F464392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 352 | 524 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10015333|Ga0157374_100153336 |
| Length | 178 |
| Sequence | MKRSPQGWLKVAAADNLVVQFQGTASMDSFTPLTALIGGGLIGLASAILWLGNGRIAGISGIFGQLLPPAQTVVWRVVFLVALVLGTLAASYLIPGLGVGGPAGKPAVLVSAPAWTAIPTPIWIAAAGLLTGIGTKIGNGCTSGHGVCGLARLSKRSMVAVMIFFGVAIITVAVTRIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 6 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 7 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 8 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 9 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 10 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 11 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 12 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 13 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 14 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 15 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 16 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 17 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 18 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 19 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 20 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 21 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 22 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 23 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 24 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 25 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 26 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 27 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 28 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 29 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 30 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 31 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 32 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 33 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 34 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 35 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 36 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 37 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 38 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 39 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 40 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 41 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 42 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 43 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 50 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 206 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 252 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 253 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 258 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 259 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 260 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 261 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 262 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 263 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 264 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 265 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 266 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 267 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 268 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 269 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 270 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 271 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 351 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.4 |
| Metatranscriptomes | 0.18 |
| Isolates | 7.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.77 |
| Nodule | 0.18 |
| Rhizoplane | 6.54 |
| Rhizosphere | 78.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3754625 | 2162886007 | Bacteria | 1180 |
| 2 | JGI24739J22299_10054017 | 3300001989 | Bacteria | 1288 |
| 3 | JGI24737J22298_10087323 | 3300001990 | Bacteria | 926 |
| 4 | JGI25152J39213_1009866 | 3300002773 | Bacteria | 2229 |
| 5 | JGI25165J46597_1002712 | 3300003214 | Bacteria | 5252 |
| 6 | JGI25153J46596_10008334 | 3300003215 | Bacteria | 4972 |
| 7 | rootH1_10019850 | 3300003316 | Bacteria | 6409 |
| 8 | rootL2_10007948 | 3300003322 | Bacteria | 9221 |
| 9 | Ga0055526_1005942 | 3300003771 | Bacteria | 6804 |
| 10 | Ga0055524_1000247 | 3300003775 | Bacteria | 56379 |
| 11 | Ga0055536_1052463 | 3300003781 | Bacteria | 888 |
| 12 | Ga0055530_10001019 | 3300003791 | Bacteria | 22405 |
| 13 | Ga0055540_1000729 | 3300003792 | Bacteria | 22405 |
| 14 | Ga0065714_10065246 | 3300005288 | Bacteria | 11484 |
| 15 | Ga0065704_10093382 | 3300005289 | Bacteria | 2600 |
| 16 | Ga0070658_10013399 | 3300005327 | Bacteria | 6578 |
| 17 | Ga0070658_10073850 | 3300005327 | Bacteria | 2797 |
| 18 | Ga0070658_11087767 | 3300005327 | Bacteria | 695 |
| 19 | Ga0070676_10013668 | 3300005328 | Bacteria | 4449 |
| 20 | Ga0070676_10087784 | 3300005328 | Bacteria | 1899 |
| 21 | Ga0070676_10418084 | 3300005328 | Bacteria | 936 |
| 22 | Ga0070690_100280057 | 3300005330 | Bacteria | 1189 |
| 23 | Ga0070670_100081739 | 3300005331 | Bacteria | 2776 |
| 24 | Ga0070677_10019898 | 3300005333 | Bacteria | 2438 |
| 25 | Ga0070677_10118884 | 3300005333 | Bacteria | 1191 |
| 26 | Ga0068869_100013257 | 3300005334 | Bacteria | 5478 |
| 27 | Ga0068869_100825457 | 3300005334 | Bacteria | 798 |
| 28 | Ga0068868_100498358 | 3300005338 | Bacteria | 1066 |
| 29 | Ga0068868_101046226 | 3300005338 | Bacteria | 749 |
| 30 | Ga0070660_100006116 | 3300005339 | Bacteria | 8324 |
| 31 | Ga0070660_100043471 | 3300005339 | Bacteria | 3433 |
| 32 | Ga0070660_100090821 | 3300005339 | Bacteria | 2408 |
| 33 | Ga0070660_100134588 | 3300005339 | Bacteria | 1980 |
| 34 | Ga0070660_100348257 | 3300005339 | Bacteria | 1219 |
| 35 | Ga0070660_100738339 | 3300005339 | Bacteria | 826 |
| 36 | Ga0070687_101420180 | 3300005343 | Bacteria | 519 |
| 37 | Ga0070661_100000248 | 3300005344 | Bacteria | 44347 |
| 38 | Ga0070661_100001221 | 3300005344 | Bacteria | 18100 |
| 39 | Ga0070661_100024508 | 3300005344 | Bacteria | 4328 |
| 40 | Ga0070661_100025444 | 3300005344 | Bacteria | 4253 |
| 41 | Ga0070661_100047172 | 3300005344 | Bacteria | 3153 |
| 42 | Ga0070661_100355627 | 3300005344 | Bacteria | 1150 |
| 43 | Ga0070661_100597568 | 3300005344 | Bacteria | 892 |
| 44 | Ga0070668_100910456 | 3300005347 | Bacteria | 787 |
| 45 | Ga0070669_100285191 | 3300005353 | Bacteria | 1324 |
| 46 | Ga0070675_100018608 | 3300005354 | Bacteria | 5529 |
| 47 | Ga0070675_100494974 | 3300005354 | Bacteria | 1101 |
| 48 | Ga0070675_100550715 | 3300005354 | Bacteria | 1043 |
| 49 | Ga0070674_100034350 | 3300005356 | Bacteria | 3386 |
| 50 | Ga0070673_100424817 | 3300005364 | Bacteria | 1192 |
| 51 | Ga0070673_100467230 | 3300005364 | Bacteria | 1137 |
| 52 | Ga0070659_100067883 | 3300005366 | Bacteria | 2828 |
| 53 | Ga0070659_100083615 | 3300005366 | Bacteria | 2552 |
| 54 | Ga0070659_100195952 | 3300005366 | Bacteria | 1662 |
| 55 | Ga0070667_100098718 | 3300005367 | Bacteria | 2520 |
| 56 | Ga0070667_100789759 | 3300005367 | Bacteria | 881 |
| 57 | Ga0070708_100716652 | 3300005445 | Bacteria | 941 |
| 58 | Ga0070663_100226479 | 3300005455 | Bacteria | 1470 |
| 59 | Ga0070678_100034672 | 3300005456 | Bacteria | 3516 |
| 60 | Ga0070678_100045872 | 3300005456 | Bacteria | 3129 |
| 61 | Ga0070662_101059414 | 3300005457 | Bacteria | 695 |
| 62 | Ga0068867_100089688 | 3300005459 | Bacteria | 2332 |
| 63 | Ga0070685_10236254 | 3300005466 | Bacteria | 1204 |
| 64 | Ga0070685_11548297 | 3300005466 | Bacteria | 512 |
| 65 | Ga0070679_100071081 | 3300005530 | Bacteria | 3471 |
| 66 | Ga0068853_100000349 | 3300005539 | Bacteria | 32236 |
| 67 | Ga0068853_100013217 | 3300005539 | Bacteria | 6737 |
| 68 | Ga0068853_100052062 | 3300005539 | Bacteria | 3526 |
| 69 | Ga0068853_100062881 | 3300005539 | Bacteria | 3213 |
| 70 | Ga0068853_100227595 | 3300005539 | Bacteria | 1705 |
| 71 | Ga0068853_100363451 | 3300005539 | Bacteria | 1349 |
| 72 | Ga0068853_101447830 | 3300005539 | Unclassified | 665 |
| 73 | Ga0070672_100010695 | 3300005543 | Bacteria | 6374 |
| 74 | Ga0070672_100362487 | 3300005543 | Bacteria | 1237 |
| 75 | Ga0070672_100551205 | 3300005543 | Bacteria | 1001 |
| 76 | Ga0070693_100117183 | 3300005547 | Bacteria | 1647 |
| 77 | Ga0070665_100103231 | 3300005548 | Bacteria | 2854 |
| 78 | Ga0070665_100404037 | 3300005548 | Bacteria | 1374 |
| 79 | Ga0070665_100492110 | 3300005548 | Bacteria | 1237 |
| 80 | Ga0070665_101219192 | 3300005548 | Bacteria | 763 |
| 81 | Ga0068855_100058763 | 3300005563 | Bacteria | 4502 |
| 82 | Ga0068855_100106005 | 3300005563 | Bacteria | 3231 |
| 83 | Ga0068855_100182254 | 3300005563 | Bacteria | 2374 |
| 84 | Ga0068855_101297421 | 3300005563 | Bacteria | 754 |
| 85 | Ga0070664_100000183 | 3300005564 | Bacteria | 44347 |
| 86 | Ga0068857_100013461 | 3300005577 | Bacteria | 7125 |
| 87 | Ga0068854_100010975 | 3300005578 | Bacteria | 5879 |
| 88 | Ga0068854_100066513 | 3300005578 | Bacteria | 2623 |
| 89 | Ga0068854_100757654 | 3300005578 | Bacteria | 843 |
| 90 | Ga0068856_100054583 | 3300005614 | Bacteria | 3941 |
| 91 | Ga0068856_100334501 | 3300005614 | Bacteria | 1532 |
| 92 | Ga0070702_100367518 | 3300005615 | Bacteria | 1019 |
| 93 | Ga0068852_100001009 | 3300005616 | Bacteria | 18589 |
| 94 | Ga0068852_100006649 | 3300005616 | Bacteria | 8378 |
| 95 | Ga0068852_100024276 | 3300005616 | Bacteria | 4897 |
| 96 | Ga0068859_100291748 | 3300005617 | Bacteria | 1724 |
| 97 | Ga0068851_10015698 | 3300005834 | Bacteria | 3613 |
| 98 | Ga0068851_10277710 | 3300005834 | Bacteria | 957 |
| 99 | Ga0068851_10699421 | 3300005834 | Bacteria | 624 |
| 100 | Ga0068858_100092511 | 3300005842 | Bacteria | 2815 |
| 101 | Ga0075365_10006101 | 3300006038 | Bacteria | 6588 |
| 102 | Ga0075365_10640614 | 3300006038 | Bacteria | 751 |
| 103 | Ga0075367_10291395 | 3300006178 | Unclassified | 1027 |
| 104 | Ga0075366_10000694 | 3300006195 | Bacteria | 15919 |
| 105 | Ga0075366_10056855 | 3300006195 | Bacteria | 2324 |
| 106 | Ga0075366_10328754 | 3300006195 | Bacteria | 937 |
| 107 | Ga0075366_10392749 | 3300006195 | Bacteria | 854 |
| 108 | Ga0097621_100698264 | 3300006237 | Bacteria | 934 |
| 109 | Ga0097621_101154865 | 3300006237 | Bacteria | 728 |
| 110 | Ga0075370_10015667 | 3300006353 | Bacteria | 4064 |
| 111 | Ga0075370_10542142 | 3300006353 | Bacteria | 703 |
| 112 | Ga0068871_100591616 | 3300006358 | Bacteria | 1008 |
| 113 | Ga0075434_101513657 | 3300006871 | Bacteria | 680 |
| 114 | Ga0068865_100189217 | 3300006881 | Bacteria | 1590 |
| 115 | Ga0097620_100291761 | 3300006931 | Bacteria | 1724 |
| 116 | Ga0075435_100271808 | 3300007076 | Bacteria | 1446 |
| 117 | Ga0099794_10077383 | 3300007265 | Bacteria | 1636 |
| 118 | Ga0099795_10237368 | 3300007788 | Bacteria | 782 |
| 119 | Ga0105244_10000664 | 3300009036 | Bacteria | 30176 |
| 120 | Ga0105244_10001980 | 3300009036 | Bacteria | 15825 |
| 121 | Ga0105240_10071843 | 3300009093 | Bacteria | 4279 |
| 122 | Ga0105240_10689874 | 3300009093 | Bacteria | 1116 |
| 123 | Ga0105245_10618854 | 3300009098 | Bacteria | 1111 |
| 124 | Ga0105245_10960506 | 3300009098 | Bacteria | 898 |
| 125 | Ga0105245_11204680 | 3300009098 | Bacteria | 805 |
| 126 | Ga0114129_11855255 | 3300009147 | Bacteria | 732 |
| 127 | Ga0105243_10016631 | 3300009148 | Bacteria | 5563 |
| 128 | Ga0105241_10086009 | 3300009174 | Bacteria | 2472 |
| 129 | Ga0105241_10174524 | 3300009174 | Bacteria | 1777 |
| 130 | Ga0105241_10193867 | 3300009174 | Bacteria | 1693 |
| 131 | Ga0105241_11715614 | 3300009174 | Bacteria | 611 |
| 132 | Ga0105242_10000355 | 3300009176 | Bacteria | 36746 |
| 133 | Ga0105248_10959647 | 3300009177 | Bacteria | 966 |
| 134 | Ga0105237_10000009 | 3300009545 | Bacteria | 337615 |
| 135 | Ga0105237_10000449 | 3300009545 | Bacteria | 58586 |
| 136 | Ga0105237_10004993 | 3300009545 | Bacteria | 15118 |
| 137 | Ga0105237_10118095 | 3300009545 | Bacteria | 2646 |
| 138 | Ga0105237_10140555 | 3300009545 | Bacteria | 2408 |
| 139 | Ga0105237_10928212 | 3300009545 | Bacteria | 877 |
| 140 | Ga0105238_10007565 | 3300009551 | Bacteria | 10884 |
| 141 | Ga0105238_10052650 | 3300009551 | Bacteria | 4092 |
| 142 | Ga0105238_10177639 | 3300009551 | Bacteria | 2106 |
| 143 | Ga0105238_10525728 | 3300009551 | Bacteria | 1186 |
| 144 | Ga0105238_10975903 | 3300009551 | Unclassified | 868 |
| 145 | Ga0105249_10722870 | 3300009553 | Bacteria | 1057 |
| 146 | Ga0099796_10047611 | 3300010159 | Bacteria | 1475 |
| 147 | Ga0105239_10009975 | 3300010375 | Bacteria | 10658 |
| 148 | Ga0105239_10016218 | 3300010375 | Bacteria | 8241 |
| 149 | Ga0105239_10203545 | 3300010375 | Bacteria | 2218 |
| 150 | Ga0105239_10206296 | 3300010375 | Bacteria | 2202 |
| 151 | Ga0105239_10234949 | 3300010375 | Bacteria | 2057 |
| 152 | Ga0105239_10276985 | 3300010375 | Bacteria | 1888 |
| 153 | Ga0105239_11586695 | 3300010375 | Bacteria | 757 |
| 154 | Ga0105239_12906707 | 3300010375 | Bacteria | 559 |
| 155 | Ga0105246_10007067 | 3300011119 | Bacteria | 6871 |
| 156 | Ga0105246_10009957 | 3300011119 | Bacteria | 5865 |
| 157 | Ga0105246_10389824 | 3300011119 | Bacteria | 1153 |
| 158 | Ga0157373_10019283 | 3300013100 | Bacteria | 4967 |
| 159 | Ga0157373_10173691 | 3300013100 | Bacteria | 1516 |
| 160 | Ga0157371_10008162 | 3300013102 | Bacteria | 8371 |
| 161 | Ga0157371_10199899 | 3300013102 | Bacteria | 1432 |
| 162 | Ga0157370_10034029 | 3300013104 | Bacteria | 4965 |
| 163 | Ga0157370_10080570 | 3300013104 | Bacteria | 3065 |
| 164 | Ga0157370_10113556 | 3300013104 | Bacteria | 2531 |
| 165 | Ga0157370_10358565 | 3300013104 | Bacteria | 1344 |
| 166 | Ga0157369_10005088 | 3300013105 | Bacteria | 15391 |
| 167 | Ga0157369_10517663 | 3300013105 | Bacteria | 1234 |
| 168 | Ga0157374_10015333 | 3300013296 | Bacteria | 6722 |
| 169 | Ga0157374_10266837 | 3300013296 | Bacteria | 1687 |
| 170 | Ga0157378_10286504 | 3300013297 | Bacteria | 1590 |
| 171 | Ga0157378_10867244 | 3300013297 | Bacteria | 932 |
| 172 | Ga0163162_10031279 | 3300013306 | Bacteria | 5279 |
| 173 | Ga0163162_10363558 | 3300013306 | Bacteria | 1580 |
| 174 | Ga0163162_10514174 | 3300013306 | Bacteria | 1327 |
| 175 | Ga0157372_10110687 | 3300013307 | Bacteria | 3146 |
| 176 | Ga0157372_11237453 | 3300013307 | Bacteria | 862 |
| 177 | Ga0157375_10195842 | 3300013308 | Bacteria | 2176 |
| 178 | Ga0157375_10466894 | 3300013308 | Bacteria | 1427 |
| 179 | Ga0163163_10315044 | 3300014325 | Bacteria | 1618 |
| 180 | Ga0163163_12501822 | 3300014325 | Bacteria | 574 |
| 181 | Ga0157380_10103882 | 3300014326 | Bacteria | 2372 |
| 182 | Ga0182008_10002018 | 3300014497 | Bacteria | 13020 |
| 183 | Ga0182008_10159993 | 3300014497 | Bacteria | 1133 |
| 184 | Ga0157379_10146027 | 3300014968 | Bacteria | 2133 |
| 185 | Ga0157379_10204453 | 3300014968 | Bacteria | 1786 |
| 186 | Ga0157376_10488341 | 3300014969 | Bacteria | 1208 |
| 187 | Ga0157376_11357848 | 3300014969 | Bacteria | 742 |
| 188 | Ga0182006_1004913 | 3300015261 | Bacteria | 6475 |
| 189 | Ga0182006_1006449 | 3300015261 | Bacteria | 5451 |
| 190 | Ga0182006_1180099 | 3300015261 | Bacteria | 705 |
| 191 | Ga0182007_10003535 | 3300015262 | Bacteria | 7360 |
| 192 | Ga0163161_10497745 | 3300017792 | Bacteria | 992 |
| 193 | Ga0197907_10579377 | 3300020069 | Bacteria | 1244 |
| 194 | Ga0207427_102147 | 3300025231 | Bacteria | 5689 |
| 195 | Ga0209258_100789 | 3300025242 | Bacteria | 19058 |
| 196 | Ga0207425_1000168 | 3300025245 | Bacteria | 55214 |
| 197 | Ga0209759_1010535 | 3300025256 | Bacteria | 2704 |
| 198 | Ga0209129_1000215 | 3300025258 | Bacteria | 66656 |
| 199 | Ga0209233_1004974 | 3300025261 | Bacteria | 4467 |
| 200 | Ga0209565_1041173 | 3300025263 | Bacteria | 860 |
| 201 | Ga0209673_1027264 | 3300025273 | Bacteria | 1861 |
| 202 | Ga0209675_1016780 | 3300025291 | Bacteria | 2118 |
| 203 | Ga0209676_1001989 | 3300025292 | Bacteria | 16215 |
| 204 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 205 | Ga0209758_1000174 | 3300025297 | Bacteria | 147347 |
| 206 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 207 | Ga0209050_1035778 | 3300025298 | Bacteria | 1462 |
| 208 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 209 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 210 | Ga0209257_1015932 | 3300025304 | Bacteria | 3081 |
| 211 | Ga0209257_1080089 | 3300025304 | Bacteria | 840 |
| 212 | Ga0207656_10019076 | 3300025321 | Bacteria | 2709 |
| 213 | Ga0207656_10210265 | 3300025321 | Bacteria | 943 |
| 214 | Ga0207655_1000114 | 3300025728 | Bacteria | 164098 |
| 215 | Ga0207682_10018862 | 3300025893 | Bacteria | 2698 |
| 216 | Ga0207682_10082214 | 3300025893 | Bacteria | 1383 |
| 217 | Ga0207647_10140797 | 3300025904 | Bacteria | 1413 |
| 218 | Ga0207647_10418958 | 3300025904 | Bacteria | 753 |
| 219 | Ga0207645_10088213 | 3300025907 | Bacteria | 1994 |
| 220 | Ga0207645_10148175 | 3300025907 | Bacteria | 1531 |
| 221 | Ga0207645_10317823 | 3300025907 | Bacteria | 1038 |
| 222 | Ga0207705_10037978 | 3300025909 | Bacteria | 3447 |
| 223 | Ga0207705_10132289 | 3300025909 | Bacteria | 1857 |
| 224 | Ga0207705_10159067 | 3300025909 | Bacteria | 1696 |
| 225 | Ga0207654_10077951 | 3300025911 | Bacteria | 1988 |
| 226 | Ga0207654_10087759 | 3300025911 | Bacteria | 1888 |
| 227 | Ga0207654_10269808 | 3300025911 | Bacteria | 1147 |
| 228 | Ga0207695_10000377 | 3300025913 | Bacteria | 101452 |
| 229 | Ga0207695_10066670 | 3300025913 | Bacteria | 3696 |
| 230 | Ga0207671_10000439 | 3300025914 | Bacteria | 57260 |
| 231 | Ga0207671_10000690 | 3300025914 | Bacteria | 43659 |
| 232 | Ga0207671_11034178 | 3300025914 | Bacteria | 646 |
| 233 | Ga0207657_10015968 | 3300025919 | Bacteria | 7252 |
| 234 | Ga0207657_10018131 | 3300025919 | Bacteria | 6734 |
| 235 | Ga0207657_10184285 | 3300025919 | Bacteria | 1686 |
| 236 | Ga0207657_10312317 | 3300025919 | Bacteria | 1244 |
| 237 | Ga0207657_10425471 | 3300025919 | Bacteria | 1043 |
| 238 | Ga0207649_10000032 | 3300025920 | Bacteria | 143552 |
| 239 | Ga0207649_10000527 | 3300025920 | Bacteria | 26665 |
| 240 | Ga0207649_10030843 | 3300025920 | Bacteria | 3180 |
| 241 | Ga0207649_10054321 | 3300025920 | Bacteria | 2492 |
| 242 | Ga0207649_10384235 | 3300025920 | Bacteria | 1047 |
| 243 | Ga0207681_10112919 | 3300025923 | Bacteria | 1980 |
| 244 | Ga0207694_10041037 | 3300025924 | Bacteria | 3565 |
| 245 | Ga0207694_10041776 | 3300025924 | Bacteria | 3535 |
| 246 | Ga0207694_10396681 | 3300025924 | Bacteria | 1147 |
| 247 | Ga0207694_10520193 | 3300025924 | Bacteria | 997 |
| 248 | Ga0207659_10017487 | 3300025926 | Bacteria | 4685 |
| 249 | Ga0207659_10177059 | 3300025926 | Bacteria | 1687 |
| 250 | Ga0207687_10391192 | 3300025927 | Bacteria | 1141 |
| 251 | Ga0207644_10345667 | 3300025931 | Bacteria | 1207 |
| 252 | Ga0207690_10041697 | 3300025932 | Bacteria | 3010 |
| 253 | Ga0207690_10119285 | 3300025932 | Bacteria | 1913 |
| 254 | Ga0207706_10223119 | 3300025933 | Bacteria | 1650 |
| 255 | Ga0207686_10005728 | 3300025934 | Bacteria | 6662 |
| 256 | Ga0207709_10335451 | 3300025935 | Bacteria | 1136 |
| 257 | Ga0207669_10857292 | 3300025937 | Bacteria | 756 |
| 258 | Ga0207704_10067468 | 3300025938 | Bacteria | 2251 |
| 259 | Ga0207691_10012108 | 3300025940 | Bacteria | 8268 |
| 260 | Ga0207691_10310158 | 3300025940 | Bacteria | 1354 |
| 261 | Ga0207711_10724682 | 3300025941 | Bacteria | 927 |
| 262 | Ga0207661_11416485 | 3300025944 | Unclassified | 638 |
| 263 | Ga0207679_10000059 | 3300025945 | Bacteria | 101268 |
| 264 | Ga0207667_10067980 | 3300025949 | Bacteria | 3711 |
| 265 | Ga0207667_10082813 | 3300025949 | Bacteria | 3322 |
| 266 | Ga0207667_10089702 | 3300025949 | Bacteria | 3177 |
| 267 | Ga0207667_10201064 | 3300025949 | Bacteria | 2044 |
| 268 | Ga0207667_11644889 | 3300025949 | Bacteria | 610 |
| 269 | Ga0207651_10634082 | 3300025960 | Bacteria | 937 |
| 270 | Ga0207668_10285333 | 3300025972 | Bacteria | 1356 |
| 271 | Ga0207640_10005936 | 3300025981 | Bacteria | 6667 |
| 272 | Ga0207658_10310958 | 3300025986 | Bacteria | 1361 |
| 273 | Ga0207677_10185116 | 3300026023 | Bacteria | 1642 |
| 274 | Ga0207677_10528235 | 3300026023 | Bacteria | 1025 |
| 275 | Ga0207703_10134246 | 3300026035 | Bacteria | 2141 |
| 276 | Ga0207639_10004587 | 3300026041 | Bacteria | 9298 |
| 277 | Ga0207639_10004923 | 3300026041 | Bacteria | 9000 |
| 278 | Ga0207639_10141089 | 3300026041 | Bacteria | 2007 |
| 279 | Ga0207639_10700599 | 3300026041 | Bacteria | 940 |
| 280 | Ga0207639_11055228 | 3300026041 | Unclassified | 762 |
| 281 | Ga0207678_10336824 | 3300026067 | Bacteria | 1299 |
| 282 | Ga0207702_10062913 | 3300026078 | Bacteria | 3171 |
| 283 | Ga0207702_10167064 | 3300026078 | Bacteria | 2014 |
| 284 | Ga0207702_10316997 | 3300026078 | Bacteria | 1484 |
| 285 | Ga0207702_10381417 | 3300026078 | Bacteria | 1356 |
| 286 | Ga0207702_10956391 | 3300026078 | Bacteria | 849 |
| 287 | Ga0207702_11409813 | 3300026078 | Bacteria | 690 |
| 288 | Ga0207641_10423736 | 3300026088 | Bacteria | 1282 |
| 289 | Ga0207648_10011938 | 3300026089 | Bacteria | 8154 |
| 290 | Ga0207648_10113554 | 3300026089 | Bacteria | 2379 |
| 291 | Ga0207648_10491976 | 3300026089 | Bacteria | 1121 |
| 292 | Ga0207674_10012591 | 3300026116 | Bacteria | 9454 |
| 293 | Ga0207683_10014515 | 3300026121 | Bacteria | 6709 |
| 294 | Ga0207683_10020075 | 3300026121 | Bacteria | 5711 |
| 295 | Ga0207698_10004973 | 3300026142 | Bacteria | 8149 |
| 296 | Ga0207698_10041277 | 3300026142 | Bacteria | 3436 |
| 297 | Ga0207698_10378417 | 3300026142 | Bacteria | 1346 |
| 298 | Ga0207698_10524860 | 3300026142 | Bacteria | 1156 |
| 299 | Ga0209179_1050355 | 3300027512 | Bacteria | 892 |
| 300 | Ga0209983_1050188 | 3300027665 | Bacteria | 912 |
| 301 | Ga0209588_1029425 | 3300027671 | Bacteria | 1752 |
| 302 | Ga0209588_1030664 | 3300027671 | Bacteria | 1718 |
| 303 | Ga0209588_1059549 | 3300027671 | Bacteria | 1235 |
| 304 | Ga0268266_10000474 | 3300028379 | Bacteria | 57849 |
| 305 | Ga0268266_10040674 | 3300028379 | Bacteria | 3964 |
| 306 | Ga0268266_10840110 | 3300028379 | Bacteria | 887 |
| 307 | Ga0268266_11629458 | 3300028379 | Bacteria | 621 |
| 308 | Ga0268264_10195034 | 3300028381 | Bacteria | 1849 |
| 309 | Ga0307517_10319547 | 3300028786 | Bacteria | 860 |
| 310 | Ga0307515_10033350 | 3300028794 | Bacteria | 8483 |
| 311 | Ga0307515_10554195 | 3300028794 | Bacteria | 759 |
| 312 | Ga0265338_10000057 | 3300028800 | Bacteria | 200477 |
| 313 | Ga0265338_10128681 | 3300028800 | Bacteria | 2004 |
| 314 | Ga0314311_1242699 | 3300030733 | Bacteria | 4146 |
| 315 | Ga0316183_1105814 | 3300030742 | Bacteria | 2486 |
| 316 | Ga0265332_10003905 | 3300031238 | Bacteria | 7110 |
| 317 | Ga0265328_10045331 | 3300031239 | Bacteria | 1617 |
| 318 | Ga0265320_10028777 | 3300031240 | Bacteria | 2882 |
| 319 | Ga0265325_10010008 | 3300031241 | Bacteria | 5509 |
| 320 | Ga0265339_10000389 | 3300031249 | Bacteria | 34751 |
| 321 | Ga0265327_10181342 | 3300031251 | Bacteria | 963 |
| 322 | Ga0265316_10019457 | 3300031344 | Bacteria | 5807 |
| 323 | Ga0307513_10080893 | 3300031456 | Bacteria | 3349 |
| 324 | Ga0307509_10220205 | 3300031507 | Bacteria | 1712 |
| 325 | Ga0307408_100000662 | 3300031548 | Bacteria | 28690 |
| 326 | Ga0307408_100350498 | 3300031548 | Bacteria | 1252 |
| 327 | Ga0307408_100408660 | 3300031548 | Bacteria | 1167 |
| 328 | Ga0307408_100602420 | 3300031548 | Bacteria | 976 |
| 329 | Ga0265313_10000449 | 3300031595 | Bacteria | 43511 |
| 330 | Ga0265314_10036366 | 3300031711 | Bacteria | 3579 |
| 331 | Ga0265314_10038798 | 3300031711 | Bacteria | 3438 |
| 332 | Ga0265314_10051063 | 3300031711 | Bacteria | 2882 |
| 333 | Ga0316578_10579214 | 3300031728 | Bacteria | 658 |
| 334 | Ga0307516_10000689 | 3300031730 | Bacteria | 45886 |
| 335 | Ga0307413_10681687 | 3300031824 | Bacteria | 851 |
| 336 | Ga0307406_10291971 | 3300031901 | Bacteria | 1248 |
| 337 | Ga0307412_11059169 | 3300031911 | Bacteria | 719 |
| 338 | Ga0307416_100431834 | 3300032002 | Bacteria | 1365 |
| 339 | Ga0307416_100607673 | 3300032002 | Bacteria | 1174 |
| 340 | Ga0307416_100873905 | 3300032002 | Bacteria | 998 |
| 341 | Ga0307416_102185210 | 3300032002 | Bacteria | 655 |
| 342 | Ga0307414_10059427 | 3300032004 | Bacteria | 2699 |
| 343 | Ga0307414_10071544 | 3300032004 | Bacteria | 2502 |
| 344 | Ga0307414_10083384 | 3300032004 | Bacteria | 2347 |
| 345 | Ga0307414_10091941 | 3300032004 | Bacteria | 2257 |
| 346 | Ga0307414_10155180 | 3300032004 | Bacteria | 1811 |
| 347 | Ga0307414_10668757 | 3300032004 | Bacteria | 937 |
| 348 | Ga0307414_10855571 | 3300032004 | Bacteria | 832 |
| 349 | Ga0307414_11508637 | 3300032004 | Bacteria | 626 |
| 350 | Ga0307411_10058265 | 3300032005 | Bacteria | 2555 |
| 351 | Ga0373926_0003426 | 3300035083 | Bacteria | 5115 |
| 352 | Ga0373934_0095599 | 3300035086 | Bacteria | 1200 |
| 353 | Ga0373940_0111205 | 3300035088 | Bacteria | 841 |
| 354 | Ga0373944_0033220 | 3300035089 | Bacteria | 1562 |
| 355 | Ga0373923_0009192 | 3300035111 | Bacteria | 3557 |
| 356 | Ga0373923_0200787 | 3300035111 | Bacteria | 922 |
| 357 | Ga0373936_0044790 | 3300035113 | Bacteria | 1781 |
| 358 | Ga0373945_0007902 | 3300035116 | Bacteria | 3452 |
| 359 | Ga0373954_0203607 | 3300035118 | Bacteria | 972 |
| 360 | Ga0373956_0036765 | 3300035119 | Bacteria | 2162 |
| 361 | Ga0373956_0153094 | 3300035119 | Bacteria | 1085 |
| 362 | Ga0373960_0404473 | 3300035121 | Bacteria | 527 |
| 363 | Ga0373955_0080419 | 3300035172 | Bacteria | 1840 |
| 364 | Ga0316574_0255744 | 3300035398 | Bacteria | 1119 |
| 365 | Ga0373924_0572862 | 3300035410 | Unclassified | 509 |
| 366 | Ga0373931_0037837 | 3300035691 | Bacteria | 2521 |
| 367 | Ga0373931_0190064 | 3300035691 | Bacteria | 1221 |
| 368 | Ga0373935_0006183 | 3300035692 | Bacteria | 7124 |
| 369 | Ga0373927_0035932 | 3300035695 | Bacteria | 3223 |
| 370 | Ga0373933_0090079 | 3300035724 | Bacteria | 1892 |
| 371 | Ga0373947_0006814 | 3300035725 | Bacteria | 6625 |
| 372 | Ga0373937_0002210 | 3300036401 | Bacteria | 16263 |
| 373 | Ga0373937_0195950 | 3300036401 | Bacteria | 1899 |
| 374 | Ga0373925_0005295 | 3300037068 | Bacteria | 9627 |
| 375 | Ga0373925_0128688 | 3300037068 | Bacteria | 1972 |
| 376 | Ga0373925_1127660 | 3300037068 | Bacteria | 645 |
| 377 | Ga0395899_0177782 | 3300037312 | Bacteria | 1495 |
| 378 | Ga0395899_0251771 | 3300037312 | Bacteria | 1212 |
| 379 | Ga0395898_0053933 | 3300037466 | Bacteria | 3925 |
| 380 | Ga0395898_1141859 | 3300037466 | Unclassified | 711 |
| 381 | Ga0395898_1569571 | 3300037466 | Bacteria | 583 |
| 382 | Ga0395905_0219153 | 3300037471 | Bacteria | 1781 |
| 383 | Ga0395905_0286446 | 3300037471 | Bacteria | 1534 |
| 384 | Ga0395901_0612107 | 3300038443 | Bacteria | 1097 |
| 385 | Ga0439453_0165312 | 3300041408 | Unclassified | 532 |
| 386 | Ga0439465_0027030 | 3300041413 | Bacteria | 1816 |
| 387 | Ga0451787_716454 | 3300041441 | Bacteria | 661 |
| 388 | Ga0451802_0714199 | 3300041460 | Bacteria | 959 |
| 389 | Ga0451843_1176783 | 3300041509 | Bacteria | 591 |
| 390 | Ga0439431_0157539 | 3300041997 | Bacteria | 648 |
| 391 | Ga0439437_018917 | 3300042000 | Bacteria | 825 |
| 392 | Ga0439449_0059913 | 3300042007 | Bacteria | 1405 |
| 393 | Ga0439456_157216 | 3300042013 | Bacteria | 531 |
| 394 | Ga0439463_004390 | 3300042016 | Bacteria | 3534 |
| 395 | Ga0439463_036476 | 3300042016 | Bacteria | 1245 |
| 396 | Ga0450917_000350 | 3300042120 | Bacteria | 3472 |
| 397 | Ga0450888_000965 | 3300042126 | Bacteria | 2725 |
| 398 | Ga0450890_005423 | 3300042127 | Bacteria | 1639 |
| 399 | Ga0450890_005467 | 3300042127 | Bacteria | 1632 |
| 400 | Ga0450897_033604 | 3300042128 | Bacteria | 587 |
| 401 | Ga0450891_000163 | 3300042129 | Bacteria | 6353 |
| 402 | Ga0450898_023790 | 3300042134 | Bacteria | 1091 |
| 403 | Ga0450889_016539 | 3300042144 | Bacteria | 797 |
| 404 | Ga0450889_031320 | 3300042144 | Bacteria | 622 |
| 405 | Ga0439435_0077967 | 3300042436 | Bacteria | 990 |
| 406 | Ga0450893_0001105 | 3300042532 | Bacteria | 4063 |
| 407 | Ga0466969_0206080 | 3300044656 | Bacteria | 896 |
| 408 | Ga0466977_0001086 | 3300044666 | Bacteria | 10619 |
| 409 | Ga0466961_0135814 | 3300044693 | Bacteria | 1541 |
| 410 | Ga0466957_0615945 | 3300044842 | Bacteria | 761 |
| 411 | Ga0451576_0000449 | 3300045051 | Bacteria | 93533 |
| 412 | Ga0495629_0003586 | 3300046459 | Bacteria | 11724 |
| 413 | Ga0495651_0155334 | 3300046462 | Bacteria | 1645 |
| 414 | Ga0495580_0013721 | 3300046472 | Bacteria | 6171 |
| 415 | Ga0495580_0354821 | 3300046472 | Bacteria | 993 |
| 416 | Ga0495582_0038825 | 3300046473 | Bacteria | 2620 |
| 417 | Ga0495594_0027819 | 3300046499 | Bacteria | 3048 |
| 418 | Ga0495630_0014687 | 3300046517 | Bacteria | 5709 |
| 419 | Ga0495663_0051852 | 3300046525 | Bacteria | 1272 |
| 420 | Ga0495666_0179758 | 3300046526 | Bacteria | 977 |
| 421 | Ga0495642_0087674 | 3300046528 | Bacteria | 1315 |
| 422 | Ga0495665_0081907 | 3300046531 | Bacteria | 1696 |
| 423 | Ga0495597_0007752 | 3300046542 | Bacteria | 5425 |
| 424 | Ga0495667_0292134 | 3300046559 | Bacteria | 1033 |
| 425 | Ga0495656_0152991 | 3300046615 | Bacteria | 1115 |
| 426 | Ga0495588_0139811 | 3300046674 | Bacteria | 1279 |
| 427 | Ga0495623_0012224 | 3300046679 | Bacteria | 5562 |
| 428 | Ga0495647_0004812 | 3300046681 | Bacteria | 4406 |
| 429 | Ga0495658_0009719 | 3300046683 | Bacteria | 4796 |
| 430 | Ga0495658_0093980 | 3300046683 | Bacteria | 1780 |
| 431 | Ga0495613_0039733 | 3300046689 | Bacteria | 3487 |
| 432 | Ga0495600_0037333 | 3300046809 | Bacteria | 3158 |
| 433 | Ga0495581_0003509 | 3300047315 | Bacteria | 9003 |
| 434 | Ga0495636_0120403 | 3300047318 | Bacteria | 1160 |
| 435 | Ga0495684_0026211 | 3300047471 | Bacteria | 4478 |
| 436 | Ga0495593_0126968 | 3300047673 | Bacteria | 1296 |
| 437 | Ga0495602_0037020 | 3300048088 | Bacteria | 4533 |
| 438 | Ga0495614_0292362 | 3300048089 | Bacteria | 752 |
| 439 | Ga0496100_0050912 | 3300048903 | Bacteria | 2686 |
| 440 | Ga0496100_1319693 | 3300048903 | Bacteria | 569 |
| 441 | Ga0496101_0052251 | 3300048904 | Bacteria | 2946 |
| 442 | Ga0496101_0603828 | 3300048904 | Bacteria | 867 |
| 443 | Ga0496102_0368988 | 3300048905 | Bacteria | 1351 |
| 444 | Ga0496104_0036185 | 3300048907 | Bacteria | 4613 |
| 445 | Ga0496104_0194483 | 3300048907 | Bacteria | 1940 |
| 446 | Ga0496104_0515672 | 3300048907 | Bacteria | 1107 |
| 447 | Ga0496105_0007005 | 3300048908 | Bacteria | 8683 |
| 448 | Ga0496105_0023729 | 3300048908 | Bacteria | 4979 |
| 449 | Ga0496108_0940579 | 3300048911 | Bacteria | 740 |
| 450 | Ga0496110_0055974 | 3300048913 | Bacteria | 3471 |
| 451 | Ga0496111_0190562 | 3300048914 | Bacteria | 1524 |
| 452 | Ga0496112_0043895 | 3300048915 | Bacteria | 4377 |
| 453 | Ga0496113_0050121 | 3300048916 | Bacteria | 3111 |
| 454 | Ga0496114_0046024 | 3300048917 | Bacteria | 3625 |
| 455 | Ga0496115_0183109 | 3300048918 | Bacteria | 1731 |
| 456 | Ga0496115_0270725 | 3300048918 | Bacteria | 1395 |
| 457 | Ga0496119_0000421 | 3300048922 | Bacteria | 58350 |
| 458 | Ga0496120_0396148 | 3300048923 | Bacteria | 611 |
| 459 | Ga0496121_0010360 | 3300048924 | Bacteria | 10529 |
| 460 | Ga0496121_0015914 | 3300048924 | Bacteria | 7814 |
| 461 | Ga0496122_0003947 | 3300048925 | Bacteria | 18963 |
| 462 | Ga0496122_0075138 | 3300048925 | Bacteria | 2386 |
| 463 | Ga0496123_0032480 | 3300048926 | Bacteria | 3778 |
| 464 | Ga0496123_0084574 | 3300048926 | Bacteria | 1913 |
| 465 | Ga0496124_0061921 | 3300048927 | Bacteria | 3134 |
| 466 | Ga0496124_0100189 | 3300048927 | Bacteria | 2349 |
| 467 | Ga0496125_0000207 | 3300048928 | Bacteria | 122897 |
| 468 | Ga0496125_0000988 | 3300048928 | Bacteria | 44327 |
| 469 | Ga0496125_0010905 | 3300048928 | Bacteria | 9138 |
| 470 | Ga0496125_0017457 | 3300048928 | Bacteria | 6839 |
| 471 | Ga0496125_0146114 | 3300048928 | Bacteria | 1634 |
| 472 | Ga0496126_0024961 | 3300048929 | Bacteria | 5762 |
| 473 | Ga0496126_0176182 | 3300048929 | Bacteria | 1819 |
| 474 | Ga0496126_0181233 | 3300048929 | Bacteria | 1789 |
| 475 | Ga0501032_0008188 | 3300049569 | Bacteria | 7619 |
| 476 | Ga0501032_0182944 | 3300049569 | Bacteria | 1372 |
| 477 | Ga0501033_0572350 | 3300049570 | Bacteria | 777 |
| 478 | Ga0501034_0004211 | 3300049571 | Bacteria | 16059 |
| 479 | Ga0501034_0016743 | 3300049571 | Bacteria | 7516 |
| 480 | Ga0501034_0231939 | 3300049571 | Bacteria | 1794 |
| 481 | Ga0501034_0274143 | 3300049571 | Bacteria | 1627 |
| 482 | Ga0501034_0553868 | 3300049571 | Bacteria | 1059 |
| 483 | Ga0501034_0661794 | 3300049571 | Bacteria | 945 |
| 484 | Ga0501034_1016692 | 3300049571 | Bacteria | 712 |
| 485 | Ga0501036_1306718 | 3300049572 | Bacteria | 589 |
| 486 | Ga0501037_0041212 | 3300049573 | Bacteria | 3396 |
| 487 | Ga0501037_0119831 | 3300049573 | Bacteria | 1892 |
| 488 | Ga0501038_0008126 | 3300049574 | Bacteria | 9659 |
| 489 | Ga0501038_0304222 | 3300049574 | Bacteria | 1251 |
| 490 | Ga0501043_0452369 | 3300049579 | Bacteria | 964 |
| 491 | Ga0501046_0440395 | 3300049580 | Bacteria | 938 |
| 492 | Ga0501047_0089830 | 3300049581 | Bacteria | 2949 |
| 493 | Ga0501047_0782199 | 3300049581 | Bacteria | 769 |
| 494 | Ga0501067_0278909 | 3300049583 | Bacteria | 931 |
| 495 | Ga0501068_0268738 | 3300049584 | Bacteria | 1089 |
| 496 | Ga0501070_0053374 | 3300049586 | Bacteria | 3353 |
| 497 | Ga0501070_0056786 | 3300049586 | Bacteria | 3245 |
| 498 | Ga0501071_0442410 | 3300049587 | Bacteria | 995 |
| 499 | Ga0501072_0142574 | 3300049588 | Bacteria | 1911 |
| 500 | Ga0501072_0865955 | 3300049588 | Bacteria | 706 |
| 501 | Ga0501073_0301961 | 3300049589 | Bacteria | 1104 |
| 502 | Ga0501074_0132382 | 3300049590 | Bacteria | 1784 |
| 503 | Ga0501076_1014595 | 3300049592 | Bacteria | 684 |
| 504 | Ga0501227_035318 | 3300049665 | Bacteria | 1216 |
| 505 | Ga0501079_0289843 | 3300049741 | Bacteria | 1280 |
| 506 | Ga0501079_0689985 | 3300049741 | Unclassified | 804 |
| 507 | Ga0501080_0304668 | 3300049742 | Bacteria | 1444 |
| 508 | Ga0501080_0410538 | 3300049742 | Bacteria | 1217 |
| 509 | Ga0501044_0081773 | 3300049823 | Bacteria | 3269 |
| 510 | Ga0501044_0199360 | 3300049823 | Bacteria | 1960 |
| 511 | Ga0501044_0400512 | 3300049823 | Bacteria | 1285 |
| 512 | nmdc:mga03683_65761_c1 | 3300050489 | Bacteria | 1540 |
| 513 | nmdc:mga03n38_172687_c1 | 3300050490 | Bacteria | 1102 |
| 514 | nmdc:mga0k408_327260_c1 | 3300050493 | Bacteria | 914 |
| 515 | nmdc:mga06z11_625803_c1 | 3300050494 | Bacteria | 655 |
| 516 | nmdc:mga07m45_5883_c1 | 3300050496 | Bacteria | 6156 |
| 517 | nmdc:mga0sz30_241257_c1 | 3300050516 | Unclassified | 804 |
| 518 | Ga0495601_0435023 | 3300053077 | Bacteria | 849 |
| 519 | Ga0495595_0109724 | 3300053084 | Bacteria | 1337 |
| 520 | Ga0495619_0012434 | 3300053085 | Bacteria | 5360 |
| 521 | Ga0500595_063350 | 3300053119 | Bacteria | 1111 |
| 522 | Ga0500604_0000191 | 3300053151 | Bacteria | 17521 |
| 523 | Ga0500634_0006404 | 3300053161 | Bacteria | 5694 |
| 524 | Ga0500634_0335580 | 3300053161 | Bacteria | 583 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0304222 | Ga0501038_0304222_565_1002 | 111 |
| 2 | 3300049580 | Ga0501046_0440395 | Ga0501046_0440395_269_706 | 111 |
| 3 | 3300049584 | Ga0501068_0268738 | Ga0501068_0268738_546_983 | 111 |
| 4 | 3300049741 | Ga0501079_0289843 | Ga0501079_0289843_175_612 | 111 |
| 5 | 3300049742 | Ga0501080_0410538 | Ga0501080_0410538_148_585 | 111 |
| 6 | 3300049588 | Ga0501072_0142574 | Ga0501072_0142574_860_1297 | 112 |
| 7 | 3300049823 | Ga0501044_0081773 | Ga0501044_0081773_2075_2512 | 112 |
| 8 | 3300049570 | Ga0501033_0572350 | Ga0501033_0572350_60_542 | 116 |
| 9 | 3300042128 | Ga0450897_033604 | Ga0450897_033604_23_382 | 118 |
| 10 | 3300003316 | rootH1_10019850 | rootH1_100198506 | 120 |
| 11 | 3300003322 | rootL2_10007948 | rootL2_1000794812 | 120 |
| 12 | 3300049569 | Ga0501032_0182944 | Ga0501032_0182944_788_1270 | 120 |
| 13 | 3300049571 | Ga0501034_0274143 | Ga0501034_0274143_699_1181 | 120 |
| 14 | 3300049581 | Ga0501047_0089830 | Ga0501047_0089830_2058_2540 | 120 |
| 15 | 3300049586 | Ga0501070_0056786 | Ga0501070_0056786_1867_2349 | 120 |
| 16 | 3300049589 | Ga0501073_0301961 | Ga0501073_0301961_236_718 | 120 |
| 17 | 3300049590 | Ga0501074_0132382 | Ga0501074_0132382_1205_1687 | 120 |
| 18 | 3300049742 | Ga0501080_0304668 | Ga0501080_0304668_330_812 | 120 |
| 19 | 3300049823 | Ga0501044_0400512 | Ga0501044_0400512_776_1258 | 120 |
| 20 | 3300010375 | Ga0105239_10016218 | Ga0105239_100162189 | 121 |
| 21 | 3300025914 | Ga0207671_11034178 | Ga0207671_110341781 | 121 |
| 22 | 3300014968 | Ga0157379_10146027 | Ga0157379_101460272 | 122 |
| 23 | 3300014969 | Ga0157376_11357848 | Ga0157376_113578482 | 122 |
| 24 | 3300035121 | Ga0373960_0404473 | Ga0373960_0404473_43_477 | 122 |
| 25 | 3300035691 | Ga0373931_0037837 | Ga0373931_0037837_1793_2227 | 122 |
| 26 | 3300048903 | Ga0496100_1319693 | Ga0496100_1319693_118_552 | 122 |
| 27 | 3300048907 | Ga0496104_0515672 | Ga0496104_0515672_622_1056 | 122 |
| 28 | 3300032002 | Ga0307416_100607673 | Ga0307416_1006076732 | 125 |
| 29 | 3300032002 | Ga0307416_102185210 | Ga0307416_1021852102 | 125 |
| 30 | 3300041408 | Ga0439453_0165312 | Ga0439453_0165312_16_450 | 125 |
| 31 | 3300048907 | Ga0496104_0194483 | Ga0496104_0194483_1278_1754 | 130 |
| 32 | 3300048908 | Ga0496105_0007005 | Ga0496105_0007005_4096_4572 | 130 |
| 33 | 3300046525 | Ga0495663_0051852 | Ga0495663_0051852_466_900 | 131 |
| 34 | 3300046528 | Ga0495642_0087674 | Ga0495642_0087674_340_774 | 131 |
| 35 | 3300047318 | Ga0495636_0120403 | Ga0495636_0120403_227_661 | 131 |
| 36 | 3300009545 | Ga0105237_10118095 | Ga0105237_101180953 | 132 |
| 37 | 3300042127 | Ga0450890_005467 | Ga0450890_005467_33_461 | 132 |
| 38 | 3300042144 | Ga0450889_031320 | Ga0450889_031320_176_604 | 132 |
| 39 | iso_pu_bacteria | 2643221580 | 2643912379 | 132 |
| 40 | iso_pu_bacteria | 2643221629 | 2644167844 | 132 |
| 41 | iso_pu_bacteria | 2643221662 | 2644349303 | 132 |
| 42 | iso_pu_bacteria | 2643221674 | 2644410696 | 132 |
| 43 | iso_pu_bacteria | 2932401849 | 2932403428 | 132 |
| 44 | 3300037068 | Ga0373925_0128688 | Ga0373925_0128688_1346_1780 | 133 |
| 45 | 3300002773 | JGI25152J39213_1009866 | JGI25152J39213_10098662 | 135 |
| 46 | 3300003215 | JGI25153J46596_10008334 | JGI25153J46596_100083344 | 135 |
| 47 | 3300003771 | Ga0055526_1005942 | Ga0055526_10059429 | 135 |
| 48 | 3300025245 | Ga0207425_1000168 | Ga0207425_100016839 | 135 |
| 49 | 3300025258 | Ga0209129_1000215 | Ga0209129_100021516 | 135 |
| 50 | 3300025273 | Ga0209673_1027264 | Ga0209673_10272643 | 135 |
| 51 | 3300025295 | Ga0209564_1000057 | Ga0209564_1000057222 | 135 |
| 52 | 3300025297 | Ga0209758_1000174 | Ga0209758_100017456 | 135 |
| 53 | 3300028786 | Ga0307517_10319547 | Ga0307517_103195471 | 135 |
| 54 | 3300028794 | Ga0307515_10033350 | Ga0307515_100333503 | 135 |
| 55 | 3300028794 | Ga0307515_10554195 | Ga0307515_105541951 | 135 |
| 56 | 3300031456 | Ga0307513_10080893 | Ga0307513_100808934 | 135 |
| 57 | 3300032004 | Ga0307414_11508637 | Ga0307414_115086371 | 135 |
| 58 | 3300041460 | Ga0451802_0714199 | Ga0451802_0714199_103_543 | 135 |
| 59 | 3300042000 | Ga0439437_018917 | Ga0439437_018917_117_545 | 135 |
| 60 | 3300042120 | Ga0450917_000350 | Ga0450917_000350_2685_3113 | 135 |
| 61 | 3300042127 | Ga0450890_005423 | Ga0450890_005423_892_1320 | 135 |
| 62 | 3300048924 | Ga0496121_0015914 | Ga0496121_0015914_6834_7280 | 135 |
| 63 | 3300048928 | Ga0496125_0146114 | Ga0496125_0146114_494_940 | 135 |
| 64 | 3300001989 | JGI24739J22299_10054017 | JGI24739J22299_100540172 | 136 |
| 65 | 3300001990 | JGI24737J22298_10087323 | JGI24737J22298_100873232 | 136 |
| 66 | 3300003214 | JGI25165J46597_1002712 | JGI25165J46597_10027123 | 136 |
| 67 | 3300005327 | Ga0070658_10013399 | Ga0070658_100133993 | 136 |
| 68 | 3300005327 | Ga0070658_10073850 | Ga0070658_100738503 | 136 |
| 69 | 3300005328 | Ga0070676_10087784 | Ga0070676_100877843 | 136 |
| 70 | 3300005334 | Ga0068869_100825457 | Ga0068869_1008254571 | 136 |
| 71 | 3300005339 | Ga0070660_100043471 | Ga0070660_1000434715 | 136 |
| 72 | 3300005339 | Ga0070660_100134588 | Ga0070660_1001345882 | 136 |
| 73 | 3300005339 | Ga0070660_100348257 | Ga0070660_1003482572 | 136 |
| 74 | 3300005339 | Ga0070660_100738339 | Ga0070660_1007383392 | 136 |
| 75 | 3300005343 | Ga0070687_101420180 | Ga0070687_1014201801 | 136 |
| 76 | 3300005344 | Ga0070661_100001221 | Ga0070661_10000122110 | 136 |
| 77 | 3300005344 | Ga0070661_100024508 | Ga0070661_1000245085 | 136 |
| 78 | 3300005344 | Ga0070661_100025444 | Ga0070661_1000254442 | 136 |
| 79 | 3300005344 | Ga0070661_100047172 | Ga0070661_1000471724 | 136 |
| 80 | 3300005344 | Ga0070661_100355627 | Ga0070661_1003556272 | 136 |
| 81 | 3300005354 | Ga0070675_100494974 | Ga0070675_1004949742 | 136 |
| 82 | 3300005354 | Ga0070675_100550715 | Ga0070675_1005507152 | 136 |
| 83 | 3300005366 | Ga0070659_100083615 | Ga0070659_1000836153 | 136 |
| 84 | 3300005366 | Ga0070659_100195952 | Ga0070659_1001959522 | 136 |
| 85 | 3300005455 | Ga0070663_100226479 | Ga0070663_1002264792 | 136 |
| 86 | 3300005456 | Ga0070678_100045872 | Ga0070678_1000458723 | 136 |
| 87 | 3300005459 | Ga0068867_100089688 | Ga0068867_1000896883 | 136 |
| 88 | 3300005466 | Ga0070685_10236254 | Ga0070685_102362542 | 136 |
| 89 | 3300005539 | Ga0068853_100000349 | Ga0068853_10000034921 | 136 |
| 90 | 3300005539 | Ga0068853_100013217 | Ga0068853_1000132174 | 136 |
| 91 | 3300005539 | Ga0068853_100052062 | Ga0068853_1000520623 | 136 |
| 92 | 3300005539 | Ga0068853_100062881 | Ga0068853_1000628813 | 136 |
| 93 | 3300005539 | Ga0068853_100363451 | Ga0068853_1003634511 | 136 |
| 94 | 3300005539 | Ga0068853_101447830 | Ga0068853_1014478301 | 136 |
| 95 | 3300005543 | Ga0070672_100551205 | Ga0070672_1005512052 | 136 |
| 96 | 3300005547 | Ga0070693_100117183 | Ga0070693_1001171833 | 136 |
| 97 | 3300005548 | Ga0070665_100103231 | Ga0070665_1001032313 | 136 |
| 98 | 3300005548 | Ga0070665_100404037 | Ga0070665_1004040373 | 136 |
| 99 | 3300005563 | Ga0068855_100058763 | Ga0068855_1000587635 | 136 |
| 100 | 3300005563 | Ga0068855_100182254 | Ga0068855_1001822543 | 136 |
| 101 | 3300005563 | Ga0068855_101297421 | Ga0068855_1012974212 | 136 |
| 102 | 3300005577 | Ga0068857_100013461 | Ga0068857_1000134615 | 136 |
| 103 | 3300005578 | Ga0068854_100010975 | Ga0068854_1000109755 | 136 |
| 104 | 3300005614 | Ga0068856_100054583 | Ga0068856_1000545832 | 136 |
| 105 | 3300005616 | Ga0068852_100001009 | Ga0068852_1000010095 | 136 |
| 106 | 3300005616 | Ga0068852_100006649 | Ga0068852_1000066495 | 136 |
| 107 | 3300005616 | Ga0068852_100024276 | Ga0068852_1000242764 | 136 |
| 108 | 3300005834 | Ga0068851_10015698 | Ga0068851_100156983 | 136 |
| 109 | 3300005834 | Ga0068851_10277710 | Ga0068851_102777102 | 136 |
| 110 | 3300006178 | Ga0075367_10291395 | Ga0075367_102913952 | 136 |
| 111 | 3300006195 | Ga0075366_10328754 | Ga0075366_103287542 | 136 |
| 112 | 3300006237 | Ga0097621_101154865 | Ga0097621_1011548651 | 136 |
| 113 | 3300006358 | Ga0068871_100591616 | Ga0068871_1005916161 | 136 |
| 114 | 3300006881 | Ga0068865_100189217 | Ga0068865_1001892173 | 136 |
| 115 | 3300009093 | Ga0105240_10071843 | Ga0105240_100718433 | 136 |
| 116 | 3300009098 | Ga0105245_10618854 | Ga0105245_106188542 | 136 |
| 117 | 3300009098 | Ga0105245_10960506 | Ga0105245_109605062 | 136 |
| 118 | 3300009098 | Ga0105245_11204680 | Ga0105245_112046801 | 136 |
| 119 | 3300009174 | Ga0105241_10086009 | Ga0105241_100860092 | 136 |
| 120 | 3300009174 | Ga0105241_10174524 | Ga0105241_101745242 | 136 |
| 121 | 3300009174 | Ga0105241_10193867 | Ga0105241_101938673 | 136 |
| 122 | 3300009545 | Ga0105237_10000449 | Ga0105237_1000044931 | 136 |
| 123 | 3300009545 | Ga0105237_10140555 | Ga0105237_101405552 | 136 |
| 124 | 3300009551 | Ga0105238_10007565 | Ga0105238_100075653 | 136 |
| 125 | 3300009551 | Ga0105238_10975903 | Ga0105238_109759031 | 136 |
| 126 | 3300009553 | Ga0105249_10722870 | Ga0105249_107228702 | 136 |
| 127 | 3300010375 | Ga0105239_10009975 | Ga0105239_100099757 | 136 |
| 128 | 3300010375 | Ga0105239_10203545 | Ga0105239_102035452 | 136 |
| 129 | 3300010375 | Ga0105239_10206296 | Ga0105239_102062961 | 136 |
| 130 | 3300010375 | Ga0105239_10234949 | Ga0105239_102349493 | 136 |
| 131 | 3300010375 | Ga0105239_10276985 | Ga0105239_102769853 | 136 |
| 132 | 3300010375 | Ga0105239_11586695 | Ga0105239_115866952 | 136 |
| 133 | 3300010375 | Ga0105239_12906707 | Ga0105239_129067071 | 136 |
| 134 | 3300013100 | Ga0157373_10173691 | Ga0157373_101736912 | 136 |
| 135 | 3300013102 | Ga0157371_10008162 | Ga0157371_100081623 | 136 |
| 136 | 3300013104 | Ga0157370_10034029 | Ga0157370_100340293 | 136 |
| 137 | 3300013104 | Ga0157370_10080570 | Ga0157370_100805702 | 136 |
| 138 | 3300013104 | Ga0157370_10358565 | Ga0157370_103585652 | 136 |
| 139 | 3300013105 | Ga0157369_10517663 | Ga0157369_105176631 | 136 |
| 140 | 3300013296 | Ga0157374_10266837 | Ga0157374_102668372 | 136 |
| 141 | 3300013297 | Ga0157378_10286504 | Ga0157378_102865042 | 136 |
| 142 | 3300013307 | Ga0157372_10110687 | Ga0157372_101106872 | 136 |
| 143 | 3300013307 | Ga0157372_11237453 | Ga0157372_112374532 | 136 |
| 144 | 3300014325 | Ga0163163_10315044 | Ga0163163_103150442 | 136 |
| 145 | 3300014497 | Ga0182008_10159993 | Ga0182008_101599932 | 136 |
| 146 | 3300015261 | Ga0182006_1180099 | Ga0182006_11800991 | 136 |
| 147 | 3300020069 | Ga0197907_10579377 | Ga0197907_105793771 | 136 |
| 148 | 3300025231 | Ga0207427_102147 | Ga0207427_1021477 | 136 |
| 149 | 3300025261 | Ga0209233_1004974 | Ga0209233_10049743 | 136 |
| 150 | 3300025321 | Ga0207656_10019076 | Ga0207656_100190762 | 136 |
| 151 | 3300025321 | Ga0207656_10210265 | Ga0207656_102102652 | 136 |
| 152 | 3300025904 | Ga0207647_10140797 | Ga0207647_101407972 | 136 |
| 153 | 3300025904 | Ga0207647_10418958 | Ga0207647_104189581 | 136 |
| 154 | 3300025909 | Ga0207705_10037978 | Ga0207705_100379783 | 136 |
| 155 | 3300025909 | Ga0207705_10132289 | Ga0207705_101322892 | 136 |
| 156 | 3300025911 | Ga0207654_10077951 | Ga0207654_100779512 | 136 |
| 157 | 3300025911 | Ga0207654_10087759 | Ga0207654_100877593 | 136 |
| 158 | 3300025911 | Ga0207654_10269808 | Ga0207654_102698082 | 136 |
| 159 | 3300025913 | Ga0207695_10066670 | Ga0207695_100666704 | 136 |
| 160 | 3300025914 | Ga0207671_10000439 | Ga0207671_100004395 | 136 |
| 161 | 3300025919 | Ga0207657_10018131 | Ga0207657_100181314 | 136 |
| 162 | 3300025919 | Ga0207657_10184285 | Ga0207657_101842852 | 136 |
| 163 | 3300025919 | Ga0207657_10312317 | Ga0207657_103123172 | 136 |
| 164 | 3300025919 | Ga0207657_10425471 | Ga0207657_104254711 | 136 |
| 165 | 3300025920 | Ga0207649_10000527 | Ga0207649_1000052710 | 136 |
| 166 | 3300025920 | Ga0207649_10030843 | Ga0207649_100308432 | 136 |
| 167 | 3300025920 | Ga0207649_10054321 | Ga0207649_100543212 | 136 |
| 168 | 3300025920 | Ga0207649_10384235 | Ga0207649_103842351 | 136 |
| 169 | 3300025924 | Ga0207694_10041776 | Ga0207694_100417764 | 136 |
| 170 | 3300025924 | Ga0207694_10520193 | Ga0207694_105201931 | 136 |
| 171 | 3300025926 | Ga0207659_10177059 | Ga0207659_101770593 | 136 |
| 172 | 3300025927 | Ga0207687_10391192 | Ga0207687_103911922 | 136 |
| 173 | 3300025931 | Ga0207644_10345667 | Ga0207644_103456672 | 136 |
| 174 | 3300025932 | Ga0207690_10041697 | Ga0207690_100416973 | 136 |
| 175 | 3300025932 | Ga0207690_10119285 | Ga0207690_101192852 | 136 |
| 176 | 3300025935 | Ga0207709_10335451 | Ga0207709_103354512 | 136 |
| 177 | 3300025938 | Ga0207704_10067468 | Ga0207704_100674683 | 136 |
| 178 | 3300025940 | Ga0207691_10310158 | Ga0207691_103101582 | 136 |
| 179 | 3300025944 | Ga0207661_11416485 | Ga0207661_114164852 | 136 |
| 180 | 3300025949 | Ga0207667_10067980 | Ga0207667_100679804 | 136 |
| 181 | 3300025949 | Ga0207667_10082813 | Ga0207667_100828131 | 136 |
| 182 | 3300025972 | Ga0207668_10285333 | Ga0207668_102853332 | 136 |
| 183 | 3300026023 | Ga0207677_10185116 | Ga0207677_101851162 | 136 |
| 184 | 3300026041 | Ga0207639_10004587 | Ga0207639_1000458711 | 136 |
| 185 | 3300026041 | Ga0207639_10004923 | Ga0207639_100049231 | 136 |
| 186 | 3300026041 | Ga0207639_10141089 | Ga0207639_101410892 | 136 |
| 187 | 3300026041 | Ga0207639_10700599 | Ga0207639_107005992 | 136 |
| 188 | 3300026041 | Ga0207639_11055228 | Ga0207639_110552281 | 136 |
| 189 | 3300026067 | Ga0207678_10336824 | Ga0207678_103368242 | 136 |
| 190 | 3300026078 | Ga0207702_10062913 | Ga0207702_100629133 | 136 |
| 191 | 3300026078 | Ga0207702_10167064 | Ga0207702_101670642 | 136 |
| 192 | 3300026078 | Ga0207702_10316997 | Ga0207702_103169972 | 136 |
| 193 | 3300026078 | Ga0207702_10381417 | Ga0207702_103814172 | 136 |
| 194 | 3300026078 | Ga0207702_10956391 | Ga0207702_109563911 | 136 |
| 195 | 3300026089 | Ga0207648_10113554 | Ga0207648_101135543 | 136 |
| 196 | 3300026089 | Ga0207648_10491976 | Ga0207648_104919762 | 136 |
| 197 | 3300026116 | Ga0207674_10012591 | Ga0207674_100125916 | 136 |
| 198 | 3300026121 | Ga0207683_10020075 | Ga0207683_100200753 | 136 |
| 199 | 3300026142 | Ga0207698_10004973 | Ga0207698_100049732 | 136 |
| 200 | 3300026142 | Ga0207698_10041277 | Ga0207698_100412773 | 136 |
| 201 | 3300026142 | Ga0207698_10524860 | Ga0207698_105248602 | 136 |
| 202 | 3300027665 | Ga0209983_1050188 | Ga0209983_10501882 | 136 |
| 203 | 3300028379 | Ga0268266_10000474 | Ga0268266_1000047444 | 136 |
| 204 | 3300028379 | Ga0268266_10840110 | Ga0268266_108401101 | 136 |
| 205 | 3300028800 | Ga0265338_10128681 | Ga0265338_101286813 | 136 |
| 206 | 3300031240 | Ga0265320_10028777 | Ga0265320_100287774 | 136 |
| 207 | 3300031241 | Ga0265325_10010008 | Ga0265325_100100085 | 136 |
| 208 | 3300031249 | Ga0265339_10000389 | Ga0265339_1000038914 | 136 |
| 209 | 3300031344 | Ga0265316_10019457 | Ga0265316_100194573 | 136 |
| 210 | 3300031595 | Ga0265313_10000449 | Ga0265313_1000044938 | 136 |
| 211 | 3300031711 | Ga0265314_10036366 | Ga0265314_100363665 | 136 |
| 212 | 3300031711 | Ga0265314_10051063 | Ga0265314_100510634 | 136 |
| 213 | 3300032002 | Ga0307416_100873905 | Ga0307416_1008739052 | 136 |
| 214 | 3300032004 | Ga0307414_10059427 | Ga0307414_100594273 | 136 |
| 215 | 3300032004 | Ga0307414_10071544 | Ga0307414_100715443 | 136 |
| 216 | 3300032004 | Ga0307414_10083384 | Ga0307414_100833842 | 136 |
| 217 | 3300032004 | Ga0307414_10091941 | Ga0307414_100919413 | 136 |
| 218 | 3300032004 | Ga0307414_10855571 | Ga0307414_108555712 | 136 |
| 219 | 3300035088 | Ga0373940_0111205 | Ga0373940_0111205_331_774 | 136 |
| 220 | 3300035111 | Ga0373923_0009192 | Ga0373923_0009192_2501_2944 | 136 |
| 221 | 3300035119 | Ga0373956_0036765 | Ga0373956_0036765_1046_1489 | 136 |
| 222 | 3300035172 | Ga0373955_0080419 | Ga0373955_0080419_546_989 | 136 |
| 223 | 3300035691 | Ga0373931_0190064 | Ga0373931_0190064_445_888 | 136 |
| 224 | 3300035724 | Ga0373933_0090079 | Ga0373933_0090079_190_633 | 136 |
| 225 | 3300036401 | Ga0373937_0002210 | Ga0373937_0002210_8155_8598 | 136 |
| 226 | 3300037068 | Ga0373925_1127660 | Ga0373925_1127660_99_539 | 136 |
| 227 | 3300037312 | Ga0395899_0177782 | Ga0395899_0177782_275_718 | 136 |
| 228 | 3300037466 | Ga0395898_1141859 | Ga0395898_1141859_101_544 | 136 |
| 229 | 3300041413 | Ga0439465_0027030 | Ga0439465_0027030_1050_1508 | 136 |
| 230 | 3300041441 | Ga0451787_716454 | Ga0451787_716454_195_635 | 136 |
| 231 | 3300041509 | Ga0451843_1176783 | Ga0451843_1176783_118_576 | 136 |
| 232 | 3300046679 | Ga0495623_0012224 | Ga0495623_0012224_854_1297 | 136 |
| 233 | 3300048088 | Ga0495602_0037020 | Ga0495602_0037020_3856_4299 | 136 |
| 234 | 3300048905 | Ga0496102_0368988 | Ga0496102_0368988_723_1181 | 136 |
| 235 | 3300049571 | Ga0501034_0004211 | Ga0501034_0004211_11789_12241 | 136 |
| 236 | 3300049571 | Ga0501034_0016743 | Ga0501034_0016743_4869_5309 | 136 |
| 237 | 3300049571 | Ga0501034_0231939 | Ga0501034_0231939_1287_1730 | 136 |
| 238 | 3300049571 | Ga0501034_0553868 | Ga0501034_0553868_103_561 | 136 |
| 239 | 3300049571 | Ga0501034_1016692 | Ga0501034_1016692_151_603 | 136 |
| 240 | 3300049572 | Ga0501036_1306718 | Ga0501036_1306718_66_524 | 136 |
| 241 | 3300049573 | Ga0501037_0119831 | Ga0501037_0119831_544_987 | 136 |
| 242 | 3300049574 | Ga0501038_0008126 | Ga0501038_0008126_836_1279 | 136 |
| 243 | 3300049579 | Ga0501043_0452369 | Ga0501043_0452369_463_906 | 136 |
| 244 | 3300049581 | Ga0501047_0782199 | Ga0501047_0782199_134_577 | 136 |
| 245 | 3300049583 | Ga0501067_0278909 | Ga0501067_0278909_210_653 | 136 |
| 246 | 3300049586 | Ga0501070_0053374 | Ga0501070_0053374_2032_2475 | 136 |
| 247 | 3300049587 | Ga0501071_0442410 | Ga0501071_0442410_509_952 | 136 |
| 248 | 3300049592 | Ga0501076_1014595 | Ga0501076_1014595_62_520 | 136 |
| 249 | 3300049741 | Ga0501079_0689985 | Ga0501079_0689985_84_521 | 136 |
| 250 | 3300049823 | Ga0501044_0199360 | Ga0501044_0199360_1158_1601 | 136 |
| 251 | 3300050493 | nmdc:mga0k408_327260_c1 | nmdc:mga0k408_327260_c1_195_653 | 136 |
| 252 | 3300050494 | nmdc:mga06z11_625803_c1 | nmdc:mga06z11_625803_c1_177_638 | 136 |
| 253 | 3300050516 | nmdc:mga0sz30_241257_c1 | nmdc:mga0sz30_241257_c1_237_695 | 136 |
| 254 | 3300053151 | Ga0500604_0000191 | Ga0500604_0000191_1481_1933 | 136 |
| 255 | 3300053161 | Ga0500634_0006404 | Ga0500634_0006404_2634_3086 | 136 |
| 256 | 3300053161 | Ga0500634_0335580 | Ga0500634_0335580_73_525 | 136 |
| 257 | 3300005327 | Ga0070658_11087767 | Ga0070658_110877671 | 137 |
| 258 | 3300005339 | Ga0070660_100006116 | Ga0070660_1000061167 | 137 |
| 259 | 3300005366 | Ga0070659_100067883 | Ga0070659_1000678833 | 137 |
| 260 | 3300005530 | Ga0070679_100071081 | Ga0070679_1000710813 | 137 |
| 261 | 3300005614 | Ga0068856_100334501 | Ga0068856_1003345012 | 137 |
| 262 | 3300006038 | Ga0075365_10640614 | Ga0075365_106406142 | 137 |
| 263 | 3300009545 | Ga0105237_10928212 | Ga0105237_109282121 | 137 |
| 264 | 3300009551 | Ga0105238_10525728 | Ga0105238_105257282 | 137 |
| 265 | 3300025909 | Ga0207705_10159067 | Ga0207705_101590672 | 137 |
| 266 | 3300025919 | Ga0207657_10015968 | Ga0207657_100159683 | 137 |
| 267 | 3300025924 | Ga0207694_10396681 | Ga0207694_103966812 | 137 |
| 268 | 3300025949 | Ga0207667_10089702 | Ga0207667_100897024 | 137 |
| 269 | 3300026078 | Ga0207702_11409813 | Ga0207702_114098132 | 137 |
| 270 | 3300050490 | nmdc:mga03n38_172687_c1 | nmdc:mga03n38_172687_c1_17_460 | 137 |
| 271 | 3300048925 | Ga0496122_0003947 | Ga0496122_0003947_1707_2156 | 138 |
| 272 | 3300048926 | Ga0496123_0032480 | Ga0496123_0032480_1284_1733 | 138 |
| 273 | 3300048927 | Ga0496124_0100189 | Ga0496124_0100189_976_1425 | 138 |
| 274 | 3300048928 | Ga0496125_0000988 | Ga0496125_0000988_21718_22167 | 138 |
| 275 | 3300048929 | Ga0496126_0024961 | Ga0496126_0024961_3056_3505 | 138 |
| 276 | iso_pu_bacteria | 2643221544 | 2643745955 | 138 |
| 277 | iso_pu_bacteria | 2932422444 | 2932423321 | 138 |
| 278 | 3300007265 | Ga0099794_10077383 | Ga0099794_100773831 | 139 |
| 279 | 3300007788 | Ga0099795_10237368 | Ga0099795_102373682 | 139 |
| 280 | 3300010159 | Ga0099796_10047611 | Ga0099796_100476112 | 139 |
| 281 | 3300027512 | Ga0209179_1050355 | Ga0209179_10503552 | 139 |
| 282 | 3300027671 | Ga0209588_1029425 | Ga0209588_10294253 | 139 |
| 283 | 3300027671 | Ga0209588_1030664 | Ga0209588_10306643 | 139 |
| 284 | 3300027671 | Ga0209588_1059549 | Ga0209588_10595491 | 139 |
| 285 | 3300041997 | Ga0439431_0157539 | Ga0439431_0157539_10_477 | 139 |
| 286 | iso_pu_bacteria | 2511231156 | 2511825074 | 139 |
| 287 | iso_pu_bacteria | 2547132374 | 2548501588 | 139 |
| 288 | iso_pu_bacteria | 2599185212 | 2599611766 | 139 |
| 289 | iso_pu_bacteria | 2599185248 | 2599768914 | 139 |
| 290 | iso_pu_bacteria | 2599185289 | 2599884698 | 139 |
| 291 | iso_pu_bacteria | 2599185291 | 2599896123 | 139 |
| 292 | iso_pu_bacteria | 2599185305 | 2599958009 | 139 |
| 293 | iso_pu_bacteria | 2599185306 | 2599968620 | 139 |
| 294 | iso_pu_bacteria | 2599185308 | 2599979812 | 139 |
| 295 | iso_pu_bacteria | 2599185313 | 2600003903 | 139 |
| 296 | iso_pu_bacteria | 2599185314 | 2600013624 | 139 |
| 297 | iso_pu_bacteria | 2599185315 | 2600015732 | 139 |
| 298 | iso_pu_bacteria | 2599185318 | 2600034021 | 139 |
| 299 | iso_pu_bacteria | 2599185319 | 2600040462 | 139 |
| 300 | iso_pu_bacteria | 2599185321 | 2600050939 | 139 |
| 301 | iso_pu_bacteria | 2599185322 | 2600058618 | 139 |
| 302 | iso_pu_bacteria | 2599185323 | 2600063466 | 139 |
| 303 | iso_pu_bacteria | 2599185324 | 2600069009 | 139 |
| 304 | iso_pu_bacteria | 2643221609 | 2644061992 | 139 |
| 305 | iso_pu_bacteria | 2643221611 | 2644076106 | 139 |
| 306 | iso_pu_bacteria | 2643221650 | 2644281197 | 139 |
| 307 | iso_pu_bacteria | 2667528170 | 2671088817 | 139 |
| 308 | iso_pu_bacteria | 2808606418 | 2809147647 | 139 |
| 309 | iso_pu_bacteria | 2825651385 | 2825652146 | 139 |
| 310 | iso_pu_bacteria | 2913036834 | 2913040236 | 139 |
| 311 | iso_pu_bacteria | 2923586266 | 2923588277 | 139 |
| 312 | iso_pu_bacteria | 2931369376 | 2931375021 | 139 |
| 313 | 3300009551 | Ga0105238_10177639 | Ga0105238_101776393 | 140 |
| 314 | 3300013102 | Ga0157371_10199899 | Ga0157371_101998993 | 140 |
| 315 | 3300013296 | Ga0157374_10015333 | Ga0157374_100153336 | 140 |
| 316 | 3300053119 | Ga0500595_063350 | Ga0500595_063350_426_917 | 140 |
| 317 | 3300045051 | Ga0451576_0000449 | Ga0451576_0000449_3648_4076 | 141 |
| 318 | 3300048904 | Ga0496101_0052251 | Ga0496101_0052251_2142_2573 | 141 |
| 319 | 3300048907 | Ga0496104_0036185 | Ga0496104_0036185_2905_3336 | 141 |
| 320 | 3300048908 | Ga0496105_0023729 | Ga0496105_0023729_1845_2276 | 141 |
| 321 | 3300048911 | Ga0496108_0940579 | Ga0496108_0940579_254_685 | 141 |
| 322 | 3300048913 | Ga0496110_0055974 | Ga0496110_0055974_294_725 | 141 |
| 323 | 3300048914 | Ga0496111_0190562 | Ga0496111_0190562_96_527 | 141 |
| 324 | 3300048915 | Ga0496112_0043895 | Ga0496112_0043895_3531_3962 | 141 |
| 325 | 3300048916 | Ga0496113_0050121 | Ga0496113_0050121_498_929 | 141 |
| 326 | 3300048918 | Ga0496115_0183109 | Ga0496115_0183109_344_775 | 141 |
| 327 | 3300048918 | Ga0496115_0270725 | Ga0496115_0270725_265_696 | 141 |
| 328 | 3300048922 | Ga0496119_0000421 | Ga0496119_0000421_36618_37049 | 141 |
| 329 | 3300048923 | Ga0496120_0396148 | Ga0496120_0396148_136_567 | 141 |
| 330 | 3300048928 | Ga0496125_0000207 | Ga0496125_0000207_78160_78597 | 141 |
| 331 | iso_pu_bacteria | 2521172590 | 2521558260 | 141 |
| 332 | iso_pu_bacteria | 2904439833 | 2904440957 | 141 |
| 333 | iso_pu_bacteria | 2904530477 | 2904532109 | 141 |
| 334 | iso_pu_bacteria | 2904584206 | 2904587662 | 141 |
| 335 | iso_pu_bacteria | 2904589729 | 2904590178 | 141 |
| 336 | iso_pu_bacteria | 2904601388 | 2904602440 | 141 |
| 337 | iso_pu_bacteria | 2919079590 | 2919080060 | 141 |
| 338 | 3300031728 | Ga0316578_10579214 | Ga0316578_105792141 | 142 |
| 339 | 3300035398 | Ga0316574_0255744 | Ga0316574_0255744_130_567 | 142 |
| 340 | 3300035410 | Ga0373924_0572862 | Ga0373924_0572862_19_450 | 142 |
| 341 | 3300036401 | Ga0373937_0195950 | Ga0373937_0195950_1144_1638 | 142 |
| 342 | 3300037466 | Ga0395898_1569571 | Ga0395898_1569571_40_498 | 142 |
| 343 | 3300037471 | Ga0395905_0286446 | Ga0395905_0286446_94_552 | 142 |
| 344 | 3300042126 | Ga0450888_000965 | Ga0450888_000965_1039_1467 | 142 |
| 345 | 3300042129 | Ga0450891_000163 | Ga0450891_000163_2084_2512 | 142 |
| 346 | 3300042144 | Ga0450889_016539 | Ga0450889_016539_190_618 | 142 |
| 347 | 3300042532 | Ga0450893_0001105 | Ga0450893_0001105_2065_2493 | 142 |
| 348 | 3300053077 | Ga0495601_0435023 | Ga0495601_0435023_89_583 | 142 |
| 349 | 3300003775 | Ga0055524_1000247 | Ga0055524_100024731 | 143 |
| 350 | 3300003781 | Ga0055536_1052463 | Ga0055536_10524631 | 143 |
| 351 | 3300003791 | Ga0055530_10001019 | Ga0055530_100010194 | 143 |
| 352 | 3300003792 | Ga0055540_1000729 | Ga0055540_10007294 | 143 |
| 353 | 3300005288 | Ga0065714_10065246 | Ga0065714_100652464 | 143 |
| 354 | 3300005328 | Ga0070676_10013668 | Ga0070676_100136682 | 143 |
| 355 | 3300005328 | Ga0070676_10418084 | Ga0070676_104180842 | 143 |
| 356 | 3300005330 | Ga0070690_100280057 | Ga0070690_1002800572 | 143 |
| 357 | 3300005331 | Ga0070670_100081739 | Ga0070670_1000817392 | 143 |
| 358 | 3300005333 | Ga0070677_10019898 | Ga0070677_100198982 | 143 |
| 359 | 3300005333 | Ga0070677_10118884 | Ga0070677_101188842 | 143 |
| 360 | 3300005334 | Ga0068869_100013257 | Ga0068869_1000132575 | 143 |
| 361 | 3300005338 | Ga0068868_100498358 | Ga0068868_1004983582 | 143 |
| 362 | 3300005338 | Ga0068868_101046226 | Ga0068868_1010462261 | 143 |
| 363 | 3300005339 | Ga0070660_100090821 | Ga0070660_1000908211 | 143 |
| 364 | 3300005344 | Ga0070661_100000248 | Ga0070661_10000024823 | 143 |
| 365 | 3300005344 | Ga0070661_100597568 | Ga0070661_1005975682 | 143 |
| 366 | 3300005347 | Ga0070668_100910456 | Ga0070668_1009104562 | 143 |
| 367 | 3300005353 | Ga0070669_100285191 | Ga0070669_1002851911 | 143 |
| 368 | 3300005354 | Ga0070675_100018608 | Ga0070675_1000186082 | 143 |
| 369 | 3300005356 | Ga0070674_100034350 | Ga0070674_1000343503 | 143 |
| 370 | 3300005364 | Ga0070673_100424817 | Ga0070673_1004248172 | 143 |
| 371 | 3300005364 | Ga0070673_100467230 | Ga0070673_1004672303 | 143 |
| 372 | 3300005367 | Ga0070667_100098718 | Ga0070667_1000987182 | 143 |
| 373 | 3300005367 | Ga0070667_100789759 | Ga0070667_1007897591 | 143 |
| 374 | 3300005445 | Ga0070708_100716652 | Ga0070708_1007166522 | 143 |
| 375 | 3300005456 | Ga0070678_100034672 | Ga0070678_1000346723 | 143 |
| 376 | 3300005457 | Ga0070662_101059414 | Ga0070662_1010594141 | 143 |
| 377 | 3300005466 | Ga0070685_11548297 | Ga0070685_115482971 | 143 |
| 378 | 3300005539 | Ga0068853_100227595 | Ga0068853_1002275953 | 143 |
| 379 | 3300005543 | Ga0070672_100010695 | Ga0070672_1000106954 | 143 |
| 380 | 3300005543 | Ga0070672_100362487 | Ga0070672_1003624872 | 143 |
| 381 | 3300005548 | Ga0070665_100492110 | Ga0070665_1004921103 | 143 |
| 382 | 3300005548 | Ga0070665_101219192 | Ga0070665_1012191922 | 143 |
| 383 | 3300005564 | Ga0070664_100000183 | Ga0070664_10000018316 | 143 |
| 384 | 3300005578 | Ga0068854_100757654 | Ga0068854_1007576542 | 143 |
| 385 | 3300005615 | Ga0070702_100367518 | Ga0070702_1003675182 | 143 |
| 386 | 3300005617 | Ga0068859_100291748 | Ga0068859_1002917482 | 143 |
| 387 | 3300005834 | Ga0068851_10699421 | Ga0068851_106994212 | 143 |
| 388 | 3300005842 | Ga0068858_100092511 | Ga0068858_1000925113 | 143 |
| 389 | 3300006038 | Ga0075365_10006101 | Ga0075365_100061018 | 143 |
| 390 | 3300006195 | Ga0075366_10000694 | Ga0075366_100006944 | 143 |
| 391 | 3300006195 | Ga0075366_10056855 | Ga0075366_100568552 | 143 |
| 392 | 3300006195 | Ga0075366_10392749 | Ga0075366_103927492 | 143 |
| 393 | 3300006353 | Ga0075370_10015667 | Ga0075370_100156676 | 143 |
| 394 | 3300006353 | Ga0075370_10542142 | Ga0075370_105421422 | 143 |
| 395 | 3300006871 | Ga0075434_101513657 | Ga0075434_1015136572 | 143 |
| 396 | 3300006931 | Ga0097620_100291761 | Ga0097620_1002917612 | 143 |
| 397 | 3300007076 | Ga0075435_100271808 | Ga0075435_1002718082 | 143 |
| 398 | 3300009036 | Ga0105244_10000664 | Ga0105244_1000066420 | 143 |
| 399 | 3300009036 | Ga0105244_10001980 | Ga0105244_100019806 | 143 |
| 400 | 3300009093 | Ga0105240_10689874 | Ga0105240_106898743 | 143 |
| 401 | 3300009147 | Ga0114129_11855255 | Ga0114129_118552552 | 143 |
| 402 | 3300009148 | Ga0105243_10016631 | Ga0105243_100166313 | 143 |
| 403 | 3300009174 | Ga0105241_11715614 | Ga0105241_117156141 | 143 |
| 404 | 3300009176 | Ga0105242_10000355 | Ga0105242_1000035516 | 143 |
| 405 | 3300009545 | Ga0105237_10000009 | Ga0105237_10000009253 | 143 |
| 406 | 3300011119 | Ga0105246_10007067 | Ga0105246_100070674 | 143 |
| 407 | 3300011119 | Ga0105246_10009957 | Ga0105246_100099573 | 143 |
| 408 | 3300011119 | Ga0105246_10389824 | Ga0105246_103898241 | 143 |
| 409 | 3300013100 | Ga0157373_10019283 | Ga0157373_100192832 | 143 |
| 410 | 3300013104 | Ga0157370_10113556 | Ga0157370_101135562 | 143 |
| 411 | 3300013105 | Ga0157369_10005088 | Ga0157369_100050885 | 143 |
| 412 | 3300013297 | Ga0157378_10867244 | Ga0157378_108672442 | 143 |
| 413 | 3300013306 | Ga0163162_10031279 | Ga0163162_100312797 | 143 |
| 414 | 3300013306 | Ga0163162_10363558 | Ga0163162_103635582 | 143 |
| 415 | 3300013306 | Ga0163162_10514174 | Ga0163162_105141742 | 143 |
| 416 | 3300013308 | Ga0157375_10195842 | Ga0157375_101958423 | 143 |
| 417 | 3300013308 | Ga0157375_10466894 | Ga0157375_104668943 | 143 |
| 418 | 3300014326 | Ga0157380_10103882 | Ga0157380_101038824 | 143 |
| 419 | 3300014497 | Ga0182008_10002018 | Ga0182008_1000201810 | 143 |
| 420 | 3300014969 | Ga0157376_10488341 | Ga0157376_104883412 | 143 |
| 421 | 3300015261 | Ga0182006_1006449 | Ga0182006_10064493 | 143 |
| 422 | 3300015262 | Ga0182007_10003535 | Ga0182007_100035354 | 143 |
| 423 | 3300017792 | Ga0163161_10497745 | Ga0163161_104977452 | 143 |
| 424 | 3300025242 | Ga0209258_100789 | Ga0209258_10078910 | 143 |
| 425 | 3300025256 | Ga0209759_1010535 | Ga0209759_10105353 | 143 |
| 426 | 3300025263 | Ga0209565_1041173 | Ga0209565_10411732 | 143 |
| 427 | 3300025291 | Ga0209675_1016780 | Ga0209675_10167803 | 143 |
| 428 | 3300025292 | Ga0209676_1001989 | Ga0209676_10019897 | 143 |
| 429 | 3300025298 | Ga0209050_1000013 | Ga0209050_1000013553 | 143 |
| 430 | 3300025298 | Ga0209050_1035778 | Ga0209050_10357782 | 143 |
| 431 | 3300025299 | Ga0209256_1000049 | Ga0209256_100004943 | 143 |
| 432 | 3300025303 | Ga0209051_1000007 | Ga0209051_1000007553 | 143 |
| 433 | 3300025304 | Ga0209257_1015932 | Ga0209257_10159322 | 143 |
| 434 | 3300025304 | Ga0209257_1080089 | Ga0209257_10800891 | 143 |
| 435 | 3300025728 | Ga0207655_1000114 | Ga0207655_1000114129 | 143 |
| 436 | 3300025893 | Ga0207682_10018862 | Ga0207682_100188624 | 143 |
| 437 | 3300025893 | Ga0207682_10082214 | Ga0207682_100822142 | 143 |
| 438 | 3300025907 | Ga0207645_10088213 | Ga0207645_100882132 | 143 |
| 439 | 3300025907 | Ga0207645_10148175 | Ga0207645_101481752 | 143 |
| 440 | 3300025907 | Ga0207645_10317823 | Ga0207645_103178232 | 143 |
| 441 | 3300025914 | Ga0207671_10000690 | Ga0207671_1000069021 | 143 |
| 442 | 3300025920 | Ga0207649_10000032 | Ga0207649_10000032108 | 143 |
| 443 | 3300025923 | Ga0207681_10112919 | Ga0207681_101129192 | 143 |
| 444 | 3300025926 | Ga0207659_10017487 | Ga0207659_100174874 | 143 |
| 445 | 3300025933 | Ga0207706_10223119 | Ga0207706_102231192 | 143 |
| 446 | 3300025934 | Ga0207686_10005728 | Ga0207686_100057282 | 143 |
| 447 | 3300025937 | Ga0207669_10857292 | Ga0207669_108572922 | 143 |
| 448 | 3300025940 | Ga0207691_10012108 | Ga0207691_100121084 | 143 |
| 449 | 3300025945 | Ga0207679_10000059 | Ga0207679_1000005924 | 143 |
| 450 | 3300025949 | Ga0207667_11644889 | Ga0207667_116448891 | 143 |
| 451 | 3300025960 | Ga0207651_10634082 | Ga0207651_106340822 | 143 |
| 452 | 3300025986 | Ga0207658_10310958 | Ga0207658_103109581 | 143 |
| 453 | 3300026023 | Ga0207677_10528235 | Ga0207677_105282352 | 143 |
| 454 | 3300026035 | Ga0207703_10134246 | Ga0207703_101342462 | 143 |
| 455 | 3300026088 | Ga0207641_10423736 | Ga0207641_104237362 | 143 |
| 456 | 3300026089 | Ga0207648_10011938 | Ga0207648_100119386 | 143 |
| 457 | 3300026121 | Ga0207683_10014515 | Ga0207683_100145154 | 143 |
| 458 | 3300026142 | Ga0207698_10378417 | Ga0207698_103784172 | 143 |
| 459 | 3300028379 | Ga0268266_10040674 | Ga0268266_100406744 | 143 |
| 460 | 3300028379 | Ga0268266_11629458 | Ga0268266_116294582 | 143 |
| 461 | 3300030733 | Ga0314311_1242699 | Ga0314311_12426994 | 143 |
| 462 | 3300030742 | Ga0316183_1105814 | Ga0316183_11058143 | 143 |
| 463 | 3300031238 | Ga0265332_10003905 | Ga0265332_100039056 | 143 |
| 464 | 3300031251 | Ga0265327_10181342 | Ga0265327_101813422 | 143 |
| 465 | 3300031548 | Ga0307408_100000662 | Ga0307408_10000066225 | 143 |
| 466 | 3300031548 | Ga0307408_100350498 | Ga0307408_1003504982 | 143 |
| 467 | 3300031548 | Ga0307408_100408660 | Ga0307408_1004086602 | 143 |
| 468 | 3300031548 | Ga0307408_100602420 | Ga0307408_1006024202 | 143 |
| 469 | 3300031824 | Ga0307413_10681687 | Ga0307413_106816872 | 143 |
| 470 | 3300031901 | Ga0307406_10291971 | Ga0307406_102919712 | 143 |
| 471 | 3300031911 | Ga0307412_11059169 | Ga0307412_110591691 | 143 |
| 472 | 3300032002 | Ga0307416_100431834 | Ga0307416_1004318342 | 143 |
| 473 | 3300032004 | Ga0307414_10668757 | Ga0307414_106687572 | 143 |
| 474 | 3300035083 | Ga0373926_0003426 | Ga0373926_0003426_402_836 | 143 |
| 475 | 3300035086 | Ga0373934_0095599 | Ga0373934_0095599_46_480 | 143 |
| 476 | 3300035089 | Ga0373944_0033220 | Ga0373944_0033220_1006_1440 | 143 |
| 477 | 3300035111 | Ga0373923_0200787 | Ga0373923_0200787_154_588 | 143 |
| 478 | 3300035113 | Ga0373936_0044790 | Ga0373936_0044790_484_918 | 143 |
| 479 | 3300035116 | Ga0373945_0007902 | Ga0373945_0007902_1988_2422 | 143 |
| 480 | 3300035118 | Ga0373954_0203607 | Ga0373954_0203607_378_812 | 143 |
| 481 | 3300035119 | Ga0373956_0153094 | Ga0373956_0153094_360_794 | 143 |
| 482 | 3300035692 | Ga0373935_0006183 | Ga0373935_0006183_233_667 | 143 |
| 483 | 3300035695 | Ga0373927_0035932 | Ga0373927_0035932_2592_3026 | 143 |
| 484 | 3300035725 | Ga0373947_0006814 | Ga0373947_0006814_221_655 | 143 |
| 485 | 3300037068 | Ga0373925_0005295 | Ga0373925_0005295_8771_9205 | 143 |
| 486 | 3300037312 | Ga0395899_0251771 | Ga0395899_0251771_174_608 | 143 |
| 487 | 3300037466 | Ga0395898_0053933 | Ga0395898_0053933_2309_2743 | 143 |
| 488 | 3300037471 | Ga0395905_0219153 | Ga0395905_0219153_51_485 | 143 |
| 489 | 3300038443 | Ga0395901_0612107 | Ga0395901_0612107_466_900 | 143 |
| 490 | 3300042007 | Ga0439449_0059913 | Ga0439449_0059913_370_807 | 143 |
| 491 | 3300042013 | Ga0439456_157216 | Ga0439456_157216_79_513 | 143 |
| 492 | 3300042016 | Ga0439463_004390 | Ga0439463_004390_636_1070 | 143 |
| 493 | 3300042016 | Ga0439463_036476 | Ga0439463_036476_292_726 | 143 |
| 494 | 3300042134 | Ga0450898_023790 | Ga0450898_023790_26_460 | 143 |
| 495 | 3300042436 | Ga0439435_0077967 | Ga0439435_0077967_443_877 | 143 |
| 496 | 3300044656 | Ga0466969_0206080 | Ga0466969_0206080_309_755 | 143 |
| 497 | 3300044666 | Ga0466977_0001086 | Ga0466977_0001086_9362_9808 | 143 |
| 498 | 3300046459 | Ga0495629_0003586 | Ga0495629_0003586_8374_8808 | 143 |
| 499 | 3300046462 | Ga0495651_0155334 | Ga0495651_0155334_288_722 | 143 |
| 500 | 3300046472 | Ga0495580_0013721 | Ga0495580_0013721_5408_5842 | 143 |
| 501 | 3300046472 | Ga0495580_0354821 | Ga0495580_0354821_541_975 | 143 |
| 502 | 3300046473 | Ga0495582_0038825 | Ga0495582_0038825_700_1134 | 143 |
| 503 | 3300046499 | Ga0495594_0027819 | Ga0495594_0027819_235_669 | 143 |
| 504 | 3300046517 | Ga0495630_0014687 | Ga0495630_0014687_4669_5103 | 143 |
| 505 | 3300046526 | Ga0495666_0179758 | Ga0495666_0179758_102_536 | 143 |
| 506 | 3300046531 | Ga0495665_0081907 | Ga0495665_0081907_775_1209 | 143 |
| 507 | 3300046542 | Ga0495597_0007752 | Ga0495597_0007752_2230_2682 | 143 |
| 508 | 3300046559 | Ga0495667_0292134 | Ga0495667_0292134_376_810 | 143 |
| 509 | 3300046615 | Ga0495656_0152991 | Ga0495656_0152991_557_991 | 143 |
| 510 | 3300046674 | Ga0495588_0139811 | Ga0495588_0139811_482_916 | 143 |
| 511 | 3300046681 | Ga0495647_0004812 | Ga0495647_0004812_2592_3026 | 143 |
| 512 | 3300046683 | Ga0495658_0009719 | Ga0495658_0009719_3165_3599 | 143 |
| 513 | 3300046683 | Ga0495658_0093980 | Ga0495658_0093980_102_536 | 143 |
| 514 | 3300046689 | Ga0495613_0039733 | Ga0495613_0039733_278_712 | 143 |
| 515 | 3300046809 | Ga0495600_0037333 | Ga0495600_0037333_540_974 | 143 |
| 516 | 3300047315 | Ga0495581_0003509 | Ga0495581_0003509_2489_2923 | 143 |
| 517 | 3300047471 | Ga0495684_0026211 | Ga0495684_0026211_358_792 | 143 |
| 518 | 3300047673 | Ga0495593_0126968 | Ga0495593_0126968_480_914 | 143 |
| 519 | 3300048903 | Ga0496100_0050912 | Ga0496100_0050912_1032_1463 | 143 |
| 520 | 3300048904 | Ga0496101_0603828 | Ga0496101_0603828_174_605 | 143 |
| 521 | 3300048917 | Ga0496114_0046024 | Ga0496114_0046024_1886_2320 | 143 |
| 522 | 3300048924 | Ga0496121_0010360 | Ga0496121_0010360_4009_4443 | 143 |
| 523 | 3300048927 | Ga0496124_0061921 | Ga0496124_0061921_1478_1912 | 143 |
| 524 | 3300048928 | Ga0496125_0010905 | Ga0496125_0010905_3119_3553 | 143 |
| 525 | 3300048928 | Ga0496125_0017457 | Ga0496125_0017457_728_1162 | 143 |
| 526 | 3300048929 | Ga0496126_0176182 | Ga0496126_0176182_1090_1524 | 143 |
| 527 | 3300048929 | Ga0496126_0181233 | Ga0496126_0181233_997_1431 | 143 |
| 528 | 3300049569 | Ga0501032_0008188 | Ga0501032_0008188_3167_3607 | 143 |
| 529 | 3300049571 | Ga0501034_0661794 | Ga0501034_0661794_365_805 | 143 |
| 530 | 3300049573 | Ga0501037_0041212 | Ga0501037_0041212_2581_3021 | 143 |
| 531 | 3300050489 | nmdc:mga03683_65761_c1 | nmdc:mga03683_65761_c1_681_1115 | 143 |
| 532 | 3300050496 | nmdc:mga07m45_5883_c1 | nmdc:mga07m45_5883_c1_5145_5582 | 143 |
| 533 | 3300053084 | Ga0495595_0109724 | Ga0495595_0109724_475_909 | 143 |
| 534 | 3300053085 | Ga0495619_0012434 | Ga0495619_0012434_2578_3012 | 143 |
| 535 | 3300009177 | Ga0105248_10959647 | Ga0105248_109596471 | 144 |
| 536 | 3300014968 | Ga0157379_10204453 | Ga0157379_102044533 | 144 |
| 537 | 3300025941 | Ga0207711_10724682 | Ga0207711_107246821 | 144 |
| 538 | 3300028381 | Ga0268264_10195034 | Ga0268264_101950343 | 144 |
| 539 | 3300028800 | Ga0265338_10000057 | Ga0265338_1000005747 | 144 |
| 540 | 3300031239 | Ga0265328_10045331 | Ga0265328_100453312 | 144 |
| 541 | 3300031711 | Ga0265314_10038798 | Ga0265314_100387985 | 144 |
| 542 | 3300032004 | Ga0307414_10155180 | Ga0307414_101551801 | 144 |
| 543 | 3300032005 | Ga0307411_10058265 | Ga0307411_100582654 | 144 |
| 544 | 3300044842 | Ga0466957_0615945 | Ga0466957_0615945_187_627 | 144 |
| 545 | 3300049665 | Ga0501227_035318 | Ga0501227_035318_750_1184 | 144 |
| 546 | iso_pu_bacteria | 2894023352 | 2894026313 | 144 |
| 547 | 3300005563 | Ga0068855_100106005 | Ga0068855_1001060053 | 145 |
| 548 | 3300005578 | Ga0068854_100066513 | Ga0068854_1000665136 | 145 |
| 549 | 3300009545 | Ga0105237_10004993 | Ga0105237_100049933 | 145 |
| 550 | 3300009551 | Ga0105238_10052650 | Ga0105238_100526502 | 145 |
| 551 | 3300015261 | Ga0182006_1004913 | Ga0182006_10049132 | 145 |
| 552 | 3300025913 | Ga0207695_10000377 | Ga0207695_1000037780 | 145 |
| 553 | 3300025924 | Ga0207694_10041037 | Ga0207694_100410372 | 145 |
| 554 | 3300025949 | Ga0207667_10201064 | Ga0207667_102010643 | 145 |
| 555 | 3300025981 | Ga0207640_10005936 | Ga0207640_100059363 | 145 |
| 556 | 3300044693 | Ga0466961_0135814 | Ga0466961_0135814_1005_1460 | 145 |
| 557 | 3300006237 | Ga0097621_100698264 | Ga0097621_1006982642 | 146 |
| 558 | 3300014325 | Ga0163163_12501822 | Ga0163163_125018221 | 146 |
| 559 | 3300031507 | Ga0307509_10220205 | Ga0307509_102202053 | 146 |
| 560 | 3300031730 | Ga0307516_10000689 | Ga0307516_1000068940 | 146 |
| 561 | 3300048089 | Ga0495614_0292362 | Ga0495614_0292362_34_540 | 146 |
| 562 | 3300049588 | Ga0501072_0865955 | Ga0501072_0865955_135_590 | 148 |
| 563 | 2162886007 | SwRhRL2b_contig_3754625 | SwRhRL2b_0880.00003420 | 149 |
| 564 | 3300005289 | Ga0065704_10093382 | Ga0065704_100933823 | 149 |
| 565 | 3300048925 | Ga0496122_0075138 | Ga0496122_0075138_176_625 | 149 |
| 566 | 3300048926 | Ga0496123_0084574 | Ga0496123_0084574_850_1299 | 149 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MDI7_1_157_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.5668 | 9 | 105 | 1.20.1080.10 |
| af_I1MDI7_1_157_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.4108 | 9 | 105 | 1.20.1080.10 |
| 5n9jV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.2915 | 8 | 104 | 1.10.287.3490 |
| 5n9jV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.2845 | 8 | 104 | 1.10.287.3490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5LIB8-F1-model_v4 | YeeE/YedE family protein | 0.842 | 11 | 145 |
GO:0005886
|
| AF-A0A4U9HU60-F1-model_v4 | Predicted transporter component | 0.8358 | 1 | 111 |
GO:0005886
|
| AF-A0A519GMT9-F1-model_v4 | YeeE/YedE family protein | 0.8348 | 1 | 133 |
GO:0005886
|
| AF-A0A2N7FPX7-F1-model_v4 | Sulphur transport domain-containing protein | 0.8327 | 9 | 149 |
GO:0005886
|
| AF-A0A2N1WY04-F1-model_v4 | deleted | 0.8292 | 1 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar