F464142

General Info

Members Datasets Scaffolds Average Seq Length
564 226 564 289

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100166818|Ga0070707_1001668182
Length 331
Sequence LNAEVYYARIVRTYDREKKRRLGPFMKNTLSRRNFVRSSALVATAFTASNDVFALGREQPLADEASPIRLGLASYTFRNFSRAQMIGFMKQLNVFALNLKDVKDHLPTDAQQETAALADYAAAGMKPHAAGTIYFEKNEDEDIRRKFEYCKHAGIAVIVAGDPALETLPRIEKFVREYDIRVAIHKHGPEDRLWPSPLDVLKAVKSMDPRIGCCIDVGHTVRAGTDVVQAIREAGPKLLNVHIKDLTNFQNKDSQVPVGDGLMPVPRIFEALTAMRYKGFVDLEYEIHPDDPMPGVISSFAYMRGILAGMGTPAGSEKSALSSNRSGANLG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
105 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.79
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001826 3300002459 Bacteria 4361
2 rootH2_10217894 3300003320 Bacteria 1044
3 rootH1_10303255 3300003323 Bacteria 1795
4 Ga0065712_10080247 3300005290 Bacteria 3112
5 Ga0065715_10100383 3300005293 Bacteria 3308
6 Ga0070658_10006014 3300005327 Bacteria 9845
7 Ga0070683_100000143 3300005329 Bacteria 45950
8 Ga0070683_100007018 3300005329 Bacteria 9481
9 Ga0070683_100039709 3300005329 Bacteria 4323
10 Ga0070683_100063329 3300005329 Bacteria 3440
11 Ga0070683_100498656 3300005329 Bacteria 1163
12 Ga0070670_100002512 3300005331 Bacteria 15130
13 Ga0070670_100011144 3300005331 Bacteria 7683
14 Ga0068869_100000399 3300005334 Bacteria 23637
15 Ga0068869_100002577 3300005334 Bacteria 10949
16 Ga0070666_10013998 3300005335 Bacteria 5100
17 Ga0070666_10091531 3300005335 Bacteria 2089
18 Ga0070666_10243698 3300005335 Unclassified 1271
19 Ga0070680_100114528 3300005336 Bacteria 2246
20 Ga0070680_100132376 3300005336 Bacteria 2087
21 Ga0070682_100184025 3300005337 Bacteria 1461
22 Ga0068868_100000759 3300005338 Bacteria 21905
23 Ga0068868_100020103 3300005338 Bacteria 5011
24 Ga0070660_100007635 3300005339 Bacteria 7537
25 Ga0070660_100065043 3300005339 Bacteria 2838
26 Ga0070660_100649784 3300005339 Unclassified 883
27 Ga0070689_100001021 3300005340 Bacteria 17575
28 Ga0070661_100000234 3300005344 Bacteria 45713
29 Ga0070661_100000289 3300005344 Bacteria 40642
30 Ga0070661_100040105 3300005344 Bacteria 3414
31 Ga0070661_100196946 3300005344 Bacteria 1538
32 Ga0070669_100052938 3300005353 Unclassified 2970
33 Ga0070675_100001507 3300005354 Bacteria 17200
34 Ga0070675_100665931 3300005354 Bacteria 947
35 Ga0070671_100001379 3300005355 Bacteria 18187
36 Ga0070671_100085575 3300005355 Unclassified 2638
37 Ga0070673_100002538 3300005364 Bacteria 11146
38 Ga0070688_100032547 3300005365 Unclassified 3145
39 Ga0070659_100024140 3300005366 Bacteria 4660
40 Ga0070659_100292205 3300005366 Bacteria 1357
41 Ga0070667_100000498 3300005367 Bacteria 39741
42 Ga0070667_100004280 3300005367 Bacteria 12053
43 Ga0070667_100060688 3300005367 Bacteria 3200
44 Ga0070709_10219991 3300005434 Bacteria 1354
45 Ga0070714_100001249 3300005435 Bacteria 18349
46 Ga0070714_100315507 3300005435 Bacteria 1461
47 Ga0070713_100004334 3300005436 Bacteria 9519
48 Ga0070713_100007481 3300005436 Bacteria 7671
49 Ga0070713_100007674 3300005436 Bacteria 7593
50 Ga0070713_100087871 3300005436 Unclassified 2667
51 Ga0070713_100096696 3300005436 Bacteria 2550
52 Ga0070713_100136436 3300005436 Bacteria 2169
53 Ga0070713_100230037 3300005436 Unclassified 1685
54 Ga0070713_100340067 3300005436 Unclassified 1390
55 Ga0070711_100001021 3300005439 Bacteria 14890
56 Ga0070700_100206582 3300005441 Bacteria 1383
57 Ga0070694_100110516 3300005444 Unclassified 1957
58 Ga0070708_100105020 3300005445 Bacteria 2591
59 Ga0070663_100000826 3300005455 Bacteria 16788
60 Ga0070663_100021544 3300005455 Bacteria 4290
61 Ga0070663_100022493 3300005455 Bacteria 4217
62 Ga0070663_100026739 3300005455 Bacteria 3911
63 Ga0070678_100060882 3300005456 Bacteria 2781
64 Ga0070662_100000987 3300005457 Bacteria 17397
65 Ga0070662_100037082 3300005457 Bacteria 3454
66 Ga0070681_10534466 3300005458 Unclassified 1086
67 Ga0070681_10562237 3300005458 Unclassified 1054
68 Ga0070685_10043495 3300005466 Bacteria 2568
69 Ga0070706_100007495 3300005467 Bacteria 10231
70 Ga0070706_100072915 3300005467 Bacteria 3177
71 Ga0070706_100088737 3300005467 Bacteria 2867
72 Ga0070706_100189913 3300005467 Bacteria 1919
73 Ga0070706_100425805 3300005467 Bacteria 1235
74 Ga0070706_100630179 3300005467 Unclassified 996
75 Ga0070707_100004041 3300005468 Bacteria 13796
76 Ga0070707_100063431 3300005468 Bacteria 3546
77 Ga0070707_100095646 3300005468 Bacteria 2877
78 Ga0070707_100133917 3300005468 Bacteria 2411
79 Ga0070707_100166818 3300005468 Bacteria 2146
80 Ga0070698_100023142 3300005471 Bacteria 6496
81 Ga0070698_100101807 3300005471 Unclassified 2844
82 Ga0070698_100249957 3300005471 Bacteria 1706
83 Ga0070699_100009359 3300005518 Bacteria 8486
84 Ga0070699_100016350 3300005518 Bacteria 6371
85 Ga0070679_100093476 3300005530 Bacteria 2995
86 Ga0070679_100135963 3300005530 Bacteria 2439
87 Ga0070679_100311967 3300005530 Bacteria 1522
88 Ga0070684_100000160 3300005535 Bacteria 45822
89 Ga0070684_100005623 3300005535 Bacteria 9635
90 Ga0070684_100010501 3300005535 Bacteria 7338
91 Ga0070684_100028564 3300005535 Bacteria 4719
92 Ga0070684_100035798 3300005535 Bacteria 4251
93 Ga0070684_100059081 3300005535 Bacteria 3352
94 Ga0070684_100249298 3300005535 Bacteria 1623
95 Ga0070684_100383939 3300005535 Unclassified 1294
96 Ga0070697_100004366 3300005536 Bacteria 10850
97 Ga0070697_100057166 3300005536 Bacteria 3174
98 Ga0068853_100000082 3300005539 Bacteria 65724
99 Ga0068853_100085909 3300005539 Bacteria 2759
100 Ga0070672_100002170 3300005543 Bacteria 12370
101 Ga0070686_100047661 3300005544 Unclassified 2710
102 Ga0070695_100004807 3300005545 Bacteria 7948
103 Ga0070695_100092172 3300005545 Bacteria 2025
104 Ga0070696_100001075 3300005546 Bacteria 17637
105 Ga0070696_100079649 3300005546 Bacteria 2318
106 Ga0070693_100001365 3300005547 Bacteria 10993
107 Ga0070693_100007964 3300005547 Bacteria 5201
108 Ga0070665_100072506 3300005548 Unclassified 3451
109 Ga0068855_100001936 3300005563 Bacteria 25711
110 Ga0068855_100002679 3300005563 Bacteria 21955
111 Ga0068855_100007521 3300005563 Bacteria 13186
112 Ga0068855_100010464 3300005563 Bacteria 11193
113 Ga0068855_100169118 3300005563 Bacteria 2476
114 Ga0068855_100176023 3300005563 Bacteria 2421
115 Ga0068855_100203487 3300005563 Bacteria 2228
116 Ga0068855_100345232 3300005563 Bacteria 1640
117 Ga0070664_100000167 3300005564 Bacteria 45686
118 Ga0070664_100073113 3300005564 Bacteria 2941
119 Ga0070664_100075978 3300005564 Bacteria 2886
120 Ga0070664_100110800 3300005564 Unclassified 2395
121 Ga0070664_100318700 3300005564 Bacteria 1408
122 Ga0070664_100340589 3300005564 Bacteria 1362
123 Ga0068857_100000125 3300005577 Bacteria 46141
124 Ga0068857_100001308 3300005577 Bacteria 19575
125 Ga0068857_100012787 3300005577 Bacteria 7317
126 Ga0068857_100030489 3300005577 Bacteria 4762
127 Ga0068857_100059032 3300005577 Bacteria 3407
128 Ga0068857_100442770 3300005577 Unclassified 1214
129 Ga0068854_100000694 3300005578 Bacteria 19974
130 Ga0068854_100022126 3300005578 Bacteria 4325
131 Ga0068856_100005754 3300005614 Bacteria 12215
132 Ga0068856_100046740 3300005614 Bacteria 4263
133 Ga0068856_100055547 3300005614 Bacteria 3908
134 Ga0068856_100073574 3300005614 Bacteria 3383
135 Ga0068856_100117922 3300005614 Bacteria 2655
136 Ga0068856_100174743 3300005614 Bacteria 2160
137 Ga0068852_100000168 3300005616 Bacteria 43887
138 Ga0068852_100003078 3300005616 Bacteria 11609
139 Ga0068852_100006214 3300005616 Bacteria 8611
140 Ga0068852_100094136 3300005616 Unclassified 2687
141 Ga0068852_100301704 3300005616 Unclassified 1550
142 Ga0068852_100347605 3300005616 Bacteria 1447
143 Ga0068859_100003279 3300005617 Bacteria 16463
144 Ga0068859_100027536 3300005617 Bacteria 5701
145 Ga0068859_100369691 3300005617 Unclassified 1529
146 Ga0068864_100000279 3300005618 Bacteria 45714
147 Ga0068864_100000856 3300005618 Bacteria 25645
148 Ga0068866_10063516 3300005718 Bacteria 1925
149 Ga0068851_10013691 3300005834 Bacteria 3840
150 Ga0068851_10036943 3300005834 Bacteria 2448
151 Ga0068851_10096214 3300005834 Unclassified 1565
152 Ga0068870_10078886 3300005840 Bacteria 1815
153 Ga0068863_100007477 3300005841 Bacteria 10693
154 Ga0068863_100009100 3300005841 Bacteria 9696
155 Ga0068863_100046400 3300005841 Bacteria 4123
156 Ga0068863_100545670 3300005841 Unclassified 1144
157 Ga0068858_100006367 3300005842 Bacteria 11495
158 Ga0068858_100037839 3300005842 Bacteria 4474
159 Ga0068860_100012293 3300005843 Bacteria 8434
160 Ga0068860_100018572 3300005843 Bacteria 6762
161 Ga0068862_100001789 3300005844 Bacteria 19444
162 Ga0068862_100257348 3300005844 Unclassified 1592
163 Ga0081455_10013562 3300005937 Bacteria 8034
164 Ga0070717_10025343 3300006028 Bacteria 4716
165 Ga0070717_10050493 3300006028 Bacteria 3419
166 Ga0070717_10080704 3300006028 Unclassified 2730
167 Ga0070716_100002615 3300006173 Bacteria 8318
168 Ga0070716_100018976 3300006173 Bacteria 3589
169 Ga0070716_100042307 3300006173 Bacteria 2543
170 Ga0070716_100073697 3300006173 Bacteria 2015
171 Ga0070712_100000627 3300006175 Bacteria 20778
172 Ga0070712_100020118 3300006175 Bacteria 4364
173 Ga0070712_100211241 3300006175 Unclassified 1530
174 Ga0070712_100281815 3300006175 Bacteria 1339
175 Ga0070712_100326095 3300006175 Bacteria 1250
176 Ga0097621_100000190 3300006237 Bacteria 39506
177 Ga0097621_100070896 3300006237 Bacteria 2878
178 Ga0097621_100284928 3300006237 Bacteria 1455
179 Ga0068871_100001341 3300006358 Bacteria 16482
180 Ga0068871_100021523 3300006358 Bacteria 4958
181 Ga0068871_100085204 3300006358 Bacteria 2623
182 Ga0068871_100104805 3300006358 Unclassified 2372
183 Ga0068871_100304676 3300006358 Bacteria 1399
184 Ga0068865_100101547 3300006881 Unclassified 2106
185 Ga0075436_100028478 3300006914 Bacteria 3843
186 Ga0097620_100003280 3300006931 Bacteria 16463
187 Ga0097620_100027534 3300006931 Bacteria 5701
188 Ga0097620_100369707 3300006931 Unclassified 1529
189 Ga0099794_10004885 3300007265 Bacteria 5328
190 Ga0099794_10029765 3300007265 Bacteria 2546
191 Ga0105240_10000213 3300009093 Bacteria 117084
192 Ga0105240_10000758 3300009093 Bacteria 58931
193 Ga0105240_10002338 3300009093 Bacteria 30652
194 Ga0105240_10009957 3300009093 Bacteria 13398
195 Ga0105240_10012555 3300009093 Bacteria 11685
196 Ga0105240_10017371 3300009093 Bacteria 9698
197 Ga0105240_10020863 3300009093 Bacteria 8727
198 Ga0105240_10081629 3300009093 Unclassified 3972
199 Ga0105240_10339208 3300009093 Bacteria 1708
200 Ga0105245_10000923 3300009098 Bacteria 26673
201 Ga0105245_10218915 3300009098 Bacteria 1836
202 Ga0105245_10579356 3300009098 Bacteria 1146
203 Ga0105247_10000671 3300009101 Bacteria 27001
204 Ga0105247_10007888 3300009101 Bacteria 6510
205 Ga0105247_10030250 3300009101 Bacteria 3282
206 Ga0114129_10297448 3300009147 Bacteria 2153
207 Ga0105243_10153650 3300009148 Bacteria 1977
208 Ga0105241_10000080 3300009174 Bacteria 71562
209 Ga0105241_10000200 3300009174 Bacteria 44853
210 Ga0105241_10011522 3300009174 Bacteria 6482
211 Ga0105241_10015287 3300009174 Bacteria 5620
212 Ga0105241_10065617 3300009174 Bacteria 2805
213 Ga0105241_10415935 3300009174 Bacteria 1182
214 Ga0105242_10090711 3300009176 Bacteria 2571
215 Ga0105242_10130628 3300009176 Unclassified 2168
216 Ga0105248_10002701 3300009177 Bacteria 19706
217 Ga0105248_10059278 3300009177 Bacteria 4299
218 Ga0105248_10278924 3300009177 Bacteria 1881
219 Ga0105248_10465754 3300009177 Bacteria 1425
220 Ga0105237_10000519 3300009545 Bacteria 54379
221 Ga0105237_10088112 3300009545 Bacteria 3093
222 Ga0105237_10179242 3300009545 Unclassified 2119
223 Ga0105237_10223899 3300009545 Unclassified 1881
224 Ga0105237_10509623 3300009545 Bacteria 1210
225 Ga0105238_10000158 3300009551 Bacteria 74148
226 Ga0105238_10000741 3300009551 Bacteria 34052
227 Ga0105238_10001488 3300009551 Bacteria 23513
228 Ga0105238_10015248 3300009551 Bacteria 7782
229 Ga0105238_10046012 3300009551 Bacteria 4407
230 Ga0105238_10061356 3300009551 Bacteria 3763
231 Ga0105238_10110867 3300009551 Bacteria 2724
232 Ga0105238_10140106 3300009551 Bacteria 2395
233 Ga0105249_10000639 3300009553 Bacteria 31964
234 Ga0105249_10034991 3300009553 Bacteria 4553
235 Ga0099796_10006780 3300010159 Unclassified 2954
236 Ga0105239_10001748 3300010375 Bacteria 28628
237 Ga0105239_10012138 3300010375 Bacteria 9606
238 Ga0105239_10114275 3300010375 Bacteria 2995
239 Ga0105239_10185332 3300010375 Bacteria 2329
240 Ga0105239_10311125 3300010375 Bacteria 1775
241 Ga0105239_10447939 3300010375 Bacteria 1464
242 Ga0105246_10000323 3300011119 Bacteria 25365
243 Ga0105246_10079245 3300011119 Unclassified 2335
244 Ga0157373_10109631 3300013100 Unclassified 1941
245 Ga0157373_10144742 3300013100 Bacteria 1671
246 Ga0157371_10041421 3300013102 Bacteria 3286
247 Ga0157371_10179359 3300013102 Bacteria 1515
248 Ga0157370_10000058 3300013104 Bacteria 117088
249 Ga0157370_10024335 3300013104 Bacteria 5996
250 Ga0157370_10032668 3300013104 Bacteria 5080
251 Ga0157369_10000340 3300013105 Bacteria 62012
252 Ga0157369_10000381 3300013105 Bacteria 58704
253 Ga0157369_10005533 3300013105 Bacteria 14667
254 Ga0157369_10032820 3300013105 Bacteria 5705
255 Ga0157369_10068554 3300013105 Bacteria 3811
256 Ga0157369_10129359 3300013105 Bacteria 2676
257 Ga0157369_10476541 3300013105 Bacteria 1292
258 Ga0157374_10002477 3300013296 Bacteria 15587
259 Ga0157374_10005802 3300013296 Bacteria 10429
260 Ga0157374_10022854 3300013296 Bacteria 5585
261 Ga0157374_10030359 3300013296 Unclassified 4906
262 Ga0157374_10053715 3300013296 Bacteria 3757
263 Ga0157374_10159588 3300013296 Bacteria 2196
264 Ga0157374_10273409 3300013296 Unclassified 1666
265 Ga0157378_10002210 3300013297 Bacteria 17263
266 Ga0157378_10029926 3300013297 Bacteria 4809
267 Ga0157378_10041531 3300013297 Bacteria 4080
268 Ga0157378_10183639 3300013297 Bacteria 1969
269 Ga0163162_10122145 3300013306 Bacteria 2709
270 Ga0163162_10465196 3300013306 Bacteria 1396
271 Ga0157372_10000622 3300013307 Bacteria 38721
272 Ga0157372_10004210 3300013307 Bacteria 15394
273 Ga0157372_10004941 3300013307 Bacteria 14158
274 Ga0157372_10007807 3300013307 Bacteria 11365
275 Ga0157372_10027544 3300013307 Bacteria 6192
276 Ga0157372_10040396 3300013307 Bacteria 5152
277 Ga0157372_10079861 3300013307 Bacteria 3701
278 Ga0157372_10088888 3300013307 Bacteria 3509
279 Ga0157372_10256763 3300013307 Bacteria 2029
280 Ga0157372_10366266 3300013307 Unclassified 1679
281 Ga0157375_10003606 3300013308 Bacteria 13436
282 Ga0157375_10459696 3300013308 Bacteria 1438
283 Ga0163163_10000331 3300014325 Bacteria 45717
284 Ga0163163_10000605 3300014325 Bacteria 31314
285 Ga0163163_10005099 3300014325 Bacteria 11323
286 Ga0157377_10005406 3300014745 Bacteria 6003
287 Ga0157379_10001665 3300014968 Bacteria 18361
288 Ga0157379_10006091 3300014968 Bacteria 10386
289 Ga0157379_10012207 3300014968 Bacteria 7504
290 Ga0157376_10012561 3300014969 Bacteria 6290
291 Ga0157376_10022920 3300014969 Bacteria 4876
292 Ga0157376_10050307 3300014969 Unclassified 3457
293 Ga0157376_10291575 3300014969 Unclassified 1541
294 Ga0213872_10035741 3300021361 Bacteria 2271
295 Ga0213872_10036944 3300021361 Bacteria 2231
296 Ga0213875_10052712 3300021388 Unclassified 1905
297 Ga0224571_100087 3300022734 Unclassified 3484
298 Ga0224572_1006491 3300024225 Bacteria 2117
299 Ga0224572_1008994 3300024225 Bacteria 1856
300 Ga0228598_1001780 3300024227 Bacteria 4704
301 Ga0228598_1009505 3300024227 Bacteria 1948
302 Ga0207656_10005765 3300025321 Bacteria 4406
303 Ga0207656_10025850 3300025321 Bacteria 2388
304 Ga0207653_10001248 3300025885 Bacteria 8307
305 Ga0207710_10069508 3300025900 Bacteria 1612
306 Ga0207710_10084927 3300025900 Unclassified 1474
307 Ga0207680_10052882 3300025903 Bacteria 2436
308 Ga0207680_10078805 3300025903 Unclassified 2064
309 Ga0207647_10069990 3300025904 Bacteria 2120
310 Ga0207699_10032702 3300025906 Bacteria 2932
311 Ga0207699_10059506 3300025906 Unclassified 2290
312 Ga0207699_10192043 3300025906 Bacteria 1379
313 Ga0207645_10005313 3300025907 Bacteria 9367
314 Ga0207705_10030953 3300025909 Bacteria 3818
315 Ga0207705_10043924 3300025909 Bacteria 3210
316 Ga0207684_10005691 3300025910 Bacteria 11450
317 Ga0207684_10013680 3300025910 Bacteria 7011
318 Ga0207684_10020177 3300025910 Bacteria 5692
319 Ga0207684_10062928 3300025910 Bacteria 3150
320 Ga0207684_10175868 3300025910 Bacteria 1846
321 Ga0207684_10340531 3300025910 Bacteria 1291
322 Ga0207654_10000151 3300025911 Bacteria 43832
323 Ga0207654_10000180 3300025911 Bacteria 39043
324 Ga0207654_10003201 3300025911 Bacteria 8278
325 Ga0207654_10009970 3300025911 Bacteria 4830
326 Ga0207654_10091826 3300025911 Unclassified 1853
327 Ga0207654_10129973 3300025911 Unclassified 1593
328 Ga0207654_10281503 3300025911 Bacteria 1125
329 Ga0207707_10066878 3300025912 Unclassified 3129
330 Ga0207695_10000108 3300025913 Bacteria 252306
331 Ga0207695_10000191 3300025913 Bacteria 174087
332 Ga0207695_10000345 3300025913 Bacteria 107062
333 Ga0207695_10001218 3300025913 Bacteria 44092
334 Ga0207695_10002413 3300025913 Bacteria 27673
335 Ga0207695_10007377 3300025913 Bacteria 14026
336 Ga0207695_10025822 3300025913 Bacteria 6567
337 Ga0207695_10054558 3300025913 Unclassified 4172
338 Ga0207695_10072504 3300025913 Bacteria 3513
339 Ga0207695_10201070 3300025913 Unclassified 1907
340 Ga0207671_10000737 3300025914 Bacteria 41536
341 Ga0207671_10000797 3300025914 Bacteria 39926
342 Ga0207671_10077680 3300025914 Bacteria 2485
343 Ga0207671_10207220 3300025914 Unclassified 1533
344 Ga0207693_10001711 3300025915 Bacteria 19305
345 Ga0207693_10039946 3300025915 Bacteria 3695
346 Ga0207693_10049726 3300025915 Bacteria 3292
347 Ga0207663_10005987 3300025916 Bacteria 6182
348 Ga0207663_10100032 3300025916 Bacteria 1945
349 Ga0207657_10002732 3300025919 Bacteria 18999
350 Ga0207657_10010358 3300025919 Bacteria 9305
351 Ga0207649_10000108 3300025920 Bacteria 69077
352 Ga0207649_10003708 3300025920 Bacteria 8335
353 Ga0207649_10008133 3300025920 Bacteria 5707
354 Ga0207646_10000443 3300025922 Bacteria 55435
355 Ga0207646_10051308 3300025922 Bacteria 3691
356 Ga0207646_10077919 3300025922 Bacteria 2962
357 Ga0207646_10406888 3300025922 Bacteria 1229
358 Ga0207694_10000083 3300025924 Bacteria 109611
359 Ga0207694_10000290 3300025924 Bacteria 47323
360 Ga0207694_10005067 3300025924 Bacteria 10188
361 Ga0207694_10005962 3300025924 Bacteria 9337
362 Ga0207694_10191562 3300025924 Bacteria 1661
363 Ga0207694_10470728 3300025924 Unclassified 1050
364 Ga0207650_10000333 3300025925 Bacteria 45762
365 Ga0207650_10019664 3300025925 Bacteria 4748
366 Ga0207659_10001592 3300025926 Bacteria 13466
367 Ga0207687_10009690 3300025927 Bacteria 6301
368 Ga0207700_10005852 3300025928 Bacteria 7388
369 Ga0207700_10006041 3300025928 Bacteria 7290
370 Ga0207700_10014397 3300025928 Bacteria 5182
371 Ga0207700_10031280 3300025928 Bacteria 3779
372 Ga0207664_10011786 3300025929 Bacteria 6232
373 Ga0207664_10060073 3300025929 Unclassified 3030
374 Ga0207644_10000483 3300025931 Bacteria 25651
375 Ga0207644_10008914 3300025931 Bacteria 6571
376 Ga0207690_10018864 3300025932 Bacteria 4236
377 Ga0207690_10041759 3300025932 Bacteria 3008
378 Ga0207706_10000242 3300025933 Bacteria 60281
379 Ga0207706_10032085 3300025933 Bacteria 4678
380 Ga0207686_10037964 3300025934 Bacteria 2910
381 Ga0207686_10160831 3300025934 Bacteria 1574
382 Ga0207709_10103601 3300025935 Bacteria 1886
383 Ga0207670_10013092 3300025936 Bacteria 4880
384 Ga0207670_10015929 3300025936 Bacteria 4504
385 Ga0207665_10000080 3300025939 Bacteria 62639
386 Ga0207665_10008703 3300025939 Bacteria 6677
387 Ga0207665_10047185 3300025939 Bacteria 2887
388 Ga0207665_10083478 3300025939 Bacteria 2203
389 Ga0207665_10094206 3300025939 Bacteria 2080
390 Ga0207665_10112751 3300025939 Bacteria 1912
391 Ga0207691_10003102 3300025940 Bacteria 16228
392 Ga0207711_10002013 3300025941 Bacteria 18383
393 Ga0207711_10023168 3300025941 Bacteria 5197
394 Ga0207711_10026985 3300025941 Bacteria 4821
395 Ga0207711_10235781 3300025941 Bacteria 1677
396 Ga0207689_10000826 3300025942 Bacteria 29881
397 Ga0207689_10002608 3300025942 Bacteria 16681
398 Ga0207689_10055362 3300025942 Bacteria 3265
399 Ga0207661_10001190 3300025944 Bacteria 17412
400 Ga0207661_10070084 3300025944 Bacteria 2861
401 Ga0207661_10073168 3300025944 Bacteria 2806
402 Ga0207661_10141489 3300025944 Bacteria 2071
403 Ga0207679_10000144 3300025945 Bacteria 58810
404 Ga0207679_10048220 3300025945 Bacteria 3099
405 Ga0207667_10003718 3300025949 Bacteria 18813
406 Ga0207667_10007178 3300025949 Bacteria 13440
407 Ga0207667_10009783 3300025949 Bacteria 11276
408 Ga0207667_10010625 3300025949 Bacteria 10747
409 Ga0207667_10025034 3300025949 Bacteria 6541
410 Ga0207667_10050784 3300025949 Bacteria 4374
411 Ga0207667_10064664 3300025949 Bacteria 3818
412 Ga0207667_10193675 3300025949 Bacteria 2086
413 Ga0207667_10309102 3300025949 Bacteria 1615
414 Ga0207667_10583250 3300025949 Bacteria 1128
415 Ga0207667_10799908 3300025949 Bacteria 940
416 Ga0207651_10003873 3300025960 Bacteria 7430
417 Ga0207712_10021496 3300025961 Bacteria 4236
418 Ga0207668_10097781 3300025972 Unclassified 2173
419 Ga0207640_10039093 3300025981 Bacteria 3000
420 Ga0207658_10000867 3300025986 Bacteria 25253
421 Ga0207677_10000295 3300026023 Bacteria 37343
422 Ga0207703_10002589 3300026035 Bacteria 15622
423 Ga0207703_10004325 3300026035 Bacteria 11679
424 Ga0207639_10000027 3300026041 Bacteria 197829
425 Ga0207639_10113417 3300026041 Bacteria 2214
426 Ga0207678_10000206 3300026067 Bacteria 52105
427 Ga0207678_10000287 3300026067 Bacteria 45710
428 Ga0207678_10044581 3300026067 Bacteria 3836
429 Ga0207678_10244794 3300026067 Unclassified 1536
430 Ga0207702_10040981 3300026078 Bacteria 3882
431 Ga0207702_10087424 3300026078 Bacteria 2721
432 Ga0207702_10112070 3300026078 Unclassified 2427
433 Ga0207702_10382288 3300026078 Bacteria 1354
434 Ga0207641_10000375 3300026088 Bacteria 53080
435 Ga0207641_10001550 3300026088 Bacteria 22510
436 Ga0207648_10007699 3300026089 Bacteria 10537
437 Ga0207676_10000177 3300026095 Bacteria 56007
438 Ga0207676_10000936 3300026095 Bacteria 22549
439 Ga0207674_10000340 3300026116 Bacteria 60032
440 Ga0207674_10001247 3300026116 Bacteria 33242
441 Ga0207674_10002139 3300026116 Bacteria 24965
442 Ga0207674_10016063 3300026116 Bacteria 8200
443 Ga0207674_10041095 3300026116 Bacteria 4784
444 Ga0207674_10247664 3300026116 Unclassified 1729
445 Ga0207675_100034569 3300026118 Bacteria 4713
446 Ga0207683_10429354 3300026121 Bacteria 1217
447 Ga0207698_10000065 3300026142 Bacteria 71171
448 Ga0207698_10000070 3300026142 Bacteria 68316
449 Ga0209179_1015541 3300027512 Unclassified 1415
450 Ga0209588_1016567 3300027671 Bacteria 2276
451 Ga0209588_1024163 3300027671 Bacteria 1918
452 Ga0268266_10011331 3300028379 Bacteria 7754
453 Ga0268266_10012364 3300028379 Bacteria 7381
454 Ga0268266_10055972 3300028379 Unclassified 3392
455 Ga0268265_10003361 3300028380 Bacteria 11543
456 Ga0268265_10240126 3300028380 Unclassified 1598
457 Ga0268264_10011039 3300028381 Bacteria 7458
458 Ga0265318_10014876 3300028577 Bacteria 3255
459 Ga0265336_10004323 3300028666 Bacteria 5388
460 Ga0265338_10002347 3300028800 Bacteria 28568
461 Ga0265338_10004307 3300028800 Bacteria 19310
462 Ga0265338_10054101 3300028800 Bacteria 3583
463 Ga0265338_10076789 3300028800 Unclassified 2827
464 Ga0265324_10056458 3300029957 Bacteria 1345
465 Ga0265762_1004098 3300030760 Bacteria 2610
466 Ga0265760_10003395 3300031090 Bacteria 4636
467 Ga0265760_10007580 3300031090 Unclassified 3101
468 Ga0265330_10000598 3300031235 Bacteria 23460
469 Ga0265330_10003451 3300031235 Bacteria 8255
470 Ga0265330_10009304 3300031235 Bacteria 4674
471 Ga0265330_10019039 3300031235 Bacteria 3150
472 Ga0265330_10033159 3300031235 Bacteria 2311
473 Ga0265328_10001766 3300031239 Bacteria 9883
474 Ga0265325_10000076 3300031241 Bacteria 69316
475 Ga0265325_10001417 3300031241 Bacteria 16888
476 Ga0265325_10118302 3300031241 Unclassified 1280
477 Ga0265329_10001731 3300031242 Bacteria 10435
478 Ga0265340_10029047 3300031247 Bacteria 2779
479 Ga0265340_10041923 3300031247 Unclassified 2248
480 Ga0265340_10068290 3300031247 Unclassified 1688
481 Ga0265339_10000834 3300031249 Bacteria 23772
482 Ga0265339_10011328 3300031249 Bacteria 5497
483 Ga0265339_10013534 3300031249 Bacteria 4941
484 Ga0265316_10000577 3300031344 Bacteria 40978
485 Ga0265316_10004000 3300031344 Bacteria 14759
486 Ga0265316_10025148 3300031344 Bacteria 4972
487 Ga0265316_10067607 3300031344 Unclassified 2763
488 Ga0265316_10182416 3300031344 Unclassified 1562
489 Ga0265316_10265771 3300031344 Bacteria 1257
490 Ga0265313_10000889 3300031595 Bacteria 30069
491 Ga0265313_10016547 3300031595 Bacteria 4235
492 Ga0265313_10035117 3300031595 Bacteria 2529
493 Ga0265313_10086950 3300031595 Bacteria 1410
494 Ga0265314_10000047 3300031711 Bacteria 194061
495 Ga0265314_10011471 3300031711 Bacteria 7312
496 Ga0265314_10123256 3300031711 Unclassified 1628
497 Ga0265342_10000574 3300031712 Bacteria 38843
498 Ga0265342_10001329 3300031712 Bacteria 23204
499 Ga0265342_10020702 3300031712 Bacteria 4212
500 Ga0265342_10034795 3300031712 Unclassified 3088
501 Ga0316214_1007884 3300033545 Unclassified 1428
502 Ga0373923_0068366 3300035111 Bacteria 1521
503 Ga0373939_0011132 3300035114 Bacteria 2263
504 Ga0373954_0090756 3300035118 Bacteria 1467
505 Ga0373942_0061861 3300035207 Unclassified 1075
506 Ga0373931_0042185 3300035691 Bacteria 2398
507 Ga0373931_0343775 3300035691 Unclassified 932
508 Ga0373935_0018637 3300035692 Bacteria 4226
509 Ga0373937_0020431 3300036401 Bacteria 5937
510 Ga0373937_0033744 3300036401 Bacteria 4651
511 Ga0436364_1173897 3300037853 Bacteria 1451
512 Ga0436360_0503569 3300039438 Bacteria 16244
513 Ga0436361_0280032 3300039447 Bacteria 1052
514 Ga0436361_0345110 3300039447 Bacteria 2746
515 Ga0436361_0586031 3300039447 Bacteria 14421
516 Ga0466966_0031583 3300044684 Bacteria 3434
517 Ga0466963_0021621 3300044694 Unclassified 4062
518 Ga0466963_0182989 3300044694 Unclassified 1463
519 Ga0466970_0200343 3300044765 Unclassified 1111
520 Ga0466967_0001974 3300045976 Bacteria 12439
521 Ga0495580_0011530 3300046472 Bacteria 6838
522 Ga0495587_0112144 3300046536 Bacteria 1566
523 Ga0495669_0004225 3300046684 Bacteria 5912
524 Ga0495669_0114190 3300046684 Unclassified 1263
525 Ga0495613_0414372 3300046689 Bacteria 917
526 Ga0495600_0035039 3300046809 Bacteria 3260
527 Ga0495581_0053365 3300047315 Bacteria 2335
528 Ga0495604_0312807 3300047317 Unclassified 1052
529 Ga0495602_0093714 3300048088 Bacteria 2484
530 Ga0496100_0153930 3300048903 Bacteria 1643
531 Ga0496101_0003812 3300048904 Bacteria 9420
532 Ga0496101_0024095 3300048904 Bacteria 4210
533 Ga0496102_0001820 3300048905 Bacteria 18412
534 Ga0496103_0004005 3300048906 Bacteria 8947
535 Ga0496104_0051430 3300048907 Bacteria 3889
536 Ga0496104_0323802 3300048907 Bacteria 1454
537 Ga0496104_0400945 3300048907 Bacteria 1284
538 Ga0496105_0009550 3300048908 Bacteria 7593
539 Ga0496105_0055697 3300048908 Bacteria 3265
540 Ga0496106_0016803 3300048909 Bacteria 5413
541 Ga0496106_0020945 3300048909 Bacteria 4852
542 Ga0496107_0017702 3300048910 Bacteria 5013
543 Ga0496107_0131910 3300048910 Unclassified 1845
544 Ga0496108_0000308 3300048911 Bacteria 42004
545 Ga0496109_0000311 3300048912 Bacteria 45781
546 Ga0496109_0011732 3300048912 Bacteria 7540
547 Ga0496109_0123530 3300048912 Unclassified 2413
548 Ga0496110_0003791 3300048913 Bacteria 11649
549 Ga0496110_0105930 3300048913 Bacteria 2523
550 Ga0496111_0022620 3300048914 Unclassified 4403
551 Ga0496112_0000135 3300048915 Bacteria 45822
552 Ga0496112_0322002 3300048915 Bacteria 1490
553 Ga0496113_0000131 3300048916 Bacteria 32371
554 Ga0496113_0053753 3300048916 Bacteria 3012
555 Ga0496114_0012316 3300048917 Bacteria 6842
556 Ga0496115_0035060 3300048918 Bacteria 3968
557 Ga0496126_0000093 3300048929 Bacteria 208741
558 Ga0496126_0049742 3300048929 Bacteria 3825
559 Ga0501070_0143290 3300049586 Bacteria 1973
560 nmdc:mga05p37_287466_c1 3300050507 Bacteria 1958
561 nmdc:mga0n895_130162_c1 3300050512 Bacteria 2541
562 nmdc:mga08x19_112784_c1 3300050514 Bacteria 1815
563 nmdc:mga08x19_21490_c1 3300050514 Bacteria 3985
564 Ga0495619_0202251 3300053085 Bacteria 1375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0312807 Ga0495604_0312807_332_1012 223
2 3300005327 Ga0070658_10006014 Ga0070658_100060147 254
3 3300005339 Ga0070660_100649784 Ga0070660_1006497841 254
4 3300005530 Ga0070679_100093476 Ga0070679_1000934762 254
5 3300005563 Ga0068855_100007521 Ga0068855_1000075216 254
6 3300025909 Ga0207705_10030953 Ga0207705_100309532 254
7 3300025913 Ga0207695_10025822 Ga0207695_100258223 254
8 3300025913 Ga0207695_10072504 Ga0207695_100725042 254
9 3300025949 Ga0207667_10010625 Ga0207667_100106254 254
10 3300005436 Ga0070713_100007674 Ga0070713_1000076744 257
11 3300046689 Ga0495613_0414372 Ga0495613_0414372_32_832 264
12 3300005841 Ga0068863_100046400 Ga0068863_1000464003 265
13 3300005329 Ga0070683_100063329 Ga0070683_1000633292 266
14 3300005535 Ga0070684_100028564 Ga0070684_1000285644 266
15 3300005563 Ga0068855_100345232 Ga0068855_1003452322 266
16 3300005616 Ga0068852_100006214 Ga0068852_1000062142 266
17 3300009174 Ga0105241_10065617 Ga0105241_100656172 266
18 3300009174 Ga0105241_10415935 Ga0105241_104159352 266
19 3300009551 Ga0105238_10001488 Ga0105238_1000148813 266
20 3300010375 Ga0105239_10114275 Ga0105239_101142752 266
21 3300013105 Ga0157369_10005533 Ga0157369_1000553312 266
22 3300013307 Ga0157372_10004210 Ga0157372_100042107 266
23 3300031247 Ga0265340_10068290 Ga0265340_100682902 266
24 3300046684 Ga0495669_0004225 Ga0495669_0004225_4358_5236 266
25 3300035111 Ga0373923_0068366 Ga0373923_0068366_283_1095 267
26 3300035118 Ga0373954_0090756 Ga0373954_0090756_560_1372 267
27 3300035692 Ga0373935_0018637 Ga0373935_0018637_2805_3617 267
28 3300036401 Ga0373937_0033744 Ga0373937_0033744_109_921 267
29 3300050514 nmdc:mga08x19_21490_c1 nmdc:mga08x19_21490_c1_1216_2076 267
30 3300024227 Ga0228598_1009505 Ga0228598_10095052 268
31 3300025928 Ga0207700_10031280 Ga0207700_100312802 270
32 3300025939 Ga0207665_10112751 Ga0207665_101127512 270
33 3300025939 Ga0207665_10008703 Ga0207665_100087033 271
34 3300028800 Ga0265338_10076789 Ga0265338_100767892 271
35 3300031711 Ga0265314_10123256 Ga0265314_101232561 271
36 3300009093 Ga0105240_10020863 Ga0105240_100208635 273
37 3300009093 Ga0105240_10081629 Ga0105240_100816293 273
38 3300009551 Ga0105238_10046012 Ga0105238_100460123 273
39 3300013104 Ga0157370_10024335 Ga0157370_100243352 273
40 3300013104 Ga0157370_10032668 Ga0157370_100326682 273
41 3300013105 Ga0157369_10476541 Ga0157369_104765411 273
42 3300013307 Ga0157372_10256763 Ga0157372_102567632 273
43 3300005467 Ga0070706_100425805 Ga0070706_1004258051 274
44 3300005434 Ga0070709_10219991 Ga0070709_102199912 275
45 3300005435 Ga0070714_100001249 Ga0070714_10000124917 275
46 3300005436 Ga0070713_100007481 Ga0070713_1000074814 275
47 3300005436 Ga0070713_100230037 Ga0070713_1002300371 275
48 3300006028 Ga0070717_10050493 Ga0070717_100504932 275
49 3300006028 Ga0070717_10080704 Ga0070717_100807043 275
50 3300006175 Ga0070712_100020118 Ga0070712_1000201186 275
51 3300025906 Ga0207699_10192043 Ga0207699_101920432 275
52 3300025916 Ga0207663_10100032 Ga0207663_101000322 275
53 3300025928 Ga0207700_10005852 Ga0207700_100058524 275
54 3300025929 Ga0207664_10060073 Ga0207664_100600732 275
55 3300031235 Ga0265330_10019039 Ga0265330_100190394 275
56 3300031249 Ga0265339_10013534 Ga0265339_100135343 275
57 3300031595 Ga0265313_10035117 Ga0265313_100351172 275
58 3300013105 Ga0157369_10129359 Ga0157369_101293593 276
59 3300025939 Ga0207665_10000080 Ga0207665_1000008039 276
60 3300025949 Ga0207667_10799908 Ga0207667_107999081 276
61 3300005336 Ga0070680_100114528 Ga0070680_1001145283 277
62 3300005458 Ga0070681_10534466 Ga0070681_105344661 277
63 3300005577 Ga0068857_100442770 Ga0068857_1004427701 277
64 3300005614 Ga0068856_100046740 Ga0068856_1000467405 277
65 3300005616 Ga0068852_100094136 Ga0068852_1000941362 277
66 3300005937 Ga0081455_10013562 Ga0081455_100135628 277
67 3300025919 Ga0207657_10010358 Ga0207657_100103582 277
68 3300025949 Ga0207667_10050784 Ga0207667_100507845 277
69 3300026078 Ga0207702_10112070 Ga0207702_101120702 277
70 3300031595 Ga0265313_10086950 Ga0265313_100869502 277
71 3300003320 rootH2_10217894 rootH2_102178941 279
72 3300009147 Ga0114129_10297448 Ga0114129_102974482 279
73 3300024225 Ga0224572_1008994 Ga0224572_10089942 279
74 3300030760 Ga0265762_1004098 Ga0265762_10040982 279
75 3300031090 Ga0265760_10007580 Ga0265760_100075804 279
76 3300037853 Ga0436364_1173897 Ga0436364_1173897_545_1405 279
77 3300050507 nmdc:mga05p37_287466_c1 nmdc:mga05p37_287466_c1_130_981 279
78 3300005535 Ga0070684_100383939 Ga0070684_1003839391 280
79 3300009551 Ga0105238_10061356 Ga0105238_100613563 280
80 3300013308 Ga0157375_10459696 Ga0157375_104596961 280
81 3300021388 Ga0213875_10052712 Ga0213875_100527122 280
82 3300031247 Ga0265340_10041923 Ga0265340_100419232 280
83 3300031344 Ga0265316_10067607 Ga0265316_100676073 280
84 3300031712 Ga0265342_10034795 Ga0265342_100347952 280
85 3300044684 Ga0466966_0031583 Ga0466966_0031583_2251_3114 280
86 3300044694 Ga0466963_0021621 Ga0466963_0021621_3005_3847 280
87 3300044765 Ga0466970_0200343 Ga0466970_0200343_149_1012 280
88 3300009545 Ga0105237_10223899 Ga0105237_102238992 281
89 3300025929 Ga0207664_10011786 Ga0207664_100117862 281
90 3300026078 Ga0207702_10382288 Ga0207702_103822882 281
91 3300039447 Ga0436361_0345110 Ga0436361_0345110_1022_1885 281
92 3300046684 Ga0495669_0114190 Ga0495669_0114190_172_1020 281
93 3300049586 Ga0501070_0143290 Ga0501070_0143290_709_1563 281
94 3300005329 Ga0070683_100498656 Ga0070683_1004986561 282
95 3300005435 Ga0070714_100315507 Ga0070714_1003155071 282
96 3300005535 Ga0070684_100035798 Ga0070684_1000357981 282
97 3300005563 Ga0068855_100002679 Ga0068855_1000026792 282
98 3300005616 Ga0068852_100003078 Ga0068852_1000030785 282
99 3300005718 Ga0068866_10063516 Ga0068866_100635162 282
100 3300013297 Ga0157378_10183639 Ga0157378_101836391 282
101 3300025913 Ga0207695_10000191 Ga0207695_10000191128 282
102 3300025914 Ga0207671_10077680 Ga0207671_100776803 282
103 3300025949 Ga0207667_10003718 Ga0207667_1000371815 282
104 3300026142 Ga0207698_10000070 Ga0207698_1000007040 282
105 3300005329 Ga0070683_100039709 Ga0070683_1000397094 283
106 3300005339 Ga0070660_100065043 Ga0070660_1000650432 283
107 3300005535 Ga0070684_100005623 Ga0070684_1000056232 283
108 3300006175 Ga0070712_100281815 Ga0070712_1002818152 283
109 3300009148 Ga0105243_10153650 Ga0105243_101536502 283
110 3300013100 Ga0157373_10144742 Ga0157373_101447422 283
111 3300013105 Ga0157369_10032820 Ga0157369_100328207 283
112 3300013307 Ga0157372_10040396 Ga0157372_100403965 283
113 3300014969 Ga0157376_10022920 Ga0157376_100229205 283
114 3300021361 Ga0213872_10035741 Ga0213872_100357412 283
115 3300025935 Ga0207709_10103601 Ga0207709_101036013 283
116 3300033545 Ga0316214_1007884 Ga0316214_10078842 283
117 3300039438 Ga0436360_0503569 Ga0436360_0503569_11957_12826 283
118 3300039447 Ga0436361_0280032 Ga0436361_0280032_161_1030 283
119 3300039447 Ga0436361_0586031 Ga0436361_0586031_1857_2726 283
120 3300048929 Ga0496126_0049742 Ga0496126_0049742_2185_3063 283
121 3300005436 Ga0070713_100096696 Ga0070713_1000966962 284
122 3300044694 Ga0466963_0182989 Ga0466963_0182989_151_1011 284
123 3300005471 Ga0070698_100249957 Ga0070698_1002499572 285
124 3300005545 Ga0070695_100092172 Ga0070695_1000921721 285
125 3300005546 Ga0070696_100079649 Ga0070696_1000796492 285
126 3300006173 Ga0070716_100018976 Ga0070716_1000189762 285
127 3300009101 Ga0105247_10007888 Ga0105247_100078883 285
128 3300009174 Ga0105241_10015287 Ga0105241_100152879 285
129 3300009177 Ga0105248_10278924 Ga0105248_102789242 285
130 3300014968 Ga0157379_10012207 Ga0157379_100122075 285
131 3300025911 Ga0207654_10129973 Ga0207654_101299732 285
132 3300025939 Ga0207665_10083478 Ga0207665_100834782 285
133 3300025949 Ga0207667_10583250 Ga0207667_105832502 285
134 3300035691 Ga0373931_0343775 Ga0373931_0343775_16_873 285
135 3300048903 Ga0496100_0153930 Ga0496100_0153930_585_1442 285
136 3300048904 Ga0496101_0024095 Ga0496101_0024095_2979_3836 285
137 3300048905 Ga0496102_0001820 Ga0496102_0001820_3622_4479 285
138 3300048906 Ga0496103_0004005 Ga0496103_0004005_7273_8130 285
139 3300048907 Ga0496104_0323802 Ga0496104_0323802_282_1139 285
140 3300048909 Ga0496106_0016803 Ga0496106_0016803_3642_4499 285
141 3300005467 Ga0070706_100007495 Ga0070706_1000074954 286
142 3300005518 Ga0070699_100016350 Ga0070699_1000163503 286
143 3300005530 Ga0070679_100135963 Ga0070679_1001359633 286
144 3300005545 Ga0070695_100004807 Ga0070695_1000048073 286
145 3300009093 Ga0105240_10000213 Ga0105240_1000021380 286
146 3300009545 Ga0105237_10509623 Ga0105237_105096231 286
147 3300009551 Ga0105238_10140106 Ga0105238_101401062 286
148 3300010375 Ga0105239_10311125 Ga0105239_103111251 286
149 3300013104 Ga0157370_10000058 Ga0157370_1000005879 286
150 3300013105 Ga0157369_10000381 Ga0157369_1000038130 286
151 3300013296 Ga0157374_10273409 Ga0157374_102734092 286
152 3300013307 Ga0157372_10000622 Ga0157372_1000062213 286
153 3300013307 Ga0157372_10088888 Ga0157372_100888884 286
154 3300024227 Ga0228598_1001780 Ga0228598_10017803 286
155 3300050514 nmdc:mga08x19_112784_c1 nmdc:mga08x19_112784_c1_135_995 286
156 3300005436 Ga0070713_100004334 Ga0070713_1000043344 287
157 3300005436 Ga0070713_100087871 Ga0070713_1000878712 287
158 3300005614 Ga0068856_100055547 Ga0068856_1000555474 287
159 3300009093 Ga0105240_10012555 Ga0105240_100125552 287
160 3300013307 Ga0157372_10007807 Ga0157372_1000780711 287
161 3300013307 Ga0157372_10079861 Ga0157372_100798612 287
162 3300021361 Ga0213872_10036944 Ga0213872_100369442 287
163 3300025924 Ga0207694_10005962 Ga0207694_100059627 287
164 3300025949 Ga0207667_10007178 Ga0207667_100071789 287
165 3300026078 Ga0207702_10040981 Ga0207702_100409813 287
166 3300028800 Ga0265338_10002347 Ga0265338_1000234711 287
167 3300031249 Ga0265339_10011328 Ga0265339_100113284 287
168 3300031711 Ga0265314_10011471 Ga0265314_100114714 287
169 3300046472 Ga0495580_0011530 Ga0495580_0011530_4732_5604 287
170 3300046536 Ga0495587_0112144 Ga0495587_0112144_166_1038 287
171 3300048088 Ga0495602_0093714 Ga0495602_0093714_695_1567 287
172 3300048908 Ga0496105_0055697 Ga0496105_0055697_2178_3050 287
173 3300048913 Ga0496110_0105930 Ga0496110_0105930_1625_2497 287
174 3300003323 rootH1_10303255 rootH1_103032551 288
175 3300005329 Ga0070683_100007018 Ga0070683_1000070184 288
176 3300005331 Ga0070670_100011144 Ga0070670_1000111441 288
177 3300005334 Ga0068869_100000399 Ga0068869_1000003999 288
178 3300005335 Ga0070666_10013998 Ga0070666_100139984 288
179 3300005338 Ga0068868_100000759 Ga0068868_1000007592 288
180 3300005344 Ga0070661_100000289 Ga0070661_10000028927 288
181 3300005344 Ga0070661_100040105 Ga0070661_1000401052 288
182 3300005344 Ga0070661_100196946 Ga0070661_1001969462 288
183 3300005354 Ga0070675_100665931 Ga0070675_1006659311 288
184 3300005355 Ga0070671_100001379 Ga0070671_1000013796 288
185 3300005367 Ga0070667_100000498 Ga0070667_1000004989 288
186 3300005455 Ga0070663_100021544 Ga0070663_1000215442 288
187 3300005455 Ga0070663_100022493 Ga0070663_1000224935 288
188 3300005455 Ga0070663_100026739 Ga0070663_1000267392 288
189 3300005535 Ga0070684_100059081 Ga0070684_1000590812 288
190 3300005535 Ga0070684_100249298 Ga0070684_1002492982 288
191 3300005539 Ga0068853_100000082 Ga0068853_10000008228 288
192 3300005539 Ga0068853_100085909 Ga0068853_1000859091 288
193 3300005563 Ga0068855_100001936 Ga0068855_10000193612 288
194 3300005563 Ga0068855_100010464 Ga0068855_1000104644 288
195 3300005563 Ga0068855_100176023 Ga0068855_1001760231 288
196 3300005564 Ga0070664_100073113 Ga0070664_1000731133 288
197 3300005564 Ga0070664_100075978 Ga0070664_1000759782 288
198 3300005564 Ga0070664_100318700 Ga0070664_1003187002 288
199 3300005564 Ga0070664_100340589 Ga0070664_1003405891 288
200 3300005577 Ga0068857_100001308 Ga0068857_1000013087 288
201 3300005577 Ga0068857_100012787 Ga0068857_1000127875 288
202 3300005577 Ga0068857_100030489 Ga0068857_1000304892 288
203 3300005577 Ga0068857_100059032 Ga0068857_1000590322 288
204 3300005578 Ga0068854_100000694 Ga0068854_1000006944 288
205 3300005614 Ga0068856_100005754 Ga0068856_1000057545 288
206 3300005614 Ga0068856_100117922 Ga0068856_1001179222 288
207 3300005614 Ga0068856_100174743 Ga0068856_1001747432 288
208 3300005616 Ga0068852_100000168 Ga0068852_10000016829 288
209 3300005616 Ga0068852_100301704 Ga0068852_1003017042 288
210 3300005617 Ga0068859_100003279 Ga0068859_1000032799 288
211 3300005617 Ga0068859_100369691 Ga0068859_1003696911 288
212 3300005618 Ga0068864_100000856 Ga0068864_10000085612 288
213 3300005834 Ga0068851_10013691 Ga0068851_100136912 288
214 3300005834 Ga0068851_10096214 Ga0068851_100962141 288
215 3300005841 Ga0068863_100009100 Ga0068863_1000091006 288
216 3300005843 Ga0068860_100012293 Ga0068860_1000122935 288
217 3300005844 Ga0068862_100257348 Ga0068862_1002573482 288
218 3300006237 Ga0097621_100000190 Ga0097621_10000019020 288
219 3300006237 Ga0097621_100070896 Ga0097621_1000708962 288
220 3300006358 Ga0068871_100001341 Ga0068871_1000013411 288
221 3300006358 Ga0068871_100021523 Ga0068871_1000215234 288
222 3300006358 Ga0068871_100304676 Ga0068871_1003046762 288
223 3300006931 Ga0097620_100003280 Ga0097620_1000032809 288
224 3300006931 Ga0097620_100369707 Ga0097620_1003697071 288
225 3300009093 Ga0105240_10000758 Ga0105240_1000075824 288
226 3300009093 Ga0105240_10002338 Ga0105240_100023384 288
227 3300009093 Ga0105240_10009957 Ga0105240_100099577 288
228 3300009093 Ga0105240_10017371 Ga0105240_100173716 288
229 3300009098 Ga0105245_10000923 Ga0105245_100009236 288
230 3300009098 Ga0105245_10218915 Ga0105245_102189152 288
231 3300009101 Ga0105247_10000671 Ga0105247_100006717 288
232 3300009101 Ga0105247_10030250 Ga0105247_100302503 288
233 3300009174 Ga0105241_10000080 Ga0105241_1000008021 288
234 3300009174 Ga0105241_10000200 Ga0105241_1000020025 288
235 3300009174 Ga0105241_10011522 Ga0105241_100115224 288
236 3300009176 Ga0105242_10090711 Ga0105242_100907112 288
237 3300009177 Ga0105248_10002701 Ga0105248_100027012 288
238 3300009545 Ga0105237_10000519 Ga0105237_1000051919 288
239 3300009545 Ga0105237_10088112 Ga0105237_100881123 288
240 3300009551 Ga0105238_10000158 Ga0105238_1000015830 288
241 3300009551 Ga0105238_10000741 Ga0105238_1000074114 288
242 3300009551 Ga0105238_10015248 Ga0105238_100152485 288
243 3300009553 Ga0105249_10034991 Ga0105249_100349913 288
244 3300010375 Ga0105239_10001748 Ga0105239_100017483 288
245 3300010375 Ga0105239_10012138 Ga0105239_100121387 288
246 3300010375 Ga0105239_10185332 Ga0105239_101853322 288
247 3300011119 Ga0105246_10000323 Ga0105246_100003238 288
248 3300011119 Ga0105246_10079245 Ga0105246_100792453 288
249 3300013100 Ga0157373_10109631 Ga0157373_101096312 288
250 3300013105 Ga0157369_10000340 Ga0157369_1000034021 288
251 3300013105 Ga0157369_10068554 Ga0157369_100685543 288
252 3300013296 Ga0157374_10002477 Ga0157374_100024774 288
253 3300013296 Ga0157374_10005802 Ga0157374_100058023 288
254 3300013296 Ga0157374_10053715 Ga0157374_100537152 288
255 3300013296 Ga0157374_10159588 Ga0157374_101595882 288
256 3300013297 Ga0157378_10002210 Ga0157378_100022107 288
257 3300013297 Ga0157378_10029926 Ga0157378_100299262 288
258 3300013297 Ga0157378_10041531 Ga0157378_100415312 288
259 3300013307 Ga0157372_10004941 Ga0157372_100049412 288
260 3300013307 Ga0157372_10027544 Ga0157372_100275443 288
261 3300014325 Ga0163163_10000605 Ga0163163_100006056 288
262 3300014968 Ga0157379_10006091 Ga0157379_100060914 288
263 3300014969 Ga0157376_10291575 Ga0157376_102915751 288
264 3300025321 Ga0207656_10005765 Ga0207656_100057651 288
265 3300025900 Ga0207710_10084927 Ga0207710_100849272 288
266 3300025903 Ga0207680_10052882 Ga0207680_100528822 288
267 3300025909 Ga0207705_10043924 Ga0207705_100439242 288
268 3300025911 Ga0207654_10000151 Ga0207654_1000015129 288
269 3300025911 Ga0207654_10000180 Ga0207654_1000018036 288
270 3300025911 Ga0207654_10003201 Ga0207654_100032015 288
271 3300025911 Ga0207654_10009970 Ga0207654_100099702 288
272 3300025913 Ga0207695_10000108 Ga0207695_1000010844 288
273 3300025913 Ga0207695_10000345 Ga0207695_1000034544 288
274 3300025913 Ga0207695_10001218 Ga0207695_100012186 288
275 3300025913 Ga0207695_10002413 Ga0207695_1000241313 288
276 3300025913 Ga0207695_10007377 Ga0207695_100073775 288
277 3300025913 Ga0207695_10054558 Ga0207695_100545582 288
278 3300025914 Ga0207671_10000737 Ga0207671_1000073713 288
279 3300025914 Ga0207671_10000797 Ga0207671_1000079726 288
280 3300025920 Ga0207649_10003708 Ga0207649_100037082 288
281 3300025920 Ga0207649_10008133 Ga0207649_100081331 288
282 3300025924 Ga0207694_10000083 Ga0207694_1000008353 288
283 3300025924 Ga0207694_10000290 Ga0207694_1000029028 288
284 3300025924 Ga0207694_10005067 Ga0207694_100050676 288
285 3300025924 Ga0207694_10191562 Ga0207694_101915621 288
286 3300025925 Ga0207650_10019664 Ga0207650_100196641 288
287 3300025931 Ga0207644_10000483 Ga0207644_100004836 288
288 3300025934 Ga0207686_10160831 Ga0207686_101608312 288
289 3300025941 Ga0207711_10023168 Ga0207711_100231682 288
290 3300025941 Ga0207711_10235781 Ga0207711_102357811 288
291 3300025942 Ga0207689_10000826 Ga0207689_1000082613 288
292 3300025944 Ga0207661_10070084 Ga0207661_100700843 288
293 3300025944 Ga0207661_10073168 Ga0207661_100731682 288
294 3300025949 Ga0207667_10009783 Ga0207667_100097837 288
295 3300025949 Ga0207667_10064664 Ga0207667_100646641 288
296 3300025949 Ga0207667_10309102 Ga0207667_103091021 288
297 3300025981 Ga0207640_10039093 Ga0207640_100390933 288
298 3300025986 Ga0207658_10000867 Ga0207658_100008678 288
299 3300026023 Ga0207677_10000295 Ga0207677_1000029517 288
300 3300026035 Ga0207703_10004325 Ga0207703_100043256 288
301 3300026041 Ga0207639_10000027 Ga0207639_1000002759 288
302 3300026041 Ga0207639_10113417 Ga0207639_101134172 288
303 3300026067 Ga0207678_10044581 Ga0207678_100445812 288
304 3300026067 Ga0207678_10244794 Ga0207678_102447942 288
305 3300026088 Ga0207641_10001550 Ga0207641_100015504 288
306 3300026095 Ga0207676_10000936 Ga0207676_100009368 288
307 3300026116 Ga0207674_10000340 Ga0207674_1000034033 288
308 3300026116 Ga0207674_10001247 Ga0207674_1000124716 288
309 3300026116 Ga0207674_10041095 Ga0207674_100410953 288
310 3300026142 Ga0207698_10000065 Ga0207698_1000006523 288
311 3300028379 Ga0268266_10055972 Ga0268266_100559723 288
312 3300028380 Ga0268265_10240126 Ga0268265_102401262 288
313 3300035207 Ga0373942_0061861 Ga0373942_0061861_74_940 288
314 3300035691 Ga0373931_0042185 Ga0373931_0042185_1459_2325 288
315 3300045976 Ga0466967_0001974 Ga0466967_0001974_4121_4993 288
316 3300005290 Ga0065712_10080247 Ga0065712_100802475 289
317 3300005293 Ga0065715_10100383 Ga0065715_101003834 289
318 3300005335 Ga0070666_10243698 Ga0070666_102436981 289
319 3300005336 Ga0070680_100132376 Ga0070680_1001323761 289
320 3300005337 Ga0070682_100184025 Ga0070682_1001840252 289
321 3300005338 Ga0068868_100020103 Ga0068868_1000201032 289
322 3300005339 Ga0070660_100007635 Ga0070660_1000076353 289
323 3300005353 Ga0070669_100052938 Ga0070669_1000529385 289
324 3300005367 Ga0070667_100004280 Ga0070667_1000042803 289
325 3300005441 Ga0070700_100206582 Ga0070700_1002065822 289
326 3300005444 Ga0070694_100110516 Ga0070694_1001105162 289
327 3300005456 Ga0070678_100060882 Ga0070678_1000608821 289
328 3300005457 Ga0070662_100000987 Ga0070662_1000009873 289
329 3300005458 Ga0070681_10562237 Ga0070681_105622371 289
330 3300005467 Ga0070706_100072915 Ga0070706_1000729152 289
331 3300005467 Ga0070706_100088737 Ga0070706_1000887374 289
332 3300005467 Ga0070706_100630179 Ga0070706_1006301791 289
333 3300005468 Ga0070707_100004041 Ga0070707_1000040419 289
334 3300005530 Ga0070679_100311967 Ga0070679_1003119672 289
335 3300005535 Ga0070684_100010501 Ga0070684_1000105012 289
336 3300005536 Ga0070697_100004366 Ga0070697_1000043663 289
337 3300005536 Ga0070697_100057166 Ga0070697_1000571662 289
338 3300005544 Ga0070686_100047661 Ga0070686_1000476612 289
339 3300005546 Ga0070696_100001075 Ga0070696_1000010753 289
340 3300005547 Ga0070693_100001365 Ga0070693_1000013653 289
341 3300005563 Ga0068855_100169118 Ga0068855_1001691181 289
342 3300005564 Ga0070664_100110800 Ga0070664_1001108003 289
343 3300005578 Ga0068854_100022126 Ga0068854_1000221262 289
344 3300005614 Ga0068856_100073574 Ga0068856_1000735742 289
345 3300005617 Ga0068859_100027536 Ga0068859_1000275366 289
346 3300005841 Ga0068863_100545670 Ga0068863_1005456702 289
347 3300005842 Ga0068858_100037839 Ga0068858_1000378392 289
348 3300006175 Ga0070712_100326095 Ga0070712_1003260951 289
349 3300006237 Ga0097621_100284928 Ga0097621_1002849283 289
350 3300006358 Ga0068871_100104805 Ga0068871_1001048053 289
351 3300006881 Ga0068865_100101547 Ga0068865_1001015472 289
352 3300006931 Ga0097620_100027534 Ga0097620_1000275344 289
353 3300007265 Ga0099794_10004885 Ga0099794_100048852 289
354 3300009093 Ga0105240_10339208 Ga0105240_103392082 289
355 3300009098 Ga0105245_10579356 Ga0105245_105793562 289
356 3300009176 Ga0105242_10130628 Ga0105242_101306282 289
357 3300009177 Ga0105248_10059278 Ga0105248_100592785 289
358 3300009545 Ga0105237_10179242 Ga0105237_101792424 289
359 3300009551 Ga0105238_10110867 Ga0105238_101108675 289
360 3300009553 Ga0105249_10000639 Ga0105249_1000063917 289
361 3300013102 Ga0157371_10041421 Ga0157371_100414212 289
362 3300013296 Ga0157374_10022854 Ga0157374_100228543 289
363 3300013306 Ga0163162_10122145 Ga0163162_101221451 289
364 3300013307 Ga0157372_10366266 Ga0157372_103662662 289
365 3300025885 Ga0207653_10001248 Ga0207653_100012484 289
366 3300025903 Ga0207680_10078805 Ga0207680_100788052 289
367 3300025906 Ga0207699_10032702 Ga0207699_100327022 289
368 3300025906 Ga0207699_10059506 Ga0207699_100595062 289
369 3300025907 Ga0207645_10005313 Ga0207645_100053136 289
370 3300025910 Ga0207684_10005691 Ga0207684_100056913 289
371 3300025910 Ga0207684_10013680 Ga0207684_100136801 289
372 3300025910 Ga0207684_10062928 Ga0207684_100629282 289
373 3300025911 Ga0207654_10091826 Ga0207654_100918261 289
374 3300025911 Ga0207654_10281503 Ga0207654_102815032 289
375 3300025912 Ga0207707_10066878 Ga0207707_100668783 289
376 3300025913 Ga0207695_10201070 Ga0207695_102010702 289
377 3300025914 Ga0207671_10207220 Ga0207671_102072202 289
378 3300025915 Ga0207693_10039946 Ga0207693_100399464 289
379 3300025919 Ga0207657_10002732 Ga0207657_100027325 289
380 3300025922 Ga0207646_10000443 Ga0207646_1000044314 289
381 3300025924 Ga0207694_10470728 Ga0207694_104707281 289
382 3300025927 Ga0207687_10009690 Ga0207687_100096902 289
383 3300025933 Ga0207706_10000242 Ga0207706_1000024232 289
384 3300025934 Ga0207686_10037964 Ga0207686_100379642 289
385 3300025936 Ga0207670_10015929 Ga0207670_100159292 289
386 3300025941 Ga0207711_10026985 Ga0207711_100269851 289
387 3300025942 Ga0207689_10055362 Ga0207689_100553622 289
388 3300025944 Ga0207661_10141489 Ga0207661_101414892 289
389 3300025945 Ga0207679_10048220 Ga0207679_100482202 289
390 3300025949 Ga0207667_10025034 Ga0207667_100250348 289
391 3300025961 Ga0207712_10021496 Ga0207712_100214966 289
392 3300025972 Ga0207668_10097781 Ga0207668_100977811 289
393 3300026067 Ga0207678_10000206 Ga0207678_1000020611 289
394 3300026078 Ga0207702_10087424 Ga0207702_100874242 289
395 3300026089 Ga0207648_10007699 Ga0207648_100076995 289
396 3300026116 Ga0207674_10247664 Ga0207674_102476642 289
397 3300026118 Ga0207675_100034569 Ga0207675_1000345691 289
398 3300026121 Ga0207683_10429354 Ga0207683_104293542 289
399 3300027671 Ga0209588_1016567 Ga0209588_10165672 289
400 3300031235 Ga0265330_10003451 Ga0265330_100034518 289
401 3300031241 Ga0265325_10001417 Ga0265325_1000141712 289
402 3300031344 Ga0265316_10000577 Ga0265316_100005773 289
403 3300031595 Ga0265313_10016547 Ga0265313_100165475 289
404 3300031712 Ga0265342_10001329 Ga0265342_1000132911 289
405 3300035114 Ga0373939_0011132 Ga0373939_0011132_964_1833 289
406 3300036401 Ga0373937_0020431 Ga0373937_0020431_2639_3514 289
407 3300048907 Ga0496104_0051430 Ga0496104_0051430_1157_2035 289
408 3300048910 Ga0496107_0131910 Ga0496107_0131910_784_1653 289
409 3300048912 Ga0496109_0123530 Ga0496109_0123530_155_1024 289
410 3300050512 nmdc:mga0n895_130162_c1 nmdc:mga0n895_130162_c1_241_1110 289
411 3300005366 Ga0070659_100292205 Ga0070659_1002922051 290
412 3300005436 Ga0070713_100136436 Ga0070713_1001364363 290
413 3300005467 Ga0070706_100189913 Ga0070706_1001899132 290
414 3300005468 Ga0070707_100063431 Ga0070707_1000634312 290
415 3300006173 Ga0070716_100073697 Ga0070716_1000736974 290
416 3300006914 Ga0075436_100028478 Ga0075436_1000284782 290
417 3300014325 Ga0163163_10005099 Ga0163163_100050996 290
418 3300025910 Ga0207684_10175868 Ga0207684_101758682 290
419 3300025910 Ga0207684_10340531 Ga0207684_103405311 290
420 3300025922 Ga0207646_10051308 Ga0207646_100513082 290
421 3300025939 Ga0207665_10047185 Ga0207665_100471851 290
422 3300025939 Ga0207665_10094206 Ga0207665_100942062 290
423 3300026116 Ga0207674_10016063 Ga0207674_100160636 290
424 3300031344 Ga0265316_10182416 Ga0265316_101824162 290
425 3300048912 Ga0496109_0011732 Ga0496109_0011732_2436_3314 290
426 3300048915 Ga0496112_0322002 Ga0496112_0322002_213_1091 290
427 3300048916 Ga0496113_0053753 Ga0496113_0053753_385_1263 290
428 3300005355 Ga0070671_100085575 Ga0070671_1000855752 291
429 3300006173 Ga0070716_100042307 Ga0070716_1000423073 291
430 3300025932 Ga0207690_10041759 Ga0207690_100417591 291
431 3300027671 Ga0209588_1024163 Ga0209588_10241632 291
432 3300028577 Ga0265318_10014876 Ga0265318_100148761 291
433 3300028666 Ga0265336_10004323 Ga0265336_100043235 291
434 3300028800 Ga0265338_10004307 Ga0265338_1000430710 291
435 3300028800 Ga0265338_10054101 Ga0265338_100541012 291
436 3300029957 Ga0265324_10056458 Ga0265324_100564581 291
437 3300031235 Ga0265330_10000598 Ga0265330_1000059815 291
438 3300031235 Ga0265330_10009304 Ga0265330_100093045 291
439 3300031235 Ga0265330_10033159 Ga0265330_100331592 291
440 3300031239 Ga0265328_10001766 Ga0265328_100017666 291
441 3300031241 Ga0265325_10000076 Ga0265325_1000007642 291
442 3300031241 Ga0265325_10118302 Ga0265325_101183021 291
443 3300031242 Ga0265329_10001731 Ga0265329_100017314 291
444 3300031247 Ga0265340_10029047 Ga0265340_100290472 291
445 3300031249 Ga0265339_10000834 Ga0265339_1000083415 291
446 3300031344 Ga0265316_10004000 Ga0265316_100040009 291
447 3300031344 Ga0265316_10025148 Ga0265316_100251484 291
448 3300031344 Ga0265316_10265771 Ga0265316_102657711 291
449 3300031595 Ga0265313_10000889 Ga0265313_100008897 291
450 3300031711 Ga0265314_10000047 Ga0265314_1000004717 291
451 3300031712 Ga0265342_10000574 Ga0265342_1000057417 291
452 3300031712 Ga0265342_10020702 Ga0265342_100207023 291
453 3300006175 Ga0070712_100211241 Ga0070712_1002112411 292
454 3300014969 Ga0157376_10012561 Ga0157376_100125612 292
455 3300024225 Ga0224572_1006491 Ga0224572_10064912 292
456 3300025915 Ga0207693_10049726 Ga0207693_100497262 292
457 3300025928 Ga0207700_10006041 Ga0207700_100060413 292
458 3300046809 Ga0495600_0035039 Ga0495600_0035039_1331_2293 292
459 3300048904 Ga0496101_0003812 Ga0496101_0003812_5219_6166 292
460 3300048908 Ga0496105_0009550 Ga0496105_0009550_5160_6122 292
461 3300048909 Ga0496106_0020945 Ga0496106_0020945_1366_2313 292
462 3300048910 Ga0496107_0017702 Ga0496107_0017702_523_1485 292
463 3300048917 Ga0496114_0012316 Ga0496114_0012316_2292_3239 292
464 3300048918 Ga0496115_0035060 Ga0496115_0035060_2486_3433 292
465 3300005436 Ga0070713_100340067 Ga0070713_1003400672 293
466 3300005439 Ga0070711_100001021 Ga0070711_10000102113 293
467 3300005468 Ga0070707_100095646 Ga0070707_1000956463 293
468 3300005468 Ga0070707_100133917 Ga0070707_1001339172 293
469 3300005471 Ga0070698_100101807 Ga0070698_1001018073 293
470 3300005518 Ga0070699_100009359 Ga0070699_1000093592 293
471 3300005547 Ga0070693_100007964 Ga0070693_1000079643 293
472 3300006028 Ga0070717_10025343 Ga0070717_100253433 293
473 3300006173 Ga0070716_100002615 Ga0070716_1000026151 293
474 3300006175 Ga0070712_100000627 Ga0070712_10000062713 293
475 3300010159 Ga0099796_10006780 Ga0099796_100067802 293
476 3300022734 Ga0224571_100087 Ga0224571_1000872 293
477 3300025910 Ga0207684_10020177 Ga0207684_100201775 293
478 3300025915 Ga0207693_10001711 Ga0207693_1000171113 293
479 3300025916 Ga0207663_10005987 Ga0207663_100059875 293
480 3300025922 Ga0207646_10077919 Ga0207646_100779193 293
481 3300025928 Ga0207700_10014397 Ga0207700_100143976 293
482 3300027512 Ga0209179_1015541 Ga0209179_10155412 293
483 3300047315 Ga0495581_0053365 Ga0495581_0053365_702_1610 293
484 3300048929 Ga0496126_0000093 Ga0496126_0000093_5777_6664 293
485 3300053085 Ga0495619_0202251 Ga0495619_0202251_238_1146 293
486 3300005445 Ga0070708_100105020 Ga0070708_1001050202 294
487 3300007265 Ga0099794_10029765 Ga0099794_100297652 294
488 3300025922 Ga0207646_10406888 Ga0207646_104068881 294
489 3300031090 Ga0265760_10003395 Ga0265760_100033952 294
490 3300002459 JGI24751J29686_10001826 JGI24751J29686_100018262 295
491 3300005329 Ga0070683_100000143 Ga0070683_1000001438 295
492 3300005331 Ga0070670_100002512 Ga0070670_10000251217 295
493 3300005334 Ga0068869_100002577 Ga0068869_1000025778 295
494 3300005335 Ga0070666_10091531 Ga0070666_100915312 295
495 3300005340 Ga0070689_100001021 Ga0070689_1000010216 295
496 3300005344 Ga0070661_100000234 Ga0070661_10000023445 295
497 3300005354 Ga0070675_100001507 Ga0070675_10000150713 295
498 3300005364 Ga0070673_100002538 Ga0070673_1000025387 295
499 3300005365 Ga0070688_100032547 Ga0070688_1000325471 295
500 3300005366 Ga0070659_100024140 Ga0070659_1000241406 295
501 3300005367 Ga0070667_100060688 Ga0070667_1000606881 295
502 3300005455 Ga0070663_100000826 Ga0070663_1000008267 295
503 3300005457 Ga0070662_100037082 Ga0070662_1000370821 295
504 3300005466 Ga0070685_10043495 Ga0070685_100434952 295
505 3300005468 Ga0070707_100166818 Ga0070707_1001668182 295
506 3300005471 Ga0070698_100023142 Ga0070698_1000231425 295
507 3300005535 Ga0070684_100000160 Ga0070684_1000001607 295
508 3300005543 Ga0070672_100002170 Ga0070672_10000217012 295
509 3300005548 Ga0070665_100072506 Ga0070665_1000725063 295
510 3300005563 Ga0068855_100203487 Ga0068855_1002034872 295
511 3300005564 Ga0070664_100000167 Ga0070664_10000016747 295
512 3300005577 Ga0068857_100000125 Ga0068857_10000012548 295
513 3300005616 Ga0068852_100347605 Ga0068852_1003476051 295
514 3300005618 Ga0068864_100000279 Ga0068864_1000002799 295
515 3300005834 Ga0068851_10036943 Ga0068851_100369432 295
516 3300005840 Ga0068870_10078886 Ga0068870_100788862 295
517 3300005841 Ga0068863_100007477 Ga0068863_1000074777 295
518 3300005842 Ga0068858_100006367 Ga0068858_1000063678 295
519 3300005843 Ga0068860_100018572 Ga0068860_1000185726 295
520 3300005844 Ga0068862_100001789 Ga0068862_10000178919 295
521 3300006358 Ga0068871_100085204 Ga0068871_1000852042 295
522 3300009177 Ga0105248_10465754 Ga0105248_104657542 295
523 3300010375 Ga0105239_10447939 Ga0105239_104479392 295
524 3300013102 Ga0157371_10179359 Ga0157371_101793592 295
525 3300013296 Ga0157374_10030359 Ga0157374_100303592 295
526 3300013306 Ga0163162_10465196 Ga0163162_104651961 295
527 3300013308 Ga0157375_10003606 Ga0157375_100036065 295
528 3300014325 Ga0163163_10000331 Ga0163163_1000033143 295
529 3300014745 Ga0157377_10005406 Ga0157377_100054062 295
530 3300014968 Ga0157379_10001665 Ga0157379_1000166511 295
531 3300014969 Ga0157376_10050307 Ga0157376_100503072 295
532 3300025321 Ga0207656_10025850 Ga0207656_100258502 295
533 3300025900 Ga0207710_10069508 Ga0207710_100695081 295
534 3300025904 Ga0207647_10069990 Ga0207647_100699903 295
535 3300025920 Ga0207649_10000108 Ga0207649_1000010871 295
536 3300025925 Ga0207650_10000333 Ga0207650_100003336 295
537 3300025926 Ga0207659_10001592 Ga0207659_100015924 295
538 3300025931 Ga0207644_10008914 Ga0207644_100089145 295
539 3300025932 Ga0207690_10018864 Ga0207690_100188647 295
540 3300025933 Ga0207706_10032085 Ga0207706_100320852 295
541 3300025936 Ga0207670_10013092 Ga0207670_100130928 295
542 3300025940 Ga0207691_10003102 Ga0207691_100031026 295
543 3300025941 Ga0207711_10002013 Ga0207711_1000201313 295
544 3300025942 Ga0207689_10002608 Ga0207689_100026086 295
545 3300025944 Ga0207661_10001190 Ga0207661_100011907 295
546 3300025945 Ga0207679_10000144 Ga0207679_1000014414 295
547 3300025949 Ga0207667_10193675 Ga0207667_101936751 295
548 3300025960 Ga0207651_10003873 Ga0207651_100038733 295
549 3300026035 Ga0207703_10002589 Ga0207703_1000258913 295
550 3300026067 Ga0207678_10000287 Ga0207678_100002876 295
551 3300026088 Ga0207641_10000375 Ga0207641_100003756 295
552 3300026095 Ga0207676_10000177 Ga0207676_100001776 295
553 3300026116 Ga0207674_10002139 Ga0207674_100021397 295
554 3300028379 Ga0268266_10011331 Ga0268266_100113312 295
555 3300028379 Ga0268266_10012364 Ga0268266_100123646 295
556 3300028380 Ga0268265_10003361 Ga0268265_100033611 295
557 3300028381 Ga0268264_10011039 Ga0268264_100110397 295
558 3300048907 Ga0496104_0400945 Ga0496104_0400945_105_992 295
559 3300048911 Ga0496108_0000308 Ga0496108_0000308_40805_41692 295
560 3300048912 Ga0496109_0000311 Ga0496109_0000311_4125_5012 295
561 3300048913 Ga0496110_0003791 Ga0496110_0003791_1986_2873 295
562 3300048914 Ga0496111_0022620 Ga0496111_0022620_1366_2253 295
563 3300048915 Ga0496112_0000135 Ga0496112_0000135_40828_41715 295
564 3300048916 Ga0496113_0000131 Ga0496113_0000131_4305_5192 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

105

306

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.9339 44 286
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.9029 46 289
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.891 44 286
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8404 46 289
3u0h-assembly1.cif.gz_A the structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius. 0.8224 47 290
ID Description Score Start End Superfamily
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.924 44 286 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8829 44 289 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8803 44 286 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8413 47 283 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8406 44 289 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V7ET17-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9874 180 294 GO:0016853
AF-A0A7Y5VBJ3-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9856 203 294 GO:0016853
AF-A0A2V7MS85-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9844 157 295 GO:0016853
AF-A0A2V7SUZ0-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9838 213 293
AF-A0A2U3LEC6-F1-model_v4 Xylose isomerase domain protein TIM barrel 0.9748 221 291 GO:0016853

Feature Viewer

pLDDT pTM Quality
87.4 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map