_2119 165
63 3300041456 Ga0451795_1126528 Ga0451795_1126528_878_1375 165
64 3300041460 Ga0451802_0251249 Ga0451802_0251249_199_696 165
65 3300041492 Ga0451835_0597254 Ga0451835_0597254_402_899 165
66 3300046512 Ga0495610_0020156 Ga0495610_0020156_987_1484 165
67 3300046519 Ga0495632_0097865 Ga0495632_0097865_775_1272 165
68 3300046660 Ga0495625_0001726 Ga0495625_0001726_16402_16959 165
69 3300046683 Ga0495658_0456305 Ga0495658_0456305_56_553 165
70 3300047472 Ga0495686_0289949 Ga0495686_0289949_196_693 165
71 3300048903 Ga0496100_0674745 Ga0496100_0674745_248_757 165
72 3300048905 Ga0496102_0016208 Ga0496102_0016208_3940_4449 165
73 3300048927 Ga0496124_0000543 Ga0496124_0000543_23925_24422 165
74 3300048928 Ga0496125_0002660 Ga0496125_0002660_5429_5926 165
75 3300050493 nmdc:mga0k408_571387_c1 nmdc:mga0k408_571387_c1_141_638 165
76 3300050496 nmdc:mga07m45_178504_c1 nmdc:mga07m45_178504_c1_539_1036 165
77 3300050496 nmdc:mga07m45_336883_c1 nmdc:mga07m45_336883_c1_239_736 165
78 3300053134 Ga0500658_0013838 Ga0500658_0013838_64_561 165
79 3300053739 Ga0500587_000949 Ga0500587_000949_3127_3624 165
80 iso_pu_bacteria 2687453129 2687580367 165
81 iso_pu_bacteria 2721755523 2722886012 165
82 iso_pu_bacteria 2839138175 2839142725 165
83 iso_pu_bacteria 2842718218 2842718952 165
84 3300002987 JGI25159J45721_1025557 JGI25159J45721_10255572 166
85 3300003781 Ga0055536_1041020 Ga0055536_10410202 166
86 3300003784 Ga0055534_1002254 Ga0055534_10022544 166
87 3300003792 Ga0055540_1015537 Ga0055540_10155372 166
88 3300005262 Ga0065165_1037071 Ga0065165_10370712 166
89 3300017792 Ga0163161_10273335 Ga0163161_102733352 166
90 3300025273 Ga0209673_1024950 Ga0209673_10249503 166
91 3300025273 Ga0209673_1074393 Ga0209673_10743931 166
92 3300025284 Ga0209130_1008939 Ga0209130_10089392 166
93 3300025291 Ga0209675_1009540 Ga0209675_10095402 166
94 3300025292 Ga0209676_1006734 Ga0209676_10067347 166
95 3300025294 Ga0209025_1106519 Ga0209025_11065191 166
96 3300025303 Ga0209051_1004969 Ga0209051_10049693 166
97 3300025304 Ga0209257_1006635 Ga0209257_10066352 166
98 3300031456 Ga0307513_10219972 Ga0307513_102199723 166
99 3300041443 Ga0451789_0398632 Ga0451789_0398632_497_1000 166
100 iso_pu_bacteria 2904479285 2904481055 166
101 iso_pu_bacteria 2928115317 2928115707 166
102 3300005548 Ga0070665_100369734 Ga0070665_1003697342 167
103 3300006051 Ga0075364_10050438 Ga0075364_100504381 167
104 3300006946 Ga0079104_1000020 Ga0079104_1000020236 167
105 3300009092 Ga0105250_10001195 Ga0105250_100011958 167
106 3300009148 Ga0105243_10009492 Ga0105243_100094926 167
107 3300025711 Ga0207696_1002283 Ga0207696_10022836 167
108 3300025935 Ga0207709_10000055 Ga0207709_1000005575 167
109 3300027111 Ga0209281_1000002 Ga0209281_1000002511 167
110 3300028379 Ga0268266_10679728 Ga0268266_106797282 167
111 3300050491 nmdc:mga00v17_80172_c1 nmdc:mga00v17_80172_c1_481_990 167
112 3300005327 Ga0070658_10248740 Ga0070658_102487402 168
113 3300009098 Ga0105245_10460803 Ga0105245_104608031 168
114 3300028794 Ga0307515_10001910 Ga0307515_1000191012 168
115 3300041999 Ga0439433_0003971 Ga0439433_0003971_2352_2864 168
116 3300042002 Ga0439442_017627 Ga0439442_017627_677_1189 168
117 3300042007 Ga0439449_0007508 Ga0439449_0007508_3252_3764 168
118 3300048905 Ga0496102_0062048 Ga0496102_0062048_1955_2461 168
119 3300048924 Ga0496121_0004421 Ga0496121_0004421_13600_14106 168
120 3300053117 Ga0500593_001511 Ga0500593_001511_563_1069 168
121 iso_pu_bacteria 2842733646 2842736262 168
122 iso_pu_bacteria 2842747753 2842748759 168
123 iso_pu_bacteria 2643221570 2643867909 169
124 iso_pu_bacteria 2643221609 2644058991 169
125 iso_pu_bacteria 2643221611 2644071218 169
126 iso_pu_bacteria 2904449895 2904451987 169
127 iso_pu_bacteria 2904456579 2904458867 169
128 iso_pu_bacteria 2904541872 2904547422 169
129 iso_pu_bacteria 2929160207 2929165077 169
130 iso_pu_bacteria 2945972063 2945975897 169
131 3300009176 Ga0105242_10014235 Ga0105242_100142353 170
132 3300025934 Ga0207686_10049208 Ga0207686_100492082 170
133 iso_pu_bacteria 2643221683 2644467273 170
134 iso_pu_bacteria 2738543012 2739246247 170
135 iso_pu_bacteria 2816332133 2816471371 170
136 iso_pu_bacteria 2928084124 2928090133 170
137 iso_pu_bacteria 2929520902 2929523475 170
138 iso_pu_bacteria 2945909444 2945910319 170
139 iso_pu_bacteria 2945984333 2945987637 170
140 iso_pu_bacteria 2954767861 2954768687 170
141 3300005331 Ga0070670_101300129 Ga0070670_1013001291 171
142 3300005334 Ga0068869_100332973 Ga0068869_1003329732 171
143 3300005354 Ga0070675_100209521 Ga0070675_1002095212 171
144 3300005367 Ga0070667_100035690 Ga0070667_1000356904 171
145 3300005456 Ga0070678_100065515 Ga0070678_1000655153 171
146 3300005456 Ga0070678_100606984 Ga0070678_1006069841 171
147 3300005459 Ga0068867_100428174 Ga0068867_1004281741 171
148 3300005466 Ga0070685_11113116 Ga0070685_111131161 171
149 3300005539 Ga0068853_101232279 Ga0068853_1012322791 171
150 3300005543 Ga0070672_100470347 Ga0070672_1004703472 171
151 3300005548 Ga0070665_100089596 Ga0070665_1000895963 171
152 3300005548 Ga0070665_100803497 Ga0070665_1008034972 171
153 3300005718 Ga0068866_10713808 Ga0068866_107138081 171
154 3300005719 Ga0068861_100282004 Ga0068861_1002820041 171
155 3300009036 Ga0105244_10262804 Ga0105244_102628041 171
156 3300013104 Ga0157370_10506869 Ga0157370_105068692 171
157 3300013306 Ga0163162_10074037 Ga0163162_100740372 171
158 3300013306 Ga0163162_10297597 Ga0163162_102975972 171
159 3300014497 Ga0182008_10000692 Ga0182008_1000069218 171
160 3300014497 Ga0182008_10003759 Ga0182008_1000375911 171
161 3300014969 Ga0157376_10540712 Ga0157376_105407122 171
162 3300015262 Ga0182007_10001131 Ga0182007_100011311 171
163 3300015683 Ga0183362_10003 Ga0183362_10003465 171
164 3300017792 Ga0163161_10383350 Ga0163161_103833502 171
165 3300025893 Ga0207682_10037023 Ga0207682_100370232 171
166 3300025903 Ga0207680_10628624 Ga0207680_106286242 171
167 3300025926 Ga0207659_11004364 Ga0207659_110043642 171
168 3300025927 Ga0207687_10611112 Ga0207687_106111122 171
169 3300025937 Ga0207669_10246686 Ga0207669_102466862 171
170 3300025940 Ga0207691_10039194 Ga0207691_100391943 171
171 3300025942 Ga0207689_10267304 Ga0207689_102673042 171
172 3300025960 Ga0207651_10502695 Ga0207651_105026951 171
173 3300026041 Ga0207639_11221693 Ga0207639_112216931 171
174 3300026118 Ga0207675_100348624 Ga0207675_1003486242 171
175 3300026121 Ga0207683_10075219 Ga0207683_100752193 171
176 3300026121 Ga0207683_10087012 Ga0207683_100870121 171
177 3300026121 Ga0207683_10315514 Ga0207683_103155142 171
178 3300028379 Ga0268266_10568052 Ga0268266_105680522 171
179 3300031251 Ga0265327_10007552 Ga0265327_100075522 171
180 3300044683 Ga0466965_0035441 Ga0466965_0035441_1070_1591 171
181 3300044901 Ga0466960_0041700 Ga0466960_0041700_763_1284 171
182 3300046459 Ga0495629_0284945 Ga0495629_0284945_508_1029 171
183 3300046463 Ga0495653_0234778 Ga0495653_0234778_190_711 171
184 3300046475 Ga0495639_0202700 Ga0495639_0202700_408_929 171
185 3300046516 Ga0495628_0337424 Ga0495628_0337424_532_1053 171
186 3300046522 Ga0495643_0023928 Ga0495643_0023928_2920_3438 171
187 3300046528 Ga0495642_0173769 Ga0495642_0173769_259_780 171
188 3300046536 Ga0495587_0270732 Ga0495587_0270732_18_539 171
189 3300046537 Ga0495598_0205244 Ga0495598_0205244_112_633 171
190 3300046537 Ga0495598_0304097 Ga0495598_0304097_67_588 171
191 3300046539 Ga0495621_0021595 Ga0495621_0021595_1550_2071 171
192 3300046539 Ga0495621_0029843 Ga0495621_0029843_979_1500 171
193 3300046615 Ga0495656_0000287 Ga0495656_0000287_3629_4150 171
194 3300046642 Ga0495634_0255808 Ga0495634_0255808_279_800 171
195 3300046664 Ga0495659_0106282 Ga0495659_0106282_411_932 171
196 3300046674 Ga0495588_0157199 Ga0495588_0157199_383_904 171
197 3300046680 Ga0495646_0327926 Ga0495646_0327926_214_735 171
198 3300046691 Ga0495670_0167138 Ga0495670_0167138_527_1048 171
199 3300047322 Ga0495680_0832524 Ga0495680_0832524_21_542 171
200 3300047470 Ga0495681_0083925 Ga0495681_0083925_868_1389 171
201 3300048089 Ga0495614_0070830 Ga0495614_0070830_810_1331 171
202 3300048090 Ga0495615_0002527 Ga0495615_0002527_841_1362 171
203 3300048903 Ga0496100_0034658 Ga0496100_0034658_1507_2028 171
204 3300048904 Ga0496101_0082797 Ga0496101_0082797_1399_1920 171
205 3300048905 Ga0496102_0072379 Ga0496102_0072379_1524_2045 171
206 3300048906 Ga0496103_0038327 Ga0496103_0038327_687_1208 171
207 3300048907 Ga0496104_0047021 Ga0496104_0047021_1817_2338 171
208 3300048908 Ga0496105_0083063 Ga0496105_0083063_1896_2417 171
209 3300048909 Ga0496106_0217389 Ga0496106_0217389_651_1172 171
210 3300048911 Ga0496108_0073687 Ga0496108_0073687_2258_2779 171
211 3300048912 Ga0496109_0503384 Ga0496109_0503384_480_1001 171
212 3300048913 Ga0496110_0116309 Ga0496110_0116309_1715_2236 171
213 3300048913 Ga0496110_0139386 Ga0496110_0139386_1425_1946 171
214 3300048916 Ga0496113_0222033 Ga0496113_0222033_375_896 171
215 3300048917 Ga0496114_0075863 Ga0496114_0075863_1547_2068 171
216 3300048926 Ga0496123_0185864 Ga0496123_0185864_366_887 171
217 3300053125 Ga0500618_017738 Ga0500618_017738_404_922 171
218 iso_pu_bacteria 2513020051 2513230519 171
219 iso_pu_bacteria 2599185214 2599623064 171
220 iso_pu_bacteria 2599185226 2599674711 171
221 iso_pu_bacteria 2599185227 2599680668 171
222 iso_pu_bacteria 2599185229 2599692683 171
223 iso_pu_bacteria 2643221658 2644325325 171
224 iso_pu_bacteria 2643221672 2644399059 171
225 iso_pu_bacteria 2738541307 2738886307 171
226 iso_pu_bacteria 2818991446 2819602496 171
227 iso_pu_bacteria 2831265667 2831272014 171
228 iso_pu_bacteria 2838054893 2838059843 171
229 iso_pu_bacteria 2885198086 2885198515 171
230 iso_pu_bacteria 2885211737 2885212105 171
231 iso_pu_bacteria 2899924645 2899928637 171
232 iso_pu_bacteria 2928037797 2928043411 171
233 iso_pu_bacteria 2928044640 2928050853 171
234 iso_pu_bacteria 2928051484 2928056238 171
235 iso_pu_bacteria 2928064002 2928066283 171
236 iso_pu_bacteria 2928070936 2928075932 171
237 3300005353 Ga0070669_100033019 Ga0070669_1000330191 172
238 3300006048 Ga0075363_100096748 Ga0075363_1000967482 172
239 3300006051 Ga0075364_10740151 Ga0075364_107401511 172
240 3300006178 Ga0075367_10369453 Ga0075367_103694531 172
241 3300017792 Ga0163161_10197874 Ga0163161_101978742 172
242 3300025923 Ga0207681_10116908 Ga0207681_101169082 172
243 3300027866 Ga0209813_10099177 Ga0209813_100991772 172
244 3300031251 Ga0265327_10001501 Ga0265327_100015015 172
245 3300041453 Ga0451797_0444334 Ga0451797_0444334_742_1263 172
246 3300046473 Ga0495582_0721911 Ga0495582_0721911_37_561 172
247 3300048919 Ga0496116_0047878 Ga0496116_0047878_1507_2028 172
248 3300048925 Ga0496122_0001678 Ga0496122_0001678_6054_6575 172
249 3300048926 Ga0496123_0000102 Ga0496123_0000102_6054_6575 172
250 3300048927 Ga0496124_0030785 Ga0496124_0030785_2536_3057 172
251 3300048929 Ga0496126_0285165 Ga0496126_0285165_650_1171 172
252 3300050489 nmdc:mga03683_12314_c1 nmdc:mga03683_12314_c1_1942_2463 172
253 3300050490 nmdc:mga03n38_111081_c1 nmdc:mga03n38_111081_c1_120_641 172
254 3300050493 nmdc:mga0k408_480576_c1 nmdc:mga0k408_480576_c1_52_573 172
255 3300050494 nmdc:mga06z11_296053_c1 nmdc:mga06z11_296053_c1_413_934 172
256 3300050496 nmdc:mga07m45_82978_c1 nmdc:mga07m45_82978_c1_537_1058 172
257 3300053090 Ga0500646_0147700 Ga0500646_0147700_16_537 172
258 3300053118 Ga0500594_0112560 Ga0500594_0112560_46_567 172
259 3300053136 Ga0500559_0003610 Ga0500559_0003610_2595_3116 172
260 3300053136 Ga0500559_0019685 Ga0500559_0019685_756_1277 172
261 3300053140 Ga0500573_0009123 Ga0500573_0009123_3935_4456 172
262 3300053723 Ga0500567_078513 Ga0500567_078513_273_794 172
263 iso_pu_bacteria 2738541277 2738720960 172
264 iso_pu_bacteria 2738543019 2739280159 172
265 3300003187 JGI25151J46595_10020576 JGI25151J46595_100205763 173
266 3300003773 Ga0055537_1000209 Ga0055537_100020931 173
267 3300003784 Ga0055534_1000204 Ga0055534_100020431 173
268 3300003790 Ga0055528_1003427 Ga0055528_10034273 173
269 3300005288 Ga0065714_10216478 Ga0065714_102164781 173
270 3300005289 Ga0065704_10079770 Ga0065704_100797704 173
271 3300005356 Ga0070674_100709060 Ga0070674_1007090601 173
272 3300005548 Ga0070665_100853263 Ga0070665_1008532631 173
273 3300006038 Ga0075365_10117633 Ga0075365_101176332 173
274 3300006048 Ga0075363_100012897 Ga0075363_1000128974 173
275 3300006051 Ga0075364_10137464 Ga0075364_101374642 173
276 3300006051 Ga0075364_10154921 Ga0075364_101549212 173
277 3300006051 Ga0075364_10207720 Ga0075364_102077202 173
278 3300006177 Ga0075362_10150991 Ga0075362_101509912 173
279 3300006186 Ga0075369_10023446 Ga0075369_100234462 173
280 3300006195 Ga0075366_10021503 Ga0075366_100215032 173
281 3300006195 Ga0075366_10101276 Ga0075366_101012762 173
282 3300006353 Ga0075370_10043316 Ga0075370_100433163 173
283 3300006353 Ga0075370_10600488 Ga0075370_106004881 173
284 3300006948 Ga0099826_10001202 Ga0099826_100012028 173
285 3300011119 Ga0105246_10288504 Ga0105246_102885042 173
286 3300013104 Ga0157370_10004270 Ga0157370_100042703 173
287 3300014497 Ga0182008_10015665 Ga0182008_100156655 173
288 3300014497 Ga0182008_10253248 Ga0182008_102532482 173
289 3300015265 Ga0182005_1040779 Ga0182005_10407792 173
290 3300017792 Ga0163161_10078880 Ga0163161_100788803 173
291 3300025263 Ga0209565_1000067 Ga0209565_100006718 173
292 3300025273 Ga0209673_1000813 Ga0209673_100081318 173
293 3300025273 Ga0209673_1005029 Ga0209673_10050296 173
294 3300025291 Ga0209675_1000038 Ga0209675_1000038226 173
295 3300025291 Ga0209675_1062156 Ga0209675_10621561 173
296 3300025294 Ga0209025_1000256 Ga0209025_100025624 173
297 3300025294 Ga0209025_1008021 Ga0209025_10080219 173
298 3300025299 Ga0209256_1033565 Ga0209256_10335652 173
299 3300025937 Ga0207669_10090407 Ga0207669_100904073 173
300 3300027666 Ga0209282_1000783 Ga0209282_10007838 173
301 3300028379 Ga0268266_11360689 Ga0268266_113606891 173
302 3300030733 Ga0314311_1042926 Ga0314311_10429262 173
303 3300030735 Ga0316178_1167009 Ga0316178_11670093 173
304 3300030742 Ga0316183_1014268 Ga0316183_10142683 173
305 3300030744 Ga0316181_1028028 Ga0316181_10280282 173
306 3300030745 Ga0316182_1367254 Ga0316182_13672543 173
307 3300031548 Ga0307408_100112906 Ga0307408_1001129062 173
308 3300031548 Ga0307408_100257025 Ga0307408_1002570252 173
309 3300031649 Ga0307514_10298404 Ga0307514_102984042 173
310 3300031731 Ga0307405_10125408 Ga0307405_101254082 173
311 3300031824 Ga0307413_10511332 Ga0307413_105113322 173
312 3300031901 Ga0307406_10520917 Ga0307406_105209171 173
313 3300031901 Ga0307406_11202309 Ga0307406_112023092 173
314 3300031903 Ga0307407_10129642 Ga0307407_101296422 173
315 3300031911 Ga0307412_10604546 Ga0307412_106045462 173
316 3300031995 Ga0307409_101128296 Ga0307409_1011282961 173
317 3300032002 Ga0307416_100288975 Ga0307416_1002889752 173
318 3300032004 Ga0307414_10311315 Ga0307414_103113152 173
319 3300032005 Ga0307411_10080623 Ga0307411_100806232 173
320 3300032126 Ga0307415_100352880 Ga0307415_1003528802 173
321 3300041404 Ga0439436_0011858 Ga0439436_0011858_1249_1785 173
322 3300041411 Ga0439466_0029330 Ga0439466_0029330_862_1398 173
323 3300041997 Ga0439431_0025322 Ga0439431_0025322_675_1211 173
324 3300042002 Ga0439442_009764 Ga0439442_009764_1100_1636 173
325 3300042014 Ga0439457_061858 Ga0439457_061858_231_767 173
326 3300042121 Ga0450919_004238 Ga0450919_004238_530_1066 173
327 3300042123 Ga0450921_001266 Ga0450921_001266_614_1150 173
328 3300042125 Ga0450923_028841 Ga0450923_028841_28_564 173
329 3300042127 Ga0450890_001380 Ga0450890_001380_402_938 173
330 3300042133 Ga0450896_018697 Ga0450896_018697_153_689 173
331 3300042134 Ga0450898_013417 Ga0450898_013417_155_691 173
332 3300042144 Ga0450889_008887 Ga0450889_008887_268_804 173
333 3300042145 Ga0450906_001304 Ga0450906_001304_3474_4010 173
334 3300042146 Ga0450907_026086 Ga0450907_026086_32_568 173
335 3300042156 Ga0439446_0013416 Ga0439446_0013416_663_1199 173
336 3300042184 Ga0450908_003863 Ga0450908_003863_812_1348 173
337 3300042185 Ga0450909_016111 Ga0450909_016111_497_1033 173
338 3300042435 Ga0439434_0001666 Ga0439434_0001666_4798_5334 173
339 3300042531 Ga0450918_000646 Ga0450918_000646_5009_5545 173
340 3300046536 Ga0495587_0180076 Ga0495587_0180076_110_634 173
341 3300046660 Ga0495625_0000317 Ga0495625_0000317_47413_47949 173
342 3300046663 Ga0495635_0061776 Ga0495635_0061776_1569_2093 173
343 3300046663 Ga0495635_0324827 Ga0495635_0324827_37_561 173
344 3300046809 Ga0495600_0484382 Ga0495600_0484382_91_615 173
345 3300049679 Ga0501249_073185 Ga0501249_073185_78_623 173
346 3300049686 Ga0501257_027513 Ga0501257_027513_298_843 173
347 3300049705 Ga0501225_0015128 Ga0501225_0015128_1111_1656 173
348 3300049759 Ga0501262_000018 Ga0501262_000018_3213_3758 173
349 3300050490 nmdc:mga03n38_7236_c1 nmdc:mga03n38_7236_c1_2367_2903 173
350 3300050491 nmdc:mga00v17_156201_c1 nmdc:mga00v17_156201_c1_324_860 173
351 3300050491 nmdc:mga00v17_84781_c1 nmdc:mga00v17_84781_c1_1258_1791 173
352 3300050492 nmdc:mga0yw44_43535_c1 nmdc:mga0yw44_43535_c1_581_1114 173
353 3300050493 nmdc:mga0k408_297233_c1 nmdc:mga0k408_297233_c1_194_727 173
354 3300050494 nmdc:mga06z11_130184_c1 nmdc:mga06z11_130184_c1_464_1000 173
355 3300050496 nmdc:mga07m45_198301_c1 nmdc:mga07m45_198301_c1_321_917 173
356 3300050496 nmdc:mga07m45_717_c1 nmdc:mga07m45_717_c1_9408_9944 173
357 3300053094 Ga0500566_0173588 Ga0500566_0173588_240_764 173
358 3300053120 Ga0500597_010292 Ga0500597_010292_2065_2589 173
359 3300053128 Ga0500626_011551 Ga0500626_011551_2430_2954 173
360 3300053136 Ga0500559_0009248 Ga0500559_0009248_3425_3949 173
361 3300053141 Ga0500574_000920 Ga0500574_000920_185_709 173
362 3300053734 Ga0500565_006842 Ga0500565_006842_36_560 173
363 iso_pu_bacteria 2643221628 2644162003 173
364 iso_pu_bacteria 2842677519 2842677723 173
365 iso_pu_bacteria 2919462493 2919467030 173
366 iso_pu_bacteria 2945945610 2945946295 173
367 3300003187 JGI25151J46595_10003724 JGI25151J46595_100037244 174
368 3300003578 Ga0006562J51391_1185878 Ga0006562J51391_11858782 174
369 3300003578 Ga0006562J51391_1185879 Ga0006562J51391_11858793 174
370 3300003781 Ga0055536_1002962 Ga0055536_10029624 174
371 3300003792 Ga0055540_1001679 Ga0055540_100167913 174
372 3300003792 Ga0055540_1003903 Ga0055540_10039035 174
373 3300005289 Ga0065704_10116658 Ga0065704_101166582 174
374 3300005337 Ga0070682_100123835 Ga0070682_1001238352 174
375 3300005844 Ga0068862_100052478 Ga0068862_1000524782 174
376 3300006048 Ga0075363_100150276 Ga0075363_1001502762 174
377 3300006177 Ga0075362_10200882 Ga0075362_102008822 174
378 3300006178 Ga0075367_10073359 Ga0075367_100733592 174
379 3300006195 Ga0075366_10014761 Ga0075366_100147614 174
380 3300006353 Ga0075370_10019488 Ga0075370_100194884 174
381 3300006353 Ga0075370_10562864 Ga0075370_105628642 174
382 3300009148 Ga0105243_10001924 Ga0105243_1000192411 174
383 3300009148 Ga0105243_10111349 Ga0105243_101113493 174
384 3300013100 Ga0157373_10016909 Ga0157373_100169092 174
385 3300014497 Ga0182008_10016000 Ga0182008_100160004 174
386 3300015261 Ga0182006_1109449 Ga0182006_11094492 174
387 3300017792 Ga0163161_10000118 Ga0163161_1000011855 174
388 3300025258 Ga0209129_1003340 Ga0209129_10033407 174
389 3300025292 Ga0209676_1001150 Ga0209676_10011508 174
390 3300025294 Ga0209025_1001146 Ga0209025_100114625 174
391 3300025303 Ga0209051_1000524 Ga0209051_100052413 174
392 3300025303 Ga0209051_1002812 Ga0209051_10028128 174
393 3300025304 Ga0209257_1013860 Ga0209257_10138603 174
394 3300025935 Ga0207709_10000393 Ga0207709_1000039311 174
395 3300025935 Ga0207709_10012050 Ga0207709_100120502 174
396 3300027866 Ga0209813_10048698 Ga0209813_100486982 174
397 3300028380 Ga0268265_10046194 Ga0268265_100461941 174
398 3300028794 Ga0307515_10267298 Ga0307515_102672982 174
399 3300028794 Ga0307515_10366861 Ga0307515_103668612 174
400 3300030745 Ga0316182_1441758 Ga0316182_14417585 174
401 3300031548 Ga0307408_100306406 Ga0307408_1003064062 174
402 3300031731 Ga0307405_10007333 Ga0307405_100073336 174
403 3300031731 Ga0307405_10178765 Ga0307405_101787652 174
404 3300031901 Ga0307406_10001607 Ga0307406_1000160711 174
405 3300031911 Ga0307412_10021730 Ga0307412_100217302 174
406 3300032002 Ga0307416_100026006 Ga0307416_1000260063 174
407 3300046453 Ga0495627_010015 Ga0495627_010015_2263_2790 174
408 3300046512 Ga0495610_0147190 Ga0495610_0147190_219_746 174
409 3300046515 Ga0495620_0016821 Ga0495620_0016821_1211_1738 174
410 3300046520 Ga0495637_0005086 Ga0495637_0005086_2093_2620 174
411 3300046520 Ga0495637_0089320 Ga0495637_0089320_532_1059 174
412 3300046524 Ga0495648_0163055 Ga0495648_0163055_17_544 174
413 3300046538 Ga0495609_0067022 Ga0495609_0067022_689_1216 174
414 3300046616 Ga0495668_0087054 Ga0495668_0087054_99_626 174
415 3300046665 Ga0495661_0102383 Ga0495661_0102383_866_1393 174
416 3300046674 Ga0495588_0107293 Ga0495588_0107293_261_794 174
417 3300046674 Ga0495588_0250622 Ga0495588_0250622_116_643 174
418 3300046692 Ga0495671_0004483 Ga0495671_0004483_5193_5720 174
419 3300047321 Ga0495676_0287066 Ga0495676_0287066_420_947 174
420 3300048089 Ga0495614_0129899 Ga0495614_0129899_126_653 174
421 3300048925 Ga0496122_0004921 Ga0496122_0004921_6969_7514 174
422 3300048925 Ga0496122_0265134 Ga0496122_0265134_387_932 174
423 3300048926 Ga0496123_0016510 Ga0496123_0016510_1050_1595 174
424 3300048926 Ga0496123_0171601 Ga0496123_0171601_59_604 174
425 3300048928 Ga0496125_0002144 Ga0496125_0002144_14825_15370 174
426 3300048928 Ga0496125_0125693 Ga0496125_0125693_97_627 174
427 3300050491 nmdc:mga00v17_219035_c1 nmdc:mga00v17_219035_c1_694_1221 174
428 3300050493 nmdc:mga0k408_33143_c1 nmdc:mga0k408_33143_c1_492_1019 174
429 3300050495 nmdc:mga04h51_177562_c1 nmdc:mga04h51_177562_c1_149_676 174
430 3300050496 nmdc:mga07m45_308583_c1 nmdc:mga07m45_308583_c1_331_861 174
431 3300050496 nmdc:mga07m45_359_c1 nmdc:mga07m45_359_c1_17948_18475 174
432 3300053079 Ga0500610_0001194 Ga0500610_0001194_265_792 174
433 3300053079 Ga0500610_0003828 Ga0500610_0003828_4303_4830 174
434 3300053079 Ga0500610_0014318 Ga0500610_0014318_1025_1552 174
435 3300053079 Ga0500610_0021251 Ga0500610_0021251_2339_2866 174
436 3300053109 Ga0500569_014646 Ga0500569_014646_1069_1596 174
437 3300053117 Ga0500593_004698 Ga0500593_004698_2681_3208 174
438 3300053121 Ga0500607_001581 Ga0500607_001581_1443_1970 174
439 3300053122 Ga0500608_021577 Ga0500608_021577_1567_2094 174
440 3300053158 Ga0500627_0002042 Ga0500627_0002042_2279_2806 174
441 3300053161 Ga0500634_0014871 Ga0500634_0014871_964_1491 174
442 3300001979 JGI24740J21852_10011757 JGI24740J21852_100117574 175
443 3300002773 JGI25152J39213_1002329 JGI25152J39213_10023297 175
444 3300002773 JGI25152J39213_1016824 JGI25152J39213_10168242 175
445 3300002774 JGI25150J39212_1009812 JGI25150J39212_10098122 175
446 3300002987 JGI25159J45721_1001905 JGI25159J45721_10019052 175
447 3300003187 JGI25151J46595_10002951 JGI25151J46595_1000295110 175
448 3300003187 JGI25151J46595_10057752 JGI25151J46595_100577522 175
449 3300003215 JGI25153J46596_10001657 JGI25153J46596_100016578 175
450 3300003320 rootH2_10096142 rootH2_100961421 175
451 3300003320 rootH2_10123516 rootH2_101235162 175
452 3300003354 JGI25160J50197_1001991 JGI25160J50197_100199110 175
453 3300003374 JGI25161J50226_1002482 JGI25161J50226_10024822 175
454 3300003374 JGI25161J50226_1004114 JGI25161J50226_10041143 175
455 3300003578 Ga0006562J51391_1093197 Ga0006562J51391_10931972 175
456 3300003578 Ga0006562J51391_1093198 Ga0006562J51391_10931981 175
457 3300003760 Ga0055527_1003577 Ga0055527_10035772 175
458 3300003761 Ga0055535_1000075 Ga0055535_100007516 175
459 3300003762 Ga0055542_1000059 Ga0055542_100005963 175
460 3300003771 Ga0055526_1002846 Ga0055526_100284610 175
461 3300003771 Ga0055526_1002969 Ga0055526_10029692 175
462 3300003773 Ga0055537_1001136 Ga0055537_100113610 175
463 3300003775 Ga0055524_1002030 Ga0055524_10020302 175
464 3300003775 Ga0055524_1015150 Ga0055524_10151502 175
465 3300003781 Ga0055536_1002541 Ga0055536_10025413 175
466 3300003784 Ga0055534_1000804 Ga0055534_10008042 175
467 3300003790 Ga0055528_1002005 Ga0055528_10020052 175
468 3300003790 Ga0055528_1003539 Ga0055528_10035397 175
469 3300003791 Ga0055530_10002967 Ga0055530_100029673 175
470 3300003792 Ga0055540_1002578 Ga0055540_10025782 175
471 3300003792 Ga0055540_1004405 Ga0055540_10044054 175
472 3300003794 Ga0055531_10004538 Ga0055531_100045382 175
473 3300003794 Ga0055531_10008029 Ga0055531_100080292 175
474 3300004625 Ga0055543_1000691 Ga0055543_100069114 175
475 3300005262 Ga0065165_1001721 Ga0065165_100172118 175
476 3300005262 Ga0065165_1020858 Ga0065165_10208582 175
477 3300005344 Ga0070661_100668913 Ga0070661_1006689131 175
478 3300005366 Ga0070659_100205417 Ga0070659_1002054172 175
479 3300005457 Ga0070662_100006218 Ga0070662_1000062184 175
480 3300005539 Ga0068853_100034583 Ga0068853_1000345834 175
481 3300005539 Ga0068853_100911312 Ga0068853_1009113121 175
482 3300005563 Ga0068855_100009804 Ga0068855_1000098047 175
483 3300005577 Ga0068857_100191727 Ga0068857_1001917273 175
484 3300005577 Ga0068857_100858486 Ga0068857_1008584862 175
485 3300005578 Ga0068854_100399625 Ga0068854_1003996252 175
486 3300005616 Ga0068852_100577588 Ga0068852_1005775881 175
487 3300006353 Ga0075370_10013978 Ga0075370_100139782 175
488 3300009036 Ga0105244_10000885 Ga0105244_1000088512 175
489 3300009093 Ga0105240_10229832 Ga0105240_102298323 175
490 3300009093 Ga0105240_10521870 Ga0105240_105218702 175
491 3300009148 Ga0105243_10228979 Ga0105243_102289792 175
492 3300009545 Ga0105237_10002891 Ga0105237_1000289119 175
493 3300009551 Ga0105238_10444580 Ga0105238_104445802 175
494 3300010375 Ga0105239_10016338 Ga0105239_100163387 175
495 3300013102 Ga0157371_10038348 Ga0157371_100383483 175
496 3300013104 Ga0157370_10078782 Ga0157370_100787823 175
497 3300013105 Ga0157369_10008062 Ga0157369_1000806214 175
498 3300013105 Ga0157369_10252691 Ga0157369_102526912 175
499 3300014497 Ga0182008_10002038 Ga0182008_1000203812 175
500 3300015261 Ga0182006_1001611 Ga0182006_10016118 175
501 3300015262 Ga0182007_10000330 Ga0182007_100003309 175
502 3300025208 Ga0209436_105659 Ga0209436_1056592 175
503 3300025228 Ga0209672_100197 Ga0209672_10019730 175
504 3300025229 Ga0209147_101305 Ga0209147_1013054 175
505 3300025242 Ga0209258_100078 Ga0209258_10007884 175
506 3300025245 Ga0207425_1000191 Ga0207425_100019123 175
507 3300025245 Ga0207425_1006189 Ga0207425_10061892 175
508 3300025254 Ga0209148_1000086 Ga0209148_100008684 175
509 3300025258 Ga0209129_1000116 Ga0209129_100011680 175
510 3300025263 Ga0209565_1000133 Ga0209565_100013373 175
511 3300025263 Ga0209565_1003501 Ga0209565_10035012 175
512 3300025263 Ga0209565_1003507 Ga0209565_10035072 175
513 3300025273 Ga0209673_1000190 Ga0209673_100019058 175
514 3300025273 Ga0209673_1000315 Ga0209673_100031560 175
515 3300025284 Ga0209130_1000159 Ga0209130_100015929 175
516 3300025284 Ga0209130_1000727 Ga0209130_100072711 175
517 3300025291 Ga0209675_1000282 Ga0209675_100028218 175
518 3300025291 Ga0209675_1004578 Ga0209675_10045782 175
519 3300025292 Ga0209676_1000125 Ga0209676_100012596 175
520 3300025292 Ga0209676_1021797 Ga0209676_10217972 175
521 3300025294 Ga0209025_1000293 Ga0209025_100029360 175
522 3300025295 Ga0209564_1000201 Ga0209564_100020160 175
523 3300025295 Ga0209564_1000535 Ga0209564_100053552 175
524 3300025297 Ga0209758_1000034 Ga0209758_100003460 175
525 3300025297 Ga0209758_1009697 Ga0209758_10096977 175
526 3300025298 Ga0209050_1000012 Ga0209050_1000012688 175
527 3300025298 Ga0209050_1013990 Ga0209050_10139902 175
528 3300025299 Ga0209256_1000066 Ga0209256_100006624 175
529 3300025299 Ga0209256_1000270 Ga0209256_100027062 175
530 3300025302 Ga0207426_1000244 Ga0207426_100024444 175
531 3300025302 Ga0207426_1000369 Ga0207426_100036927 175
532 3300025303 Ga0209051_1000134 Ga0209051_100013434 175
533 3300025303 Ga0209051_1041598 Ga0209051_10415982 175
534 3300025304 Ga0209257_1000024 Ga0209257_1000024634 175
535 3300025304 Ga0209257_1001178 Ga0209257_10011788 175
536 3300025728 Ga0207655_1011175 Ga0207655_10111755 175
537 3300025924 Ga0207694_10376305 Ga0207694_103763052 175
538 3300025932 Ga0207690_10395189 Ga0207690_103951892 175
539 3300025933 Ga0207706_10066902 Ga0207706_100669022 175
540 3300025935 Ga0207709_10019386 Ga0207709_100193863 175
541 3300025949 Ga0207667_10011022 Ga0207667_100110227 175
542 3300025981 Ga0207640_10123126 Ga0207640_101231262 175
543 3300026041 Ga0207639_10700683 Ga0207639_107006832 175
544 3300026067 Ga0207678_10741366 Ga0207678_107413661 175
545 3300026078 Ga0207702_10802628 Ga0207702_108026282 175
546 3300026116 Ga0207674_10245300 Ga0207674_102453002 175
547 3300026116 Ga0207674_10345131 Ga0207674_103451312 175
548 3300026142 Ga0207698_10204742 Ga0207698_102047422 175
549 3300041486 Ga0451807_1433404 Ga0451807_1433404_869_1399 175
550 3300041509 Ga0451843_0690356 Ga0451843_0690356_291_821 175
551 3300048904 Ga0496101_0150063 Ga0496101_0150063_89_622 175
552 3300048919 Ga0496116_0013383 Ga0496116_0013383_1091_1621 175
553 3300048919 Ga0496116_0174389 Ga0496116_0174389_194_721 175
554 3300048920 Ga0496117_0010561 Ga0496117_0010561_2750_3277 175
555 3300048920 Ga0496117_0050980 Ga0496117_0050980_1870_2400 175
556 3300048920 Ga0496117_0098143 Ga0496117_0098143_1235_1762 175
557 3300048921 Ga0496118_0022115 Ga0496118_0022115_3569_4096 175
558 3300048921 Ga0496118_0066201 Ga0496118_0066201_1944_2471 175
559 3300048921 Ga0496118_0128312 Ga0496118_0128312_677_1207 175
560 3300048924 Ga0496121_0039097 Ga0496121_0039097_2345_2875 175
561 3300048925 Ga0496122_0020254 Ga0496122_0020254_3988_4518 175
562 3300048925 Ga0496122_0182590 Ga0496122_0182590_237_773 175
563 3300048926 Ga0496123_0018344 Ga0496123_0018344_3131_3667 175
564 3300048926 Ga0496123_0046335 Ga0496123_0046335_1949_2479 175
565 3300048926 Ga0496123_0130368 Ga0496123_0130368_829_1356 175
566 3300048927 Ga0496124_0002373 Ga0496124_0002373_15092_15622 175
567 3300048927 Ga0496124_0084641 Ga0496124_0084641_544_1071 175
568 3300048927 Ga0496124_0114205 Ga0496124_0114205_1575_2102 175
569 3300048928 Ga0496125_0010225 Ga0496125_0010225_1547_2074 175
570 3300048928 Ga0496125_0198342 Ga0496125_0198342_148_684 175
571 3300050496 nmdc:mga07m45_7194_c1 nmdc:mga07m45_7194_c1_2448_2975 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

41

144

0.94

PF14437

MafB19-deam

MafB19-like deaminase

42

154

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.909 18 129
7bv5-assembly2.cif.gz_B crystal structure of the yeast heterodimeric adat2/3 0.8891 21 126
6vpc-assembly1.cif.gz_E structure of the spcas9 dna adenine base editor - abe8e 0.8738 22 168
7cph-assembly1.cif.gz_A crystal structure of trna adenosine deaminase from bacillus subtilis 0.8698 18 173
5xko-assembly1.cif.gz_A crystal structure of native msmeg3575 deaminase from mycobacterium smegmatis 0.8689 17 170
ID Description Score Start End Superfamily
af_A0A1D8PFE5_422_777_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9455 44 58 2.120.10.80
af_Q95Y87_1_153_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9307 24 129 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9293 23 129 3.40.140.10
af_O59834_3_162_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9179 15 174 3.40.140.10
1tiyB00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9169 22 129 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A4V1U5I9-F1-model_v4 deleted 0.9489 12 157
AF-A0A7U9A4L9-F1-model_v4 deleted 0.9475 12 175
AF-A0A519ELV2-F1-model_v4 Nucleoside deaminase 0.9472 44 175 GO:0002100
GO:0008270
GO:0052717
AF-A0A0P0MEK3-F1-model_v4 Guanine deaminase (EC 3.5.4.3) 0.9462 10 175 GO:0008270
GO:0008892
AF-A0A359KRC9-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9448 18 170 GO:0002100
GO:0008270
GO:0052717

Feature Viewer

pLDDT pTM Quality
90.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map