F464392

General Info

Members Datasets Scaffolds Average Seq Length
566 352 524 145

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10015333|Ga0157374_100153336
Length 178
Sequence MKRSPQGWLKVAAADNLVVQFQGTASMDSFTPLTALIGGGLIGLASAILWLGNGRIAGISGIFGQLLPPAQTVVWRVVFLVALVLGTLAASYLIPGLGVGGPAGKPAVLVSAPAWTAIPTPIWIAAAGLLTGIGTKIGNGCTSGHGVCGLARLSKRSMVAVMIFFGVAIITVAVTRIV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
6 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
7 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
8 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
9 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
10 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
11 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
12 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
13 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
14 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
15 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
16 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
17 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
18 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
19 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
20 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
21 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
22 2643221580 Devosia sp. Root635 Isolate Unclassified
23 2643221609 Acidovorax sp. Root217 Isolate Unclassified
24 2643221611 Acidovorax sp. Root219 Isolate Unclassified
25 2643221629 Devosia sp. Root105 Isolate Unclassified
26 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
27 2643221662 Devosia sp. Root413D1 Isolate Unclassified
28 2643221674 Devosia sp. Root436 Isolate Unclassified
29 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
30 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
31 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
32 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
33 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
34 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
35 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
36 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
37 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
38 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
39 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
40 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
41 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
42 2932401849 Devosia sp. 2618 Isolate Rhizosphere
43 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
206 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
254 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
255 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
258 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
259 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
260 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
261 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
262 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
263 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
264 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
265 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
266 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
267 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
268 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
269 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.4
Metatranscriptomes 0.18
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.77
Nodule 0.18
Rhizoplane 6.54
Rhizosphere 78.09
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3754625 2162886007 Bacteria 1180
2 JGI24739J22299_10054017 3300001989 Bacteria 1288
3 JGI24737J22298_10087323 3300001990 Bacteria 926
4 JGI25152J39213_1009866 3300002773 Bacteria 2229
5 JGI25165J46597_1002712 3300003214 Bacteria 5252
6 JGI25153J46596_10008334 3300003215 Bacteria 4972
7 rootH1_10019850 3300003316 Bacteria 6409
8 rootL2_10007948 3300003322 Bacteria 9221
9 Ga0055526_1005942 3300003771 Bacteria 6804
10 Ga0055524_1000247 3300003775 Bacteria 56379
11 Ga0055536_1052463 3300003781 Bacteria 888
12 Ga0055530_10001019 3300003791 Bacteria 22405
13 Ga0055540_1000729 3300003792 Bacteria 22405
14 Ga0065714_10065246 3300005288 Bacteria 11484
15 Ga0065704_10093382 3300005289 Bacteria 2600
16 Ga0070658_10013399 3300005327 Bacteria 6578
17 Ga0070658_10073850 3300005327 Bacteria 2797
18 Ga0070658_11087767 3300005327 Bacteria 695
19 Ga0070676_10013668 3300005328 Bacteria 4449
20 Ga0070676_10087784 3300005328 Bacteria 1899
21 Ga0070676_10418084 3300005328 Bacteria 936
22 Ga0070690_100280057 3300005330 Bacteria 1189
23 Ga0070670_100081739 3300005331 Bacteria 2776
24 Ga0070677_10019898 3300005333 Bacteria 2438
25 Ga0070677_10118884 3300005333 Bacteria 1191
26 Ga0068869_100013257 3300005334 Bacteria 5478
27 Ga0068869_100825457 3300005334 Bacteria 798
28 Ga0068868_100498358 3300005338 Bacteria 1066
29 Ga0068868_101046226 3300005338 Bacteria 749
30 Ga0070660_100006116 3300005339 Bacteria 8324
31 Ga0070660_100043471 3300005339 Bacteria 3433
32 Ga0070660_100090821 3300005339 Bacteria 2408
33 Ga0070660_100134588 3300005339 Bacteria 1980
34 Ga0070660_100348257 3300005339 Bacteria 1219
35 Ga0070660_100738339 3300005339 Bacteria 826
36 Ga0070687_101420180 3300005343 Bacteria 519
37 Ga0070661_100000248 3300005344 Bacteria 44347
38 Ga0070661_100001221 3300005344 Bacteria 18100
39 Ga0070661_100024508 3300005344 Bacteria 4328
40 Ga0070661_100025444 3300005344 Bacteria 4253
41 Ga0070661_100047172 3300005344 Bacteria 3153
42 Ga0070661_100355627 3300005344 Bacteria 1150
43 Ga0070661_100597568 3300005344 Bacteria 892
44 Ga0070668_100910456 3300005347 Bacteria 787
45 Ga0070669_100285191 3300005353 Bacteria 1324
46 Ga0070675_100018608 3300005354 Bacteria 5529
47 Ga0070675_100494974 3300005354 Bacteria 1101
48 Ga0070675_100550715 3300005354 Bacteria 1043
49 Ga0070674_100034350 3300005356 Bacteria 3386
50 Ga0070673_100424817 3300005364 Bacteria 1192
51 Ga0070673_100467230 3300005364 Bacteria 1137
52 Ga0070659_100067883 3300005366 Bacteria 2828
53 Ga0070659_100083615 3300005366 Bacteria 2552
54 Ga0070659_100195952 3300005366 Bacteria 1662
55 Ga0070667_100098718 3300005367 Bacteria 2520
56 Ga0070667_100789759 3300005367 Bacteria 881
57 Ga0070708_100716652 3300005445 Bacteria 941
58 Ga0070663_100226479 3300005455 Bacteria 1470
59 Ga0070678_100034672 3300005456 Bacteria 3516
60 Ga0070678_100045872 3300005456 Bacteria 3129
61 Ga0070662_101059414 3300005457 Bacteria 695
62 Ga0068867_100089688 3300005459 Bacteria 2332
63 Ga0070685_10236254 3300005466 Bacteria 1204
64 Ga0070685_11548297 3300005466 Bacteria 512
65 Ga0070679_100071081 3300005530 Bacteria 3471
66 Ga0068853_100000349 3300005539 Bacteria 32236
67 Ga0068853_100013217 3300005539 Bacteria 6737
68 Ga0068853_100052062 3300005539 Bacteria 3526
69 Ga0068853_100062881 3300005539 Bacteria 3213
70 Ga0068853_100227595 3300005539 Bacteria 1705
71 Ga0068853_100363451 3300005539 Bacteria 1349
72 Ga0068853_101447830 3300005539 Unclassified 665
73 Ga0070672_100010695 3300005543 Bacteria 6374
74 Ga0070672_100362487 3300005543 Bacteria 1237
75 Ga0070672_100551205 3300005543 Bacteria 1001
76 Ga0070693_100117183 3300005547 Bacteria 1647
77 Ga0070665_100103231 3300005548 Bacteria 2854
78 Ga0070665_100404037 3300005548 Bacteria 1374
79 Ga0070665_100492110 3300005548 Bacteria 1237
80 Ga0070665_101219192 3300005548 Bacteria 763
81 Ga0068855_100058763 3300005563 Bacteria 4502
82 Ga0068855_100106005 3300005563 Bacteria 3231
83 Ga0068855_100182254 3300005563 Bacteria 2374
84 Ga0068855_101297421 3300005563 Bacteria 754
85 Ga0070664_100000183 3300005564 Bacteria 44347
86 Ga0068857_100013461 3300005577 Bacteria 7125
87 Ga0068854_100010975 3300005578 Bacteria 5879
88 Ga0068854_100066513 3300005578 Bacteria 2623
89 Ga0068854_100757654 3300005578 Bacteria 843
90 Ga0068856_100054583 3300005614 Bacteria 3941
91 Ga0068856_100334501 3300005614 Bacteria 1532
92 Ga0070702_100367518 3300005615 Bacteria 1019
93 Ga0068852_100001009 3300005616 Bacteria 18589
94 Ga0068852_100006649 3300005616 Bacteria 8378
95 Ga0068852_100024276 3300005616 Bacteria 4897
96 Ga0068859_100291748 3300005617 Bacteria 1724
97 Ga0068851_10015698 3300005834 Bacteria 3613
98 Ga0068851_10277710 3300005834 Bacteria 957
99 Ga0068851_10699421 3300005834 Bacteria 624
100 Ga0068858_100092511 3300005842 Bacteria 2815
101 Ga0075365_10006101 3300006038 Bacteria 6588
102 Ga0075365_10640614 3300006038 Bacteria 751
103 Ga0075367_10291395 3300006178 Unclassified 1027
104 Ga0075366_10000694 3300006195 Bacteria 15919
105 Ga0075366_10056855 3300006195 Bacteria 2324
106 Ga0075366_10328754 3300006195 Bacteria 937
107 Ga0075366_10392749 3300006195 Bacteria 854
108 Ga0097621_100698264 3300006237 Bacteria 934
109 Ga0097621_101154865 3300006237 Bacteria 728
110 Ga0075370_10015667 3300006353 Bacteria 4064
111 Ga0075370_10542142 3300006353 Bacteria 703
112 Ga0068871_100591616 3300006358 Bacteria 1008
113 Ga0075434_101513657 3300006871 Bacteria 680
114 Ga0068865_100189217 3300006881 Bacteria 1590
115 Ga0097620_100291761 3300006931 Bacteria 1724
116 Ga0075435_100271808 3300007076 Bacteria 1446
117 Ga0099794_10077383 3300007265 Bacteria 1636
118 Ga0099795_10237368 3300007788 Bacteria 782
119 Ga0105244_10000664 3300009036 Bacteria 30176
120 Ga0105244_10001980 3300009036 Bacteria 15825
121 Ga0105240_10071843 3300009093 Bacteria 4279
122 Ga0105240_10689874 3300009093 Bacteria 1116
123 Ga0105245_10618854 3300009098 Bacteria 1111
124 Ga0105245_10960506 3300009098 Bacteria 898
125 Ga0105245_11204680 3300009098 Bacteria 805
126 Ga0114129_11855255 3300009147 Bacteria 732
127 Ga0105243_10016631 3300009148 Bacteria 5563
128 Ga0105241_10086009 3300009174 Bacteria 2472
129 Ga0105241_10174524 3300009174 Bacteria 1777
130 Ga0105241_10193867 3300009174 Bacteria 1693
131 Ga0105241_11715614 3300009174 Bacteria 611
132 Ga0105242_10000355 3300009176 Bacteria 36746
133 Ga0105248_10959647 3300009177 Bacteria 966
134 Ga0105237_10000009 3300009545 Bacteria 337615
135 Ga0105237_10000449 3300009545 Bacteria 58586
136 Ga0105237_10004993 3300009545 Bacteria 15118
137 Ga0105237_10118095 3300009545 Bacteria 2646
138 Ga0105237_10140555 3300009545 Bacteria 2408
139 Ga0105237_10928212 3300009545 Bacteria 877
140 Ga0105238_10007565 3300009551 Bacteria 10884
141 Ga0105238_10052650 3300009551 Bacteria 4092
142 Ga0105238_10177639 3300009551 Bacteria 2106
143 Ga0105238_10525728 3300009551 Bacteria 1186
144 Ga0105238_10975903 3300009551 Unclassified 868
145 Ga0105249_10722870 3300009553 Bacteria 1057
146 Ga0099796_10047611 3300010159 Bacteria 1475
147 Ga0105239_10009975 3300010375 Bacteria 10658
148 Ga0105239_10016218 3300010375 Bacteria 8241
149 Ga0105239_10203545 3300010375 Bacteria 2218
150 Ga0105239_10206296 3300010375 Bacteria 2202
151 Ga0105239_10234949 3300010375 Bacteria 2057
152 Ga0105239_10276985 3300010375 Bacteria 1888
153 Ga0105239_11586695 3300010375 Bacteria 757
154 Ga0105239_12906707 3300010375 Bacteria 559
155 Ga0105246_10007067 3300011119 Bacteria 6871
156 Ga0105246_10009957 3300011119 Bacteria 5865
157 Ga0105246_10389824 3300011119 Bacteria 1153
158 Ga0157373_10019283 3300013100 Bacteria 4967
159 Ga0157373_10173691 3300013100 Bacteria 1516
160 Ga0157371_10008162 3300013102 Bacteria 8371
161 Ga0157371_10199899 3300013102 Bacteria 1432
162 Ga0157370_10034029 3300013104 Bacteria 4965
163 Ga0157370_10080570 3300013104 Bacteria 3065
164 Ga0157370_10113556 3300013104 Bacteria 2531
165 Ga0157370_10358565 3300013104 Bacteria 1344
166 Ga0157369_10005088 3300013105 Bacteria 15391
167 Ga0157369_10517663 3300013105 Bacteria 1234
168 Ga0157374_10015333 3300013296 Bacteria 6722
169 Ga0157374_10266837 3300013296 Bacteria 1687
170 Ga0157378_10286504 3300013297 Bacteria 1590
171 Ga0157378_10867244 3300013297 Bacteria 932
172 Ga0163162_10031279 3300013306 Bacteria 5279
173 Ga0163162_10363558 3300013306 Bacteria 1580
174 Ga0163162_10514174 3300013306 Bacteria 1327
175 Ga0157372_10110687 3300013307 Bacteria 3146
176 Ga0157372_11237453 3300013307 Bacteria 862
177 Ga0157375_10195842 3300013308 Bacteria 2176
178 Ga0157375_10466894 3300013308 Bacteria 1427
179 Ga0163163_10315044 3300014325 Bacteria 1618
180 Ga0163163_12501822 3300014325 Bacteria 574
181 Ga0157380_10103882 3300014326 Bacteria 2372
182 Ga0182008_10002018 3300014497 Bacteria 13020
183 Ga0182008_10159993 3300014497 Bacteria 1133
184 Ga0157379_10146027 3300014968 Bacteria 2133
185 Ga0157379_10204453 3300014968 Bacteria 1786
186 Ga0157376_10488341 3300014969 Bacteria 1208
187 Ga0157376_11357848 3300014969 Bacteria 742
188 Ga0182006_1004913 3300015261 Bacteria 6475
189 Ga0182006_1006449 3300015261 Bacteria 5451
190 Ga0182006_1180099 3300015261 Bacteria 705
191 Ga0182007_10003535 3300015262 Bacteria 7360
192 Ga0163161_10497745 3300017792 Bacteria 992
193 Ga0197907_10579377 3300020069 Bacteria 1244
194 Ga0207427_102147 3300025231 Bacteria 5689
195 Ga0209258_100789 3300025242 Bacteria 19058
196 Ga0207425_1000168 3300025245 Bacteria 55214
197 Ga0209759_1010535 3300025256 Bacteria 2704
198 Ga0209129_1000215 3300025258 Bacteria 66656
199 Ga0209233_1004974 3300025261 Bacteria 4467
200 Ga0209565_1041173 3300025263 Bacteria 860
201 Ga0209673_1027264 3300025273 Bacteria 1861
202 Ga0209675_1016780 3300025291 Bacteria 2118
203 Ga0209676_1001989 3300025292 Bacteria 16215
204 Ga0209564_1000057 3300025295 Bacteria 340400
205 Ga0209758_1000174 3300025297 Bacteria 147347
206 Ga0209050_1000013 3300025298 Bacteria 811408
207 Ga0209050_1035778 3300025298 Bacteria 1462
208 Ga0209256_1000049 3300025299 Bacteria 310696
209 Ga0209051_1000007 3300025303 Bacteria 811408
210 Ga0209257_1015932 3300025304 Bacteria 3081
211 Ga0209257_1080089 3300025304 Bacteria 840
212 Ga0207656_10019076 3300025321 Bacteria 2709
213 Ga0207656_10210265 3300025321 Bacteria 943
214 Ga0207655_1000114 3300025728 Bacteria 164098
215 Ga0207682_10018862 3300025893 Bacteria 2698
216 Ga0207682_10082214 3300025893 Bacteria 1383
217 Ga0207647_10140797 3300025904 Bacteria 1413
218 Ga0207647_10418958 3300025904 Bacteria 753
219 Ga0207645_10088213 3300025907 Bacteria 1994
220 Ga0207645_10148175 3300025907 Bacteria 1531
221 Ga0207645_10317823 3300025907 Bacteria 1038
222 Ga0207705_10037978 3300025909 Bacteria 3447
223 Ga0207705_10132289 3300025909 Bacteria 1857
224 Ga0207705_10159067 3300025909 Bacteria 1696
225 Ga0207654_10077951 3300025911 Bacteria 1988
226 Ga0207654_10087759 3300025911 Bacteria 1888
227 Ga0207654_10269808 3300025911 Bacteria 1147
228 Ga0207695_10000377 3300025913 Bacteria 101452
229 Ga0207695_10066670 3300025913 Bacteria 3696
230 Ga0207671_10000439 3300025914 Bacteria 57260
231 Ga0207671_10000690 3300025914 Bacteria 43659
232 Ga0207671_11034178 3300025914 Bacteria 646
233 Ga0207657_10015968 3300025919 Bacteria 7252
234 Ga0207657_10018131 3300025919 Bacteria 6734
235 Ga0207657_10184285 3300025919 Bacteria 1686
236 Ga0207657_10312317 3300025919 Bacteria 1244
237 Ga0207657_10425471 3300025919 Bacteria 1043
238 Ga0207649_10000032 3300025920 Bacteria 143552
239 Ga0207649_10000527 3300025920 Bacteria 26665
240 Ga0207649_10030843 3300025920 Bacteria 3180
241 Ga0207649_10054321 3300025920 Bacteria 2492
242 Ga0207649_10384235 3300025920 Bacteria 1047
243 Ga0207681_10112919 3300025923 Bacteria 1980
244 Ga0207694_10041037 3300025924 Bacteria 3565
245 Ga0207694_10041776 3300025924 Bacteria 3535
246 Ga0207694_10396681 3300025924 Bacteria 1147
247 Ga0207694_10520193 3300025924 Bacteria 997
248 Ga0207659_10017487 3300025926 Bacteria 4685
249 Ga0207659_10177059 3300025926 Bacteria 1687
250 Ga0207687_10391192 3300025927 Bacteria 1141
251 Ga0207644_10345667 3300025931 Bacteria 1207
252 Ga0207690_10041697 3300025932 Bacteria 3010
253 Ga0207690_10119285 3300025932 Bacteria 1913
254 Ga0207706_10223119 3300025933 Bacteria 1650
255 Ga0207686_10005728 3300025934 Bacteria 6662
256 Ga0207709_10335451 3300025935 Bacteria 1136
257 Ga0207669_10857292 3300025937 Bacteria 756
258 Ga0207704_10067468 3300025938 Bacteria 2251
259 Ga0207691_10012108 3300025940 Bacteria 8268
260 Ga0207691_10310158 3300025940 Bacteria 1354
261 Ga0207711_10724682 3300025941 Bacteria 927
262 Ga0207661_11416485 3300025944 Unclassified 638
263 Ga0207679_10000059 3300025945 Bacteria 101268
264 Ga0207667_10067980 3300025949 Bacteria 3711
265 Ga0207667_10082813 3300025949 Bacteria 3322
266 Ga0207667_10089702 3300025949 Bacteria 3177
267 Ga0207667_10201064 3300025949 Bacteria 2044
268 Ga0207667_11644889 3300025949 Bacteria 610
269 Ga0207651_10634082 3300025960 Bacteria 937
270 Ga0207668_10285333 3300025972 Bacteria 1356
271 Ga0207640_10005936 3300025981 Bacteria 6667
272 Ga0207658_10310958 3300025986 Bacteria 1361
273 Ga0207677_10185116 3300026023 Bacteria 1642
274 Ga0207677_10528235 3300026023 Bacteria 1025
275 Ga0207703_10134246 3300026035 Bacteria 2141
276 Ga0207639_10004587 3300026041 Bacteria 9298
277 Ga0207639_10004923 3300026041 Bacteria 9000
278 Ga0207639_10141089 3300026041 Bacteria 2007
279 Ga0207639_10700599 3300026041 Bacteria 940
280 Ga0207639_11055228 3300026041 Unclassified 762
281 Ga0207678_10336824 3300026067 Bacteria 1299
282 Ga0207702_10062913 3300026078 Bacteria 3171
283 Ga0207702_10167064 3300026078 Bacteria 2014
284 Ga0207702_10316997 3300026078 Bacteria 1484
285 Ga0207702_10381417 3300026078 Bacteria 1356
286 Ga0207702_10956391 3300026078 Bacteria 849
287 Ga0207702_11409813 3300026078 Bacteria 690
288 Ga0207641_10423736 3300026088 Bacteria 1282
289 Ga0207648_10011938 3300026089 Bacteria 8154
290 Ga0207648_10113554 3300026089 Bacteria 2379
291 Ga0207648_10491976 3300026089 Bacteria 1121
292 Ga0207674_10012591 3300026116 Bacteria 9454
293 Ga0207683_10014515 3300026121 Bacteria 6709
294 Ga0207683_10020075 3300026121 Bacteria 5711
295 Ga0207698_10004973 3300026142 Bacteria 8149
296 Ga0207698_10041277 3300026142 Bacteria 3436
297 Ga0207698_10378417 3300026142 Bacteria 1346
298 Ga0207698_10524860 3300026142 Bacteria 1156
299 Ga0209179_1050355 3300027512 Bacteria 892
300 Ga0209983_1050188 3300027665 Bacteria 912
301 Ga0209588_1029425 3300027671 Bacteria 1752
302 Ga0209588_1030664 3300027671 Bacteria 1718
303 Ga0209588_1059549 3300027671 Bacteria 1235
304 Ga0268266_10000474 3300028379 Bacteria 57849
305 Ga0268266_10040674 3300028379 Bacteria 3964
306 Ga0268266_10840110 3300028379 Bacteria 887
307 Ga0268266_11629458 3300028379 Bacteria 621
308 Ga0268264_10195034 3300028381 Bacteria 1849
309 Ga0307517_10319547 3300028786 Bacteria 860
310 Ga0307515_10033350 3300028794 Bacteria 8483
311 Ga0307515_10554195 3300028794 Bacteria 759
312 Ga0265338_10000057 3300028800 Bacteria 200477
313 Ga0265338_10128681 3300028800 Bacteria 2004
314 Ga0314311_1242699 3300030733 Bacteria 4146
315 Ga0316183_1105814 3300030742 Bacteria 2486
316 Ga0265332_10003905 3300031238 Bacteria 7110
317 Ga0265328_10045331 3300031239 Bacteria 1617
318 Ga0265320_10028777 3300031240 Bacteria 2882
319 Ga0265325_10010008 3300031241 Bacteria 5509
320 Ga0265339_10000389 3300031249 Bacteria 34751
321 Ga0265327_10181342 3300031251 Bacteria 963
322 Ga0265316_10019457 3300031344 Bacteria 5807
323 Ga0307513_10080893 3300031456 Bacteria 3349
324 Ga0307509_10220205 3300031507 Bacteria 1712
325 Ga0307408_100000662 3300031548 Bacteria 28690
326 Ga0307408_100350498 3300031548 Bacteria 1252
327 Ga0307408_100408660 3300031548 Bacteria 1167
328 Ga0307408_100602420 3300031548 Bacteria 976
329 Ga0265313_10000449 3300031595 Bacteria 43511
330 Ga0265314_10036366 3300031711 Bacteria 3579
331 Ga0265314_10038798 3300031711 Bacteria 3438
332 Ga0265314_10051063 3300031711 Bacteria 2882
333 Ga0316578_10579214 3300031728 Bacteria 658
334 Ga0307516_10000689 3300031730 Bacteria 45886
335 Ga0307413_10681687 3300031824 Bacteria 851
336 Ga0307406_10291971 3300031901 Bacteria 1248
337 Ga0307412_11059169 3300031911 Bacteria 719
338 Ga0307416_100431834 3300032002 Bacteria 1365
339 Ga0307416_100607673 3300032002 Bacteria 1174
340 Ga0307416_100873905 3300032002 Bacteria 998
341 Ga0307416_102185210 3300032002 Bacteria 655
342 Ga0307414_10059427 3300032004 Bacteria 2699
343 Ga0307414_10071544 3300032004 Bacteria 2502
344 Ga0307414_10083384 3300032004 Bacteria 2347
345 Ga0307414_10091941 3300032004 Bacteria 2257
346 Ga0307414_10155180 3300032004 Bacteria 1811
347 Ga0307414_10668757 3300032004 Bacteria 937
348 Ga0307414_10855571 3300032004 Bacteria 832
349 Ga0307414_11508637 3300032004 Bacteria 626
350 Ga0307411_10058265 3300032005 Bacteria 2555
351 Ga0373926_0003426 3300035083 Bacteria 5115
352 Ga0373934_0095599 3300035086 Bacteria 1200
353 Ga0373940_0111205 3300035088 Bacteria 841
354 Ga0373944_0033220 3300035089 Bacteria 1562
355 Ga0373923_0009192 3300035111 Bacteria 3557
356 Ga0373923_0200787 3300035111 Bacteria 922
357 Ga0373936_0044790 3300035113 Bacteria 1781
358 Ga0373945_0007902 3300035116 Bacteria 3452
359 Ga0373954_0203607 3300035118 Bacteria 972
360 Ga0373956_0036765 3300035119 Bacteria 2162
361 Ga0373956_0153094 3300035119 Bacteria 1085
362 Ga0373960_0404473 3300035121 Bacteria 527
363 Ga0373955_0080419 3300035172 Bacteria 1840
364 Ga0316574_0255744 3300035398 Bacteria 1119
365 Ga0373924_0572862 3300035410 Unclassified 509
366 Ga0373931_0037837 3300035691 Bacteria 2521
367 Ga0373931_0190064 3300035691 Bacteria 1221
368 Ga0373935_0006183 3300035692 Bacteria 7124
369 Ga0373927_0035932 3300035695 Bacteria 3223
370 Ga0373933_0090079 3300035724 Bacteria 1892
371 Ga0373947_0006814 3300035725 Bacteria 6625
372 Ga0373937_0002210 3300036401 Bacteria 16263
373 Ga0373937_0195950 3300036401 Bacteria 1899
374 Ga0373925_0005295 3300037068 Bacteria 9627
375 Ga0373925_0128688 3300037068 Bacteria 1972
376 Ga0373925_1127660 3300037068 Bacteria 645
377 Ga0395899_0177782 3300037312 Bacteria 1495
378 Ga0395899_0251771 3300037312 Bacteria 1212
379 Ga0395898_0053933 3300037466 Bacteria 3925
380 Ga0395898_1141859 3300037466 Unclassified 711
381 Ga0395898_1569571 3300037466 Bacteria 583
382 Ga0395905_0219153 3300037471 Bacteria 1781
383 Ga0395905_0286446 3300037471 Bacteria 1534
384 Ga0395901_0612107 3300038443 Bacteria 1097
385 Ga0439453_0165312 3300041408 Unclassified 532
386 Ga0439465_0027030 3300041413 Bacteria 1816
387 Ga0451787_716454 3300041441 Bacteria 661
388 Ga0451802_0714199 3300041460 Bacteria 959
389 Ga0451843_1176783 3300041509 Bacteria 591
390 Ga0439431_0157539 3300041997 Bacteria 648
391 Ga0439437_018917 3300042000 Bacteria 825
392 Ga0439449_0059913 3300042007 Bacteria 1405
393 Ga0439456_157216 3300042013 Bacteria 531
394 Ga0439463_004390 3300042016 Bacteria 3534
395 Ga0439463_036476 3300042016 Bacteria 1245
396 Ga0450917_000350 3300042120 Bacteria 3472
397 Ga0450888_000965 3300042126 Bacteria 2725
398 Ga0450890_005423 3300042127 Bacteria 1639
399 Ga0450890_005467 3300042127 Bacteria 1632
400 Ga0450897_033604 3300042128 Bacteria 587
401 Ga0450891_000163 3300042129 Bacteria 6353
402 Ga0450898_023790 3300042134 Bacteria 1091
403 Ga0450889_016539 3300042144 Bacteria 797
404 Ga0450889_031320 3300042144 Bacteria 622
405 Ga0439435_0077967 3300042436 Bacteria 990
406 Ga0450893_0001105 3300042532 Bacteria 4063
407 Ga0466969_0206080 3300044656 Bacteria 896
408 Ga0466977_0001086 3300044666 Bacteria 10619
409 Ga0466961_0135814 3300044693 Bacteria 1541
410 Ga0466957_0615945 3300044842 Bacteria 761
411 Ga0451576_0000449 3300045051 Bacteria 93533
412 Ga0495629_0003586 3300046459 Bacteria 11724
413 Ga0495651_0155334 3300046462 Bacteria 1645
414 Ga0495580_0013721 3300046472 Bacteria 6171
415 Ga0495580_0354821 3300046472 Bacteria 993
416 Ga0495582_0038825 3300046473 Bacteria 2620
417 Ga0495594_0027819 3300046499 Bacteria 3048
418 Ga0495630_0014687 3300046517 Bacteria 5709
419 Ga0495663_0051852 3300046525 Bacteria 1272
420 Ga0495666_0179758 3300046526 Bacteria 977
421 Ga0495642_0087674 3300046528 Bacteria 1315
422 Ga0495665_0081907 3300046531 Bacteria 1696
423 Ga0495597_0007752 3300046542 Bacteria 5425
424 Ga0495667_0292134 3300046559 Bacteria 1033
425 Ga0495656_0152991 3300046615 Bacteria 1115
426 Ga0495588_0139811 3300046674 Bacteria 1279
427 Ga0495623_0012224 3300046679 Bacteria 5562
428 Ga0495647_0004812 3300046681 Bacteria 4406
429 Ga0495658_0009719 3300046683 Bacteria 4796
430 Ga0495658_0093980 3300046683 Bacteria 1780
431 Ga0495613_0039733 3300046689 Bacteria 3487
432 Ga0495600_0037333 3300046809 Bacteria 3158
433 Ga0495581_0003509 3300047315 Bacteria 9003
434 Ga0495636_0120403 3300047318 Bacteria 1160
435 Ga0495684_0026211 3300047471 Bacteria 4478
436 Ga0495593_0126968 3300047673 Bacteria 1296
437 Ga0495602_0037020 3300048088 Bacteria 4533
438 Ga0495614_0292362 3300048089 Bacteria 752
439 Ga0496100_0050912 3300048903 Bacteria 2686
440 Ga0496100_1319693 3300048903 Bacteria 569
441 Ga0496101_0052251 3300048904 Bacteria 2946
442 Ga0496101_0603828 3300048904 Bacteria 867
443 Ga0496102_0368988 3300048905 Bacteria 1351
444 Ga0496104_0036185 3300048907 Bacteria 4613
445 Ga0496104_0194483 3300048907 Bacteria 1940
446 Ga0496104_0515672 3300048907 Bacteria 1107
447 Ga0496105_0007005 3300048908 Bacteria 8683
448 Ga0496105_0023729 3300048908 Bacteria 4979
449 Ga0496108_0940579 3300048911 Bacteria 740
450 Ga0496110_0055974 3300048913 Bacteria 3471
451 Ga0496111_0190562 3300048914 Bacteria 1524
452 Ga0496112_0043895 3300048915 Bacteria 4377
453 Ga0496113_0050121 3300048916 Bacteria 3111
454 Ga0496114_0046024 3300048917 Bacteria 3625
455 Ga0496115_0183109 3300048918 Bacteria 1731
456 Ga0496115_0270725 3300048918 Bacteria 1395
457 Ga0496119_0000421 3300048922 Bacteria 58350
458 Ga0496120_0396148 3300048923 Bacteria 611
459 Ga0496121_0010360 3300048924 Bacteria 10529
460 Ga0496121_0015914 3300048924 Bacteria 7814
461 Ga0496122_0003947 3300048925 Bacteria 18963
462 Ga0496122_0075138 3300048925 Bacteria 2386
463 Ga0496123_0032480 3300048926 Bacteria 3778
464 Ga0496123_0084574 3300048926 Bacteria 1913
465 Ga0496124_0061921 3300048927 Bacteria 3134
466 Ga0496124_0100189 3300048927 Bacteria 2349
467 Ga0496125_0000207 3300048928 Bacteria 122897
468 Ga0496125_0000988 3300048928 Bacteria 44327
469 Ga0496125_0010905 3300048928 Bacteria 9138
470 Ga0496125_0017457 3300048928 Bacteria 6839
471 Ga0496125_0146114 3300048928 Bacteria 1634
472 Ga0496126_0024961 3300048929 Bacteria 5762
473 Ga0496126_0176182 3300048929 Bacteria 1819
474 Ga0496126_0181233 3300048929 Bacteria 1789
475 Ga0501032_0008188 3300049569 Bacteria 7619
476 Ga0501032_0182944 3300049569 Bacteria 1372
477 Ga0501033_0572350 3300049570 Bacteria 777
478 Ga0501034_0004211 3300049571 Bacteria 16059
479 Ga0501034_0016743 3300049571 Bacteria 7516
480 Ga0501034_0231939 3300049571 Bacteria 1794
481 Ga0501034_0274143 3300049571 Bacteria 1627
482 Ga0501034_0553868 3300049571 Bacteria 1059
483 Ga0501034_0661794 3300049571 Bacteria 945
484 Ga0501034_1016692 3300049571 Bacteria 712
485 Ga0501036_1306718 3300049572 Bacteria 589
486 Ga0501037_0041212 3300049573 Bacteria 3396
487 Ga0501037_0119831 3300049573 Bacteria 1892
488 Ga0501038_0008126 3300049574 Bacteria 9659
489 Ga0501038_0304222 3300049574 Bacteria 1251
490 Ga0501043_0452369 3300049579 Bacteria 964
491 Ga0501046_0440395 3300049580 Bacteria 938
492 Ga0501047_0089830 3300049581 Bacteria 2949
493 Ga0501047_0782199 3300049581 Bacteria 769
494 Ga0501067_0278909 3300049583 Bacteria 931
495 Ga0501068_0268738 3300049584 Bacteria 1089
496 Ga0501070_0053374 3300049586 Bacteria 3353
497 Ga0501070_0056786 3300049586 Bacteria 3245
498 Ga0501071_0442410 3300049587 Bacteria 995
499 Ga0501072_0142574 3300049588 Bacteria 1911
500 Ga0501072_0865955 3300049588 Bacteria 706
501 Ga0501073_0301961 3300049589 Bacteria 1104
502 Ga0501074_0132382 3300049590 Bacteria 1784
503 Ga0501076_1014595 3300049592 Bacteria 684
504 Ga0501227_035318 3300049665 Bacteria 1216
505 Ga0501079_0289843 3300049741 Bacteria 1280
506 Ga0501079_0689985 3300049741 Unclassified 804
507 Ga0501080_0304668 3300049742 Bacteria 1444
508 Ga0501080_0410538 3300049742 Bacteria 1217
509 Ga0501044_0081773 3300049823 Bacteria 3269
510 Ga0501044_0199360 3300049823 Bacteria 1960
511 Ga0501044_0400512 3300049823 Bacteria 1285
512 nmdc:mga03683_65761_c1 3300050489 Bacteria 1540
513 nmdc:mga03n38_172687_c1 3300050490 Bacteria 1102
514 nmdc:mga0k408_327260_c1 3300050493 Bacteria 914
515 nmdc:mga06z11_625803_c1 3300050494 Bacteria 655
516 nmdc:mga07m45_5883_c1 3300050496 Bacteria 6156
517 nmdc:mga0sz30_241257_c1 3300050516 Unclassified 804
518 Ga0495601_0435023 3300053077 Bacteria 849
519 Ga0495595_0109724 3300053084 Bacteria 1337
520 Ga0495619_0012434 3300053085 Bacteria 5360
521 Ga0500595_063350 3300053119 Bacteria 1111
522 Ga0500604_0000191 3300053151 Bacteria 17521
523 Ga0500634_0006404 3300053161 Bacteria 5694
524 Ga0500634_0335580 3300053161 Bacteria 583

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0304222 Ga0501038_0304222_565_1002 111
2 3300049580 Ga0501046_0440395 Ga0501046_0440395_269_706 111
3 3300049584 Ga0501068_0268738 Ga0501068_0268738_546_983 111
4 3300049741 Ga0501079_0289843 Ga0501079_0289843_175_612 111
5 3300049742 Ga0501080_0410538 Ga0501080_0410538_148_585 111
6 3300049588 Ga0501072_0142574 Ga0501072_0142574_860_1297 112
7 3300049823 Ga0501044_0081773 Ga0501044_0081773_2075_2512 112
8 3300049570 Ga0501033_0572350 Ga0501033_0572350_60_542 116
9 3300042128 Ga0450897_033604 Ga0450897_033604_23_382 118
10 3300003316 rootH1_10019850 rootH1_100198506 120
11 3300003322 rootL2_10007948 rootL2_1000794812 120
12 3300049569 Ga0501032_0182944 Ga0501032_0182944_788_1270 120
13 3300049571 Ga0501034_0274143 Ga0501034_0274143_699_1181 120
14 3300049581 Ga0501047_0089830 Ga0501047_0089830_2058_2540 120
15 3300049586 Ga0501070_0056786 Ga0501070_0056786_1867_2349 120
16 3300049589 Ga0501073_0301961 Ga0501073_0301961_236_718 120
17 3300049590 Ga0501074_0132382 Ga0501074_0132382_1205_1687 120
18 3300049742 Ga0501080_0304668 Ga0501080_0304668_330_812 120
19 3300049823 Ga0501044_0400512 Ga0501044_0400512_776_1258 120
20 3300010375 Ga0105239_10016218 Ga0105239_100162189 121
21 3300025914 Ga0207671_11034178 Ga0207671_110341781 121
22 3300014968 Ga0157379_10146027 Ga0157379_101460272 122
23 3300014969 Ga0157376_11357848 Ga0157376_113578482 122
24 3300035121 Ga0373960_0404473 Ga0373960_0404473_43_477 122
25 3300035691 Ga0373931_0037837 Ga0373931_0037837_1793_2227 122
26 3300048903 Ga0496100_1319693 Ga0496100_1319693_118_552 122
27 3300048907 Ga0496104_0515672 Ga0496104_0515672_622_1056 122
28 3300032002 Ga0307416_100607673 Ga0307416_1006076732 125
29 3300032002 Ga0307416_102185210 Ga0307416_1021852102 125
30 3300041408 Ga0439453_0165312 Ga0439453_0165312_16_450 125
31 3300048907 Ga0496104_0194483 Ga0496104_0194483_1278_1754 130
32 3300048908 Ga0496105_0007005 Ga0496105_0007005_4096_4572 130
33 3300046525 Ga0495663_0051852 Ga0495663_0051852_466_900 131
34 3300046528 Ga0495642_0087674 Ga0495642_0087674_340_774 131
35 3300047318 Ga0495636_0120403 Ga0495636_0120403_227_661 131
36 3300009545 Ga0105237_10118095 Ga0105237_101180953 132
37 3300042127 Ga0450890_005467 Ga0450890_005467_33_461 132
38 3300042144 Ga0450889_031320 Ga0450889_031320_176_604 132
39 iso_pu_bacteria 2643221580 2643912379 132
40 iso_pu_bacteria 2643221629 2644167844 132
41 iso_pu_bacteria 2643221662 2644349303 132
42 iso_pu_bacteria 2643221674 2644410696 132
43 iso_pu_bacteria 2932401849 2932403428 132
44 3300037068 Ga0373925_0128688 Ga0373925_0128688_1346_1780 133
45 3300002773 JGI25152J39213_1009866 JGI25152J39213_10098662 135
46 3300003215 JGI25153J46596_10008334 JGI25153J46596_100083344 135
47 3300003771 Ga0055526_1005942 Ga0055526_10059429 135
48 3300025245 Ga0207425_1000168 Ga0207425_100016839 135
49 3300025258 Ga0209129_1000215 Ga0209129_100021516 135
50 3300025273 Ga0209673_1027264 Ga0209673_10272643 135
51 3300025295 Ga0209564_1000057 Ga0209564_1000057222 135
52 3300025297 Ga0209758_1000174 Ga0209758_100017456 135
53 3300028786 Ga0307517_10319547 Ga0307517_103195471 135
54 3300028794 Ga0307515_10033350 Ga0307515_100333503 135
55 3300028794 Ga0307515_10554195 Ga0307515_105541951 135
56 3300031456 Ga0307513_10080893 Ga0307513_100808934 135
57 3300032004 Ga0307414_11508637 Ga0307414_115086371 135
58 3300041460 Ga0451802_0714199 Ga0451802_0714199_103_543 135
59 3300042000 Ga0439437_018917 Ga0439437_018917_117_545 135
60 3300042120 Ga0450917_000350 Ga0450917_000350_2685_3113 135
61 3300042127 Ga0450890_005423 Ga0450890_005423_892_1320 135
62 3300048924 Ga0496121_0015914 Ga0496121_0015914_6834_7280 135
63 3300048928 Ga0496125_0146114 Ga0496125_0146114_494_940 135
64 3300001989 JGI24739J22299_10054017 JGI24739J22299_100540172 136
65 3300001990 JGI24737J22298_10087323 JGI24737J22298_100873232 136
66 3300003214 JGI25165J46597_1002712 JGI25165J46597_10027123 136
67 3300005327 Ga0070658_10013399 Ga0070658_100133993 136
68 3300005327 Ga0070658_10073850 Ga0070658_100738503 136
69 3300005328 Ga0070676_10087784 Ga0070676_100877843 136
70 3300005334 Ga0068869_100825457 Ga0068869_1008254571 136
71 3300005339 Ga0070660_100043471 Ga0070660_1000434715 136
72 3300005339 Ga0070660_100134588 Ga0070660_1001345882 136
73 3300005339 Ga0070660_100348257 Ga0070660_1003482572 136
74 3300005339 Ga0070660_100738339 Ga0070660_1007383392 136
75 3300005343 Ga0070687_101420180 Ga0070687_1014201801 136
76 3300005344 Ga0070661_100001221 Ga0070661_10000122110 136
77 3300005344 Ga0070661_100024508 Ga0070661_1000245085 136
78 3300005344 Ga0070661_100025444 Ga0070661_1000254442 136
79 3300005344 Ga0070661_100047172 Ga0070661_1000471724 136
80 3300005344 Ga0070661_100355627 Ga0070661_1003556272 136
81 3300005354 Ga0070675_100494974 Ga0070675_1004949742 136
82 3300005354 Ga0070675_100550715 Ga0070675_1005507152 136
83 3300005366 Ga0070659_100083615 Ga0070659_1000836153 136
84 3300005366 Ga0070659_100195952 Ga0070659_1001959522 136
85 3300005455 Ga0070663_100226479 Ga0070663_1002264792 136
86 3300005456 Ga0070678_100045872 Ga0070678_1000458723 136
87 3300005459 Ga0068867_100089688 Ga0068867_1000896883 136
88 3300005466 Ga0070685_10236254 Ga0070685_102362542 136
89 3300005539 Ga0068853_100000349 Ga0068853_10000034921 136
90 3300005539 Ga0068853_100013217 Ga0068853_1000132174 136
91 3300005539 Ga0068853_100052062 Ga0068853_1000520623 136
92 3300005539 Ga0068853_100062881 Ga0068853_1000628813 136
93 3300005539 Ga0068853_100363451 Ga0068853_1003634511 136
94 3300005539 Ga0068853_101447830 Ga0068853_1014478301 136
95 3300005543 Ga0070672_100551205 Ga0070672_1005512052 136
96 3300005547 Ga0070693_100117183 Ga0070693_1001171833 136
97 3300005548 Ga0070665_100103231 Ga0070665_1001032313 136
98 3300005548 Ga0070665_100404037 Ga0070665_1004040373 136
99 3300005563 Ga0068855_100058763 Ga0068855_1000587635 136
100 3300005563 Ga0068855_100182254 Ga0068855_1001822543 136
101 3300005563 Ga0068855_101297421 Ga0068855_1012974212 136
102 3300005577 Ga0068857_100013461 Ga0068857_1000134615 136
103 3300005578 Ga0068854_100010975 Ga0068854_1000109755 136
104 3300005614 Ga0068856_100054583 Ga0068856_1000545832 136
105 3300005616 Ga0068852_100001009 Ga0068852_1000010095 136
106 3300005616 Ga0068852_100006649 Ga0068852_1000066495 136
107 3300005616 Ga0068852_100024276 Ga0068852_1000242764 136
108 3300005834 Ga0068851_10015698 Ga0068851_100156983 136
109 3300005834 Ga0068851_10277710 Ga0068851_102777102 136
110 3300006178 Ga0075367_10291395 Ga0075367_102913952 136
111 3300006195 Ga0075366_10328754 Ga0075366_103287542 136
112 3300006237 Ga0097621_101154865 Ga0097621_1011548651 136
113 3300006358 Ga0068871_100591616 Ga0068871_1005916161 136
114 3300006881 Ga0068865_100189217 Ga0068865_1001892173 136
115 3300009093 Ga0105240_10071843 Ga0105240_100718433 136
116 3300009098 Ga0105245_10618854 Ga0105245_106188542 136
117 3300009098 Ga0105245_10960506 Ga0105245_109605062 136
118 3300009098 Ga0105245_11204680 Ga0105245_112046801 136
119 3300009174 Ga0105241_10086009 Ga0105241_100860092 136
120 3300009174 Ga0105241_10174524 Ga0105241_101745242 136
121 3300009174 Ga0105241_10193867 Ga0105241_101938673 136
122 3300009545 Ga0105237_10000449 Ga0105237_1000044931 136
123 3300009545 Ga0105237_10140555 Ga0105237_101405552 136
124 3300009551 Ga0105238_10007565 Ga0105238_100075653 136
125 3300009551 Ga0105238_10975903 Ga0105238_109759031 136
126 3300009553 Ga0105249_10722870 Ga0105249_107228702 136
127 3300010375 Ga0105239_10009975 Ga0105239_100099757 136
128 3300010375 Ga0105239_10203545 Ga0105239_102035452 136
129 3300010375 Ga0105239_10206296 Ga0105239_102062961 136
130 3300010375 Ga0105239_10234949 Ga0105239_102349493 136
131 3300010375 Ga0105239_10276985 Ga0105239_102769853 136
132 3300010375 Ga0105239_11586695 Ga0105239_115866952 136
133 3300010375 Ga0105239_12906707 Ga0105239_129067071 136
134 3300013100 Ga0157373_10173691 Ga0157373_101736912 136
135 3300013102 Ga0157371_10008162 Ga0157371_100081623 136
136 3300013104 Ga0157370_10034029 Ga0157370_100340293 136
137 3300013104 Ga0157370_10080570 Ga0157370_100805702 136
138 3300013104 Ga0157370_10358565 Ga0157370_103585652 136
139 3300013105 Ga0157369_10517663 Ga0157369_105176631 136
140 3300013296 Ga0157374_10266837 Ga0157374_102668372 136
141 3300013297 Ga0157378_10286504 Ga0157378_102865042 136
142 3300013307 Ga0157372_10110687 Ga0157372_101106872 136
143 3300013307 Ga0157372_11237453 Ga0157372_112374532 136
144 3300014325 Ga0163163_10315044 Ga0163163_103150442 136
145 3300014497 Ga0182008_10159993 Ga0182008_101599932 136
146 3300015261 Ga0182006_1180099 Ga0182006_11800991 136
147 3300020069 Ga0197907_10579377 Ga0197907_105793771 136
148 3300025231 Ga0207427_102147 Ga0207427_1021477 136
149 3300025261 Ga0209233_1004974 Ga0209233_10049743 136
150 3300025321 Ga0207656_10019076 Ga0207656_100190762 136
151 3300025321 Ga0207656_10210265 Ga0207656_102102652 136
152 3300025904 Ga0207647_10140797 Ga0207647_101407972 136
153 3300025904 Ga0207647_10418958 Ga0207647_104189581 136
154 3300025909 Ga0207705_10037978 Ga0207705_100379783 136
155 3300025909 Ga0207705_10132289 Ga0207705_101322892 136
156 3300025911 Ga0207654_10077951 Ga0207654_100779512 136
157 3300025911 Ga0207654_10087759 Ga0207654_100877593 136
158 3300025911 Ga0207654_10269808 Ga0207654_102698082 136
159 3300025913 Ga0207695_10066670 Ga0207695_100666704 136
160 3300025914 Ga0207671_10000439 Ga0207671_100004395 136
161 3300025919 Ga0207657_10018131 Ga0207657_100181314 136
162 3300025919 Ga0207657_10184285 Ga0207657_101842852 136
163 3300025919 Ga0207657_10312317 Ga0207657_103123172 136
164 3300025919 Ga0207657_10425471 Ga0207657_104254711 136
165 3300025920 Ga0207649_10000527 Ga0207649_1000052710 136
166 3300025920 Ga0207649_10030843 Ga0207649_100308432 136
167 3300025920 Ga0207649_10054321 Ga0207649_100543212 136
168 3300025920 Ga0207649_10384235 Ga0207649_103842351 136
169 3300025924 Ga0207694_10041776 Ga0207694_100417764 136
170 3300025924 Ga0207694_10520193 Ga0207694_105201931 136
171 3300025926 Ga0207659_10177059 Ga0207659_101770593 136
172 3300025927 Ga0207687_10391192 Ga0207687_103911922 136
173 3300025931 Ga0207644_10345667 Ga0207644_103456672 136
174 3300025932 Ga0207690_10041697 Ga0207690_100416973 136
175 3300025932 Ga0207690_10119285 Ga0207690_101192852 136
176 3300025935 Ga0207709_10335451 Ga0207709_103354512 136
177 3300025938 Ga0207704_10067468 Ga0207704_100674683 136
178 3300025940 Ga0207691_10310158 Ga0207691_103101582 136
179 3300025944 Ga0207661_11416485 Ga0207661_114164852 136
180 3300025949 Ga0207667_10067980 Ga0207667_100679804 136
181 3300025949 Ga0207667_10082813 Ga0207667_100828131 136
182 3300025972 Ga0207668_10285333 Ga0207668_102853332 136
183 3300026023 Ga0207677_10185116 Ga0207677_101851162 136
184 3300026041 Ga0207639_10004587 Ga0207639_1000458711 136
185 3300026041 Ga0207639_10004923 Ga0207639_100049231 136
186 3300026041 Ga0207639_10141089 Ga0207639_101410892 136
187 3300026041 Ga0207639_10700599 Ga0207639_107005992 136
188 3300026041 Ga0207639_11055228 Ga0207639_110552281 136
189 3300026067 Ga0207678_10336824 Ga0207678_103368242 136
190 3300026078 Ga0207702_10062913 Ga0207702_100629133 136
191 3300026078 Ga0207702_10167064 Ga0207702_101670642 136
192 3300026078 Ga0207702_10316997 Ga0207702_103169972 136
193 3300026078 Ga0207702_10381417 Ga0207702_103814172 136
194 3300026078 Ga0207702_10956391 Ga0207702_109563911 136
195 3300026089 Ga0207648_10113554 Ga0207648_101135543 136
196 3300026089 Ga0207648_10491976 Ga0207648_104919762 136
197 3300026116 Ga0207674_10012591 Ga0207674_100125916 136
198 3300026121 Ga0207683_10020075 Ga0207683_100200753 136
199 3300026142 Ga0207698_10004973 Ga0207698_100049732 136
200 3300026142 Ga0207698_10041277 Ga0207698_100412773 136
201 3300026142 Ga0207698_10524860 Ga0207698_105248602 136
202 3300027665 Ga0209983_1050188 Ga0209983_10501882 136
203 3300028379 Ga0268266_10000474 Ga0268266_1000047444 136
204 3300028379 Ga0268266_10840110 Ga0268266_108401101 136
205 3300028800 Ga0265338_10128681 Ga0265338_101286813 136
206 3300031240 Ga0265320_10028777 Ga0265320_100287774 136
207 3300031241 Ga0265325_10010008 Ga0265325_100100085 136
208 3300031249 Ga0265339_10000389 Ga0265339_1000038914 136
209 3300031344 Ga0265316_10019457 Ga0265316_100194573 136
210 3300031595 Ga0265313_10000449 Ga0265313_1000044938 136
211 3300031711 Ga0265314_10036366 Ga0265314_100363665 136
212 3300031711 Ga0265314_10051063 Ga0265314_100510634 136
213 3300032002 Ga0307416_100873905 Ga0307416_1008739052 136
214 3300032004 Ga0307414_10059427 Ga0307414_100594273 136
215 3300032004 Ga0307414_10071544 Ga0307414_100715443 136
216 3300032004 Ga0307414_10083384 Ga0307414_100833842 136
217 3300032004 Ga0307414_10091941 Ga0307414_100919413 136
218 3300032004 Ga0307414_10855571 Ga0307414_108555712 136
219 3300035088 Ga0373940_0111205 Ga0373940_0111205_331_774 136
220 3300035111 Ga0373923_0009192 Ga0373923_0009192_2501_2944 136
221 3300035119 Ga0373956_0036765 Ga0373956_0036765_1046_1489 136
222 3300035172 Ga0373955_0080419 Ga0373955_0080419_546_989 136
223 3300035691 Ga0373931_0190064 Ga0373931_0190064_445_888 136
224 3300035724 Ga0373933_0090079 Ga0373933_0090079_190_633 136
225 3300036401 Ga0373937_0002210 Ga0373937_0002210_8155_8598 136
226 3300037068 Ga0373925_1127660 Ga0373925_1127660_99_539 136
227 3300037312 Ga0395899_0177782 Ga0395899_0177782_275_718 136
228 3300037466 Ga0395898_1141859 Ga0395898_1141859_101_544 136
229 3300041413 Ga0439465_0027030 Ga0439465_0027030_1050_1508 136
230 3300041441 Ga0451787_716454 Ga0451787_716454_195_635 136
231 3300041509 Ga0451843_1176783 Ga0451843_1176783_118_576 136
232 3300046679 Ga0495623_0012224 Ga0495623_0012224_854_1297 136
233 3300048088 Ga0495602_0037020 Ga0495602_0037020_3856_4299 136
234 3300048905 Ga0496102_0368988 Ga0496102_0368988_723_1181 136
235 3300049571 Ga0501034_0004211 Ga0501034_0004211_11789_12241 136
236 3300049571 Ga0501034_0016743 Ga0501034_0016743_4869_5309 136
237 3300049571 Ga0501034_0231939 Ga0501034_0231939_1287_1730 136
238 3300049571 Ga0501034_0553868 Ga0501034_0553868_103_561 136
239 3300049571 Ga0501034_1016692 Ga0501034_1016692_151_603 136
240 3300049572 Ga0501036_1306718 Ga0501036_1306718_66_524 136
241 3300049573 Ga0501037_0119831 Ga0501037_0119831_544_987 136
242 3300049574 Ga0501038_0008126 Ga0501038_0008126_836_1279 136
243 3300049579 Ga0501043_0452369 Ga0501043_0452369_463_906 136
244 3300049581 Ga0501047_0782199 Ga0501047_0782199_134_577 136
245 3300049583 Ga0501067_0278909 Ga0501067_0278909_210_653 136
246 3300049586 Ga0501070_0053374 Ga0501070_0053374_2032_2475 136
247 3300049587 Ga0501071_0442410 Ga0501071_0442410_509_952 136
248 3300049592 Ga0501076_1014595 Ga0501076_1014595_62_520 136
249 3300049741 Ga0501079_0689985 Ga0501079_0689985_84_521 136
250 3300049823 Ga0501044_0199360 Ga0501044_0199360_1158_1601 136
251 3300050493 nmdc:mga0k408_327260_c1 nmdc:mga0k408_327260_c1_195_653 136
252 3300050494 nmdc:mga06z11_625803_c1 nmdc:mga06z11_625803_c1_177_638 136
253 3300050516 nmdc:mga0sz30_241257_c1 nmdc:mga0sz30_241257_c1_237_695 136
254 3300053151 Ga0500604_0000191 Ga0500604_0000191_1481_1933 136
255 3300053161 Ga0500634_0006404 Ga0500634_0006404_2634_3086 136
256 3300053161 Ga0500634_0335580 Ga0500634_0335580_73_525 136
257 3300005327 Ga0070658_11087767 Ga0070658_110877671 137
258 3300005339 Ga0070660_100006116 Ga0070660_1000061167 137
259 3300005366 Ga0070659_100067883 Ga0070659_1000678833 137
260 3300005530 Ga0070679_100071081 Ga0070679_1000710813 137
261 3300005614 Ga0068856_100334501 Ga0068856_1003345012 137
262 3300006038 Ga0075365_10640614 Ga0075365_106406142 137
263 3300009545 Ga0105237_10928212 Ga0105237_109282121 137
264 3300009551 Ga0105238_10525728 Ga0105238_105257282 137
265 3300025909 Ga0207705_10159067 Ga0207705_101590672 137
266 3300025919 Ga0207657_10015968 Ga0207657_100159683 137
267 3300025924 Ga0207694_10396681 Ga0207694_103966812 137
268 3300025949 Ga0207667_10089702 Ga0207667_100897024 137
269 3300026078 Ga0207702_11409813 Ga0207702_114098132 137
270 3300050490 nmdc:mga03n38_172687_c1 nmdc:mga03n38_172687_c1_17_460 137
271 3300048925 Ga0496122_0003947 Ga0496122_0003947_1707_2156 138
272 3300048926 Ga0496123_0032480 Ga0496123_0032480_1284_1733 138
273 3300048927 Ga0496124_0100189 Ga0496124_0100189_976_1425 138
274 3300048928 Ga0496125_0000988 Ga0496125_0000988_21718_22167 138
275 3300048929 Ga0496126_0024961 Ga0496126_0024961_3056_3505 138
276 iso_pu_bacteria 2643221544 2643745955 138
277 iso_pu_bacteria 2932422444 2932423321 138
278 3300007265 Ga0099794_10077383 Ga0099794_100773831 139
279 3300007788 Ga0099795_10237368 Ga0099795_102373682 139
280 3300010159 Ga0099796_10047611 Ga0099796_100476112 139
281 3300027512 Ga0209179_1050355 Ga0209179_10503552 139
282 3300027671 Ga0209588_1029425 Ga0209588_10294253 139
283 3300027671 Ga0209588_1030664 Ga0209588_10306643 139
284 3300027671 Ga0209588_1059549 Ga0209588_10595491 139
285 3300041997 Ga0439431_0157539 Ga0439431_0157539_10_477 139
286 iso_pu_bacteria 2511231156 2511825074 139
287 iso_pu_bacteria 2547132374 2548501588 139
288 iso_pu_bacteria 2599185212 2599611766 139
289 iso_pu_bacteria 2599185248 2599768914 139
290 iso_pu_bacteria 2599185289 2599884698 139
291 iso_pu_bacteria 2599185291 2599896123 139
292 iso_pu_bacteria 2599185305 2599958009 139
293 iso_pu_bacteria 2599185306 2599968620 139
294 iso_pu_bacteria 2599185308 2599979812 139
295 iso_pu_bacteria 2599185313 2600003903 139
296 iso_pu_bacteria 2599185314 2600013624 139
297 iso_pu_bacteria 2599185315 2600015732 139
298 iso_pu_bacteria 2599185318 2600034021 139
299 iso_pu_bacteria 2599185319 2600040462 139
300 iso_pu_bacteria 2599185321 2600050939 139
301 iso_pu_bacteria 2599185322 2600058618 139
302 iso_pu_bacteria 2599185323 2600063466 139
303 iso_pu_bacteria 2599185324 2600069009 139
304 iso_pu_bacteria 2643221609 2644061992 139
305 iso_pu_bacteria 2643221611 2644076106 139
306 iso_pu_bacteria 2643221650 2644281197 139
307 iso_pu_bacteria 2667528170 2671088817 139
308 iso_pu_bacteria 2808606418 2809147647 139
309 iso_pu_bacteria 2825651385 2825652146 139
310 iso_pu_bacteria 2913036834 2913040236 139
311 iso_pu_bacteria 2923586266 2923588277 139
312 iso_pu_bacteria 2931369376 2931375021 139
313 3300009551 Ga0105238_10177639 Ga0105238_101776393 140
314 3300013102 Ga0157371_10199899 Ga0157371_101998993 140
315 3300013296 Ga0157374_10015333 Ga0157374_100153336 140
316 3300053119 Ga0500595_063350 Ga0500595_063350_426_917 140
317 3300045051 Ga0451576_0000449 Ga0451576_0000449_3648_4076 141
318 3300048904 Ga0496101_0052251 Ga0496101_0052251_2142_2573 141
319 3300048907 Ga0496104_0036185 Ga0496104_0036185_2905_3336 141
320 3300048908 Ga0496105_0023729 Ga0496105_0023729_1845_2276 141
321 3300048911 Ga0496108_0940579 Ga0496108_0940579_254_685 141
322 3300048913 Ga0496110_0055974 Ga0496110_0055974_294_725 141
323 3300048914 Ga0496111_0190562 Ga0496111_0190562_96_527 141
324 3300048915 Ga0496112_0043895 Ga0496112_0043895_3531_3962 141
325 3300048916 Ga0496113_0050121 Ga0496113_0050121_498_929 141
326 3300048918 Ga0496115_0183109 Ga0496115_0183109_344_775 141
327 3300048918 Ga0496115_0270725 Ga0496115_0270725_265_696 141
328 3300048922 Ga0496119_0000421 Ga0496119_0000421_36618_37049 141
329 3300048923 Ga0496120_0396148 Ga0496120_0396148_136_567 141
330 3300048928 Ga0496125_0000207 Ga0496125_0000207_78160_78597 141
331 iso_pu_bacteria 2521172590 2521558260 141
332 iso_pu_bacteria 2904439833 2904440957 141
333 iso_pu_bacteria 2904530477 2904532109 141
334 iso_pu_bacteria 2904584206 2904587662 141
335 iso_pu_bacteria 2904589729 2904590178 141
336 iso_pu_bacteria 2904601388 2904602440 141
337 iso_pu_bacteria 2919079590 2919080060 141
338 3300031728 Ga0316578_10579214 Ga0316578_105792141 142
339 3300035398 Ga0316574_0255744 Ga0316574_0255744_130_567 142
340 3300035410 Ga0373924_0572862 Ga0373924_0572862_19_450 142
341 3300036401 Ga0373937_0195950 Ga0373937_0195950_1144_1638 142
342 3300037466 Ga0395898_1569571 Ga0395898_1569571_40_498 142
343 3300037471 Ga0395905_0286446 Ga0395905_0286446_94_552 142
344 3300042126 Ga0450888_000965 Ga0450888_000965_1039_1467 142
345 3300042129 Ga0450891_000163 Ga0450891_000163_2084_2512 142
346 3300042144 Ga0450889_016539 Ga0450889_016539_190_618 142
347 3300042532 Ga0450893_0001105 Ga0450893_0001105_2065_2493 142
348 3300053077 Ga0495601_0435023 Ga0495601_0435023_89_583 142
349 3300003775 Ga0055524_1000247 Ga0055524_100024731 143
350 3300003781 Ga0055536_1052463 Ga0055536_10524631 143
351 3300003791 Ga0055530_10001019 Ga0055530_100010194 143
352 3300003792 Ga0055540_1000729 Ga0055540_10007294 143
353 3300005288 Ga0065714_10065246 Ga0065714_100652464 143
354 3300005328 Ga0070676_10013668 Ga0070676_100136682 143
355 3300005328 Ga0070676_10418084 Ga0070676_104180842 143
356 3300005330 Ga0070690_100280057 Ga0070690_1002800572 143
357 3300005331 Ga0070670_100081739 Ga0070670_1000817392 143
358 3300005333 Ga0070677_10019898 Ga0070677_100198982 143
359 3300005333 Ga0070677_10118884 Ga0070677_101188842 143
360 3300005334 Ga0068869_100013257 Ga0068869_1000132575 143
361 3300005338 Ga0068868_100498358 Ga0068868_1004983582 143
362 3300005338 Ga0068868_101046226 Ga0068868_1010462261 143
363 3300005339 Ga0070660_100090821 Ga0070660_1000908211 143
364 3300005344 Ga0070661_100000248 Ga0070661_10000024823 143
365 3300005344 Ga0070661_100597568 Ga0070661_1005975682 143
366 3300005347 Ga0070668_100910456 Ga0070668_1009104562 143
367 3300005353 Ga0070669_100285191 Ga0070669_1002851911 143
368 3300005354 Ga0070675_100018608 Ga0070675_1000186082 143
369 3300005356 Ga0070674_100034350 Ga0070674_1000343503 143
370 3300005364 Ga0070673_100424817 Ga0070673_1004248172 143
371 3300005364 Ga0070673_100467230 Ga0070673_1004672303 143
372 3300005367 Ga0070667_100098718 Ga0070667_1000987182 143
373 3300005367 Ga0070667_100789759 Ga0070667_1007897591 143
374 3300005445 Ga0070708_100716652 Ga0070708_1007166522 143
375 3300005456 Ga0070678_100034672 Ga0070678_1000346723 143
376 3300005457 Ga0070662_101059414 Ga0070662_1010594141 143
377 3300005466 Ga0070685_11548297 Ga0070685_115482971 143
378 3300005539 Ga0068853_100227595 Ga0068853_1002275953 143
379 3300005543 Ga0070672_100010695 Ga0070672_1000106954 143
380 3300005543 Ga0070672_100362487 Ga0070672_1003624872 143
381 3300005548 Ga0070665_100492110 Ga0070665_1004921103 143
382 3300005548 Ga0070665_101219192 Ga0070665_1012191922 143
383 3300005564 Ga0070664_100000183 Ga0070664_10000018316 143
384 3300005578 Ga0068854_100757654 Ga0068854_1007576542 143
385 3300005615 Ga0070702_100367518 Ga0070702_1003675182 143
386 3300005617 Ga0068859_100291748 Ga0068859_1002917482 143
387 3300005834 Ga0068851_10699421 Ga0068851_106994212 143
388 3300005842 Ga0068858_100092511 Ga0068858_1000925113 143
389 3300006038 Ga0075365_10006101 Ga0075365_100061018 143
390 3300006195 Ga0075366_10000694 Ga0075366_100006944 143
391 3300006195 Ga0075366_10056855 Ga0075366_100568552 143
392 3300006195 Ga0075366_10392749 Ga0075366_103927492 143
393 3300006353 Ga0075370_10015667 Ga0075370_100156676 143
394 3300006353 Ga0075370_10542142 Ga0075370_105421422 143
395 3300006871 Ga0075434_101513657 Ga0075434_1015136572 143
396 3300006931 Ga0097620_100291761 Ga0097620_1002917612 143
397 3300007076 Ga0075435_100271808 Ga0075435_1002718082 143
398 3300009036 Ga0105244_10000664 Ga0105244_1000066420 143
399 3300009036 Ga0105244_10001980 Ga0105244_100019806 143
400 3300009093 Ga0105240_10689874 Ga0105240_106898743 143
401 3300009147 Ga0114129_11855255 Ga0114129_118552552 143
402 3300009148 Ga0105243_10016631 Ga0105243_100166313 143
403 3300009174 Ga0105241_11715614 Ga0105241_117156141 143
404 3300009176 Ga0105242_10000355 Ga0105242_1000035516 143
405 3300009545 Ga0105237_10000009 Ga0105237_10000009253 143
406 3300011119 Ga0105246_10007067 Ga0105246_100070674 143
407 3300011119 Ga0105246_10009957 Ga0105246_100099573 143
408 3300011119 Ga0105246_10389824 Ga0105246_103898241 143
409 3300013100 Ga0157373_10019283 Ga0157373_100192832 143
410 3300013104 Ga0157370_10113556 Ga0157370_101135562 143
411 3300013105 Ga0157369_10005088 Ga0157369_100050885 143
412 3300013297 Ga0157378_10867244 Ga0157378_108672442 143
413 3300013306 Ga0163162_10031279 Ga0163162_100312797 143
414 3300013306 Ga0163162_10363558 Ga0163162_103635582 143
415 3300013306 Ga0163162_10514174 Ga0163162_105141742 143
416 3300013308 Ga0157375_10195842 Ga0157375_101958423 143
417 3300013308 Ga0157375_10466894 Ga0157375_104668943 143
418 3300014326 Ga0157380_10103882 Ga0157380_101038824 143
419 3300014497 Ga0182008_10002018 Ga0182008_1000201810 143
420 3300014969 Ga0157376_10488341 Ga0157376_104883412 143
421 3300015261 Ga0182006_1006449 Ga0182006_10064493 143
422 3300015262 Ga0182007_10003535 Ga0182007_100035354 143
423 3300017792 Ga0163161_10497745 Ga0163161_104977452 143
424 3300025242 Ga0209258_100789 Ga0209258_10078910 143
425 3300025256 Ga0209759_1010535 Ga0209759_10105353 143
426 3300025263 Ga0209565_1041173 Ga0209565_10411732 143
427 3300025291 Ga0209675_1016780 Ga0209675_10167803 143
428 3300025292 Ga0209676_1001989 Ga0209676_10019897 143
429 3300025298 Ga0209050_1000013 Ga0209050_1000013553 143
430 3300025298 Ga0209050_1035778 Ga0209050_10357782 143
431 3300025299 Ga0209256_1000049 Ga0209256_100004943 143
432 3300025303 Ga0209051_1000007 Ga0209051_1000007553 143
433 3300025304 Ga0209257_1015932 Ga0209257_10159322 143
434 3300025304 Ga0209257_1080089 Ga0209257_10800891 143
435 3300025728 Ga0207655_1000114 Ga0207655_1000114129 143
436 3300025893 Ga0207682_10018862 Ga0207682_100188624 143
437 3300025893 Ga0207682_10082214 Ga0207682_100822142 143
438 3300025907 Ga0207645_10088213 Ga0207645_100882132 143
439 3300025907 Ga0207645_10148175 Ga0207645_101481752 143
440 3300025907 Ga0207645_10317823 Ga0207645_103178232 143
441 3300025914 Ga0207671_10000690 Ga0207671_1000069021 143
442 3300025920 Ga0207649_10000032 Ga0207649_10000032108 143
443 3300025923 Ga0207681_10112919 Ga0207681_101129192 143
444 3300025926 Ga0207659_10017487 Ga0207659_100174874 143
445 3300025933 Ga0207706_10223119 Ga0207706_102231192 143
446 3300025934 Ga0207686_10005728 Ga0207686_100057282 143
447 3300025937 Ga0207669_10857292 Ga0207669_108572922 143
448 3300025940 Ga0207691_10012108 Ga0207691_100121084 143
449 3300025945 Ga0207679_10000059 Ga0207679_1000005924 143
450 3300025949 Ga0207667_11644889 Ga0207667_116448891 143
451 3300025960 Ga0207651_10634082 Ga0207651_106340822 143
452 3300025986 Ga0207658_10310958 Ga0207658_103109581 143
453 3300026023 Ga0207677_10528235 Ga0207677_105282352 143
454 3300026035 Ga0207703_10134246 Ga0207703_101342462 143
455 3300026088 Ga0207641_10423736 Ga0207641_104237362 143
456 3300026089 Ga0207648_10011938 Ga0207648_100119386 143
457 3300026121 Ga0207683_10014515 Ga0207683_100145154 143
458 3300026142 Ga0207698_10378417 Ga0207698_103784172 143
459 3300028379 Ga0268266_10040674 Ga0268266_100406744 143
460 3300028379 Ga0268266_11629458 Ga0268266_116294582 143
461 3300030733 Ga0314311_1242699 Ga0314311_12426994 143
462 3300030742 Ga0316183_1105814 Ga0316183_11058143 143
463 3300031238 Ga0265332_10003905 Ga0265332_100039056 143
464 3300031251 Ga0265327_10181342 Ga0265327_101813422 143
465 3300031548 Ga0307408_100000662 Ga0307408_10000066225 143
466 3300031548 Ga0307408_100350498 Ga0307408_1003504982 143
467 3300031548 Ga0307408_100408660 Ga0307408_1004086602 143
468 3300031548 Ga0307408_100602420 Ga0307408_1006024202 143
469 3300031824 Ga0307413_10681687 Ga0307413_106816872 143
470 3300031901 Ga0307406_10291971 Ga0307406_102919712 143
471 3300031911 Ga0307412_11059169 Ga0307412_110591691 143
472 3300032002 Ga0307416_100431834 Ga0307416_1004318342 143
473 3300032004 Ga0307414_10668757 Ga0307414_106687572 143
474 3300035083 Ga0373926_0003426 Ga0373926_0003426_402_836 143
475 3300035086 Ga0373934_0095599 Ga0373934_0095599_46_480 143
476 3300035089 Ga0373944_0033220 Ga0373944_0033220_1006_1440 143
477 3300035111 Ga0373923_0200787 Ga0373923_0200787_154_588 143
478 3300035113 Ga0373936_0044790 Ga0373936_0044790_484_918 143
479 3300035116 Ga0373945_0007902 Ga0373945_0007902_1988_2422 143
480 3300035118 Ga0373954_0203607 Ga0373954_0203607_378_812 143
481 3300035119 Ga0373956_0153094 Ga0373956_0153094_360_794 143
482 3300035692 Ga0373935_0006183 Ga0373935_0006183_233_667 143
483 3300035695 Ga0373927_0035932 Ga0373927_0035932_2592_3026 143
484 3300035725 Ga0373947_0006814 Ga0373947_0006814_221_655 143
485 3300037068 Ga0373925_0005295 Ga0373925_0005295_8771_9205 143
486 3300037312 Ga0395899_0251771 Ga0395899_0251771_174_608 143
487 3300037466 Ga0395898_0053933 Ga0395898_0053933_2309_2743 143
488 3300037471 Ga0395905_0219153 Ga0395905_0219153_51_485 143
489 3300038443 Ga0395901_0612107 Ga0395901_0612107_466_900 143
490 3300042007 Ga0439449_0059913 Ga0439449_0059913_370_807 143
491 3300042013 Ga0439456_157216 Ga0439456_157216_79_513 143
492 3300042016 Ga0439463_004390 Ga0439463_004390_636_1070 143
493 3300042016 Ga0439463_036476 Ga0439463_036476_292_726 143
494 3300042134 Ga0450898_023790 Ga0450898_023790_26_460 143
495 3300042436 Ga0439435_0077967 Ga0439435_0077967_443_877 143
496 3300044656 Ga0466969_0206080 Ga0466969_0206080_309_755 143
497 3300044666 Ga0466977_0001086 Ga0466977_0001086_9362_9808 143
498 3300046459 Ga0495629_0003586 Ga0495629_0003586_8374_8808 143
499 3300046462 Ga0495651_0155334 Ga0495651_0155334_288_722 143
500 3300046472 Ga0495580_0013721 Ga0495580_0013721_5408_5842 143
501 3300046472 Ga0495580_0354821 Ga0495580_0354821_541_975 143
502 3300046473 Ga0495582_0038825 Ga0495582_0038825_700_1134 143
503 3300046499 Ga0495594_0027819 Ga0495594_0027819_235_669 143
504 3300046517 Ga0495630_0014687 Ga0495630_0014687_4669_5103 143
505 3300046526 Ga0495666_0179758 Ga0495666_0179758_102_536 143
506 3300046531 Ga0495665_0081907 Ga0495665_0081907_775_1209 143
507 3300046542 Ga0495597_0007752 Ga0495597_0007752_2230_2682 143
508 3300046559 Ga0495667_0292134 Ga0495667_0292134_376_810 143
509 3300046615 Ga0495656_0152991 Ga0495656_0152991_557_991 143
510 3300046674 Ga0495588_0139811 Ga0495588_0139811_482_916 143
511 3300046681 Ga0495647_0004812 Ga0495647_0004812_2592_3026 143
512 3300046683 Ga0495658_0009719 Ga0495658_0009719_3165_3599 143
513 3300046683 Ga0495658_0093980 Ga0495658_0093980_102_536 143
514 3300046689 Ga0495613_0039733 Ga0495613_0039733_278_712 143
515 3300046809 Ga0495600_0037333 Ga0495600_0037333_540_974 143
516 3300047315 Ga0495581_0003509 Ga0495581_0003509_2489_2923 143
517 3300047471 Ga0495684_0026211 Ga0495684_0026211_358_792 143
518 3300047673 Ga0495593_0126968 Ga0495593_0126968_480_914 143
519 3300048903 Ga0496100_0050912 Ga0496100_0050912_1032_1463 143
520 3300048904 Ga0496101_0603828 Ga0496101_0603828_174_605 143
521 3300048917 Ga0496114_0046024 Ga0496114_0046024_1886_2320 143
522 3300048924 Ga0496121_0010360 Ga0496121_0010360_4009_4443 143
523 3300048927 Ga0496124_0061921 Ga0496124_0061921_1478_1912 143
524 3300048928 Ga0496125_0010905 Ga0496125_0010905_3119_3553 143
525 3300048928 Ga0496125_0017457 Ga0496125_0017457_728_1162 143
526 3300048929 Ga0496126_0176182 Ga0496126_0176182_1090_1524 143
527 3300048929 Ga0496126_0181233 Ga0496126_0181233_997_1431 143
528 3300049569 Ga0501032_0008188 Ga0501032_0008188_3167_3607 143
529 3300049571 Ga0501034_0661794 Ga0501034_0661794_365_805 143
530 3300049573 Ga0501037_0041212 Ga0501037_0041212_2581_3021 143
531 3300050489 nmdc:mga03683_65761_c1 nmdc:mga03683_65761_c1_681_1115 143
532 3300050496 nmdc:mga07m45_5883_c1 nmdc:mga07m45_5883_c1_5145_5582 143
533 3300053084 Ga0495595_0109724 Ga0495595_0109724_475_909 143
534 3300053085 Ga0495619_0012434 Ga0495619_0012434_2578_3012 143
535 3300009177 Ga0105248_10959647 Ga0105248_109596471 144
536 3300014968 Ga0157379_10204453 Ga0157379_102044533 144
537 3300025941 Ga0207711_10724682 Ga0207711_107246821 144
538 3300028381 Ga0268264_10195034 Ga0268264_101950343 144
539 3300028800 Ga0265338_10000057 Ga0265338_1000005747 144
540 3300031239 Ga0265328_10045331 Ga0265328_100453312 144
541 3300031711 Ga0265314_10038798 Ga0265314_100387985 144
542 3300032004 Ga0307414_10155180 Ga0307414_101551801 144
543 3300032005 Ga0307411_10058265 Ga0307411_100582654 144
544 3300044842 Ga0466957_0615945 Ga0466957_0615945_187_627 144
545 3300049665 Ga0501227_035318 Ga0501227_035318_750_1184 144
546 iso_pu_bacteria 2894023352 2894026313 144
547 3300005563 Ga0068855_100106005 Ga0068855_1001060053 145
548 3300005578 Ga0068854_100066513 Ga0068854_1000665136 145
549 3300009545 Ga0105237_10004993 Ga0105237_100049933 145
550 3300009551 Ga0105238_10052650 Ga0105238_100526502 145
551 3300015261 Ga0182006_1004913 Ga0182006_10049132 145
552 3300025913 Ga0207695_10000377 Ga0207695_1000037780 145
553 3300025924 Ga0207694_10041037 Ga0207694_100410372 145
554 3300025949 Ga0207667_10201064 Ga0207667_102010643 145
555 3300025981 Ga0207640_10005936 Ga0207640_100059363 145
556 3300044693 Ga0466961_0135814 Ga0466961_0135814_1005_1460 145
557 3300006237 Ga0097621_100698264 Ga0097621_1006982642 146
558 3300014325 Ga0163163_12501822 Ga0163163_125018221 146
559 3300031507 Ga0307509_10220205 Ga0307509_102202053 146
560 3300031730 Ga0307516_10000689 Ga0307516_1000068940 146
561 3300048089 Ga0495614_0292362 Ga0495614_0292362_34_540 146
562 3300049588 Ga0501072_0865955 Ga0501072_0865955_135_590 148
563 2162886007 SwRhRL2b_contig_3754625 SwRhRL2b_0880.00003420 149
564 3300005289 Ga0065704_10093382 Ga0065704_100933823 149
565 3300048925 Ga0496122_0075138 Ga0496122_0075138_176_625 149
566 3300048926 Ga0496123_0084574 Ga0496123_0084574_850_1299 149

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.5668 9 105 1.20.1080.10
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4108 9 105 1.20.1080.10
5n9jV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2915 8 104 1.10.287.3490
5n9jV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2845 8 104 1.10.287.3490
ID Description Score Start End GO Terms
AF-A0A7X5LIB8-F1-model_v4 YeeE/YedE family protein 0.842 11 145 GO:0005886
AF-A0A4U9HU60-F1-model_v4 Predicted transporter component 0.8358 1 111 GO:0005886
AF-A0A519GMT9-F1-model_v4 YeeE/YedE family protein 0.8348 1 133 GO:0005886
AF-A0A2N7FPX7-F1-model_v4 Sulphur transport domain-containing protein 0.8327 9 149 GO:0005886
AF-A0A2N1WY04-F1-model_v4 deleted 0.8292 1 122

Feature Viewer

pLDDT pTM Quality
81.32 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map