metagRoot

F463075

General Info

Members	Datasets	Scaffolds	Average Seq Length
555	233	555	158

Family's Representative Sequence

Representative Sequence	3300005355\|Ga0070671_100069649\|Ga0070671_1000696494
Length	160
Sequence	MGAHTELTPTEAADRLALRELFDAYAHCADRRDAEGQKALFTDETVFAVYMEGEGSEPSYVLHGRESLTPVFDDLNRYEATTHFNGQSTVTIDGGDSATGESYTIAHHLYTEDGARKIMIASLRYLDRFAKIDGRWYFAERKLILDWSETRSVTAPSTSG

Samples

	Sample ID	Description	Type	Environment
1	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
2	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
3	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
4	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
5	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
6	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
7	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
15	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
16	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
17	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
20	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
21	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
22	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
25	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
36	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
37	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
38	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
39	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
40	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
41	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
42	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
43	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
44	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
45	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
46	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
47	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
50	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
53	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
54	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
67	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
68	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
69	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
70	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
74	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
75	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
80	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
81	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
82	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
83	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
85	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
86	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
92	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
93	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
94	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
95	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
96	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
97	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
98	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
99	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
100	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
101	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
102	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
103	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
104	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
105	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
158	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
162	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
163	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
164	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
165	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
166	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
167	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
168	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
169	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
170	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
171	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
172	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
173	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
174	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
175	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
176	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
177	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
178	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
179	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
180	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
181	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
182	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
183	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
184	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
185	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
186	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
187	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
188	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
189	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
190	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
191	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
192	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
193	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
194	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
195	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
196	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
197	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
198	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
199	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
200	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
201	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
202	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
203	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
204	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
205	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
206	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
207	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
208	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
209	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
210	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
211	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
212	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
213	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
214	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
215	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
216	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
217	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
218	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
219	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
220	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
221	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
222	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
223	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
224	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
225	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
226	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
227	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
228	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
229	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
230	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
231	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
232	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
233	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	16.76
Rhizosphere	83.06
Stem	0
Stem Tuber	0
Unclassified	0.18

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	ARSoilOldRDRAFT_c009410	3300000044	Unclassified	815
2	JGI24744J21845_10001426	3300002077	Bacteria	4744
3	Ga0070690_100038284	3300005330	Bacteria	3026
4	Ga0068869_100650003	3300005334	Unclassified	895
5	Ga0070680_100188849	3300005336	Bacteria	1736
6	Ga0070682_100001835	3300005337	Bacteria	11840
7	Ga0070682_100019352	3300005337	Bacteria	3994
8	Ga0068868_100139590	3300005338	Bacteria	1988
9	Ga0068868_100475240	3300005338	Bacteria	1091
10	Ga0070660_100020344	3300005339	Bacteria	4876
11	Ga0070689_100004021	3300005340	Bacteria	9890
12	Ga0070691_10072744	3300005341	Bacteria	1670
13	Ga0070687_100034769	3300005343	Bacteria	2497
14	Ga0070687_100049929	3300005343	Bacteria	2159
15	Ga0070692_10006604	3300005345	Bacteria	5047
16	Ga0070692_10063868	3300005345	Bacteria	1946
17	Ga0070668_100032465	3300005347	Bacteria	3973
18	Ga0070671_100069649	3300005355	Bacteria	2934
19	Ga0070671_100088299	3300005355	Bacteria	2595
20	Ga0070674_100025410	3300005356	Bacteria	3856
21	Ga0070674_100169276	3300005356	Unclassified	1664
22	Ga0070674_101402175	3300005356	Bacteria	626
23	Ga0070673_100293255	3300005364	Bacteria	1430
24	Ga0070688_100224839	3300005365	Bacteria	1324
25	Ga0070688_100616650	3300005365	Unclassified	832
26	Ga0070659_100114637	3300005366	Bacteria	2178
27	Ga0070659_100956895	3300005366	Bacteria	750
28	Ga0070667_101031117	3300005367	Bacteria	768
29	Ga0070703_10026592	3300005406	Bacteria	1721
30	Ga0070709_10015839	3300005434	Bacteria	4293
31	Ga0070709_10155110	3300005434	Bacteria	1586
32	Ga0070714_100386162	3300005435	Bacteria	1321
33	Ga0070714_100781970	3300005435	Bacteria	924
34	Ga0070714_101081374	3300005435	Bacteria	781
35	Ga0070713_100791699	3300005436	Bacteria	909
36	Ga0070713_101361647	3300005436	Bacteria	688
37	Ga0070710_10001144	3300005437	Bacteria	12584
38	Ga0070710_10063351	3300005437	Bacteria	2112
39	Ga0070710_10202942	3300005437	Bacteria	1253
40	Ga0070710_10290815	3300005437	Bacteria	1063
41	Ga0070710_10445465	3300005437	Bacteria	877
42	Ga0070701_10001579	3300005438	Bacteria	8473
43	Ga0070711_100005621	3300005439	Bacteria	7506
44	Ga0070711_100035740	3300005439	Bacteria	3325
45	Ga0070711_100041236	3300005439	Bacteria	3117
46	Ga0070711_100118178	3300005439	Bacteria	1956
47	Ga0070711_100197643	3300005439	Bacteria	1550
48	Ga0070711_100240850	3300005439	Bacteria	1414
49	Ga0070711_100833661	3300005439	Bacteria	784
50	Ga0070711_100838713	3300005439	Bacteria	781
51	Ga0070705_100001791	3300005440	Bacteria	11107
52	Ga0070700_100000342	3300005441	Bacteria	24072
53	Ga0070700_100021999	3300005441	Bacteria	3712
54	Ga0070694_100018481	3300005444	Bacteria	4424
55	Ga0070694_100254153	3300005444	Bacteria	1330
56	Ga0070663_100277552	3300005455	Bacteria	1334
57	Ga0070663_100330109	3300005455	Bacteria	1229
58	Ga0070678_100000759	3300005456	Bacteria	16198
59	Ga0070678_100264597	3300005456	Bacteria	1448
60	Ga0070662_100044925	3300005457	Bacteria	3167
61	Ga0070662_100115655	3300005457	Bacteria	2049
62	Ga0070662_101252437	3300005457	Bacteria	638
63	Ga0070681_10997847	3300005458	Unclassified	757
64	Ga0068867_100001070	3300005459	Bacteria	18696
65	Ga0068867_100051615	3300005459	Bacteria	3033
66	Ga0068867_101305175	3300005459	Unclassified	670
67	Ga0070685_10003155	3300005466	Bacteria	8379
68	Ga0070706_100113643	3300005467	Bacteria	2521
69	Ga0070706_100458232	3300005467	Bacteria	1186
70	Ga0070706_100753030	3300005467	Bacteria	902
71	Ga0070707_100002302	3300005468	Bacteria	18245
72	Ga0070707_100022260	3300005468	Bacteria	5991
73	Ga0070707_100463943	3300005468	Bacteria	1227
74	Ga0070707_101128581	3300005468	Bacteria	750
75	Ga0070698_100028283	3300005471	Bacteria	5825
76	Ga0070698_100036991	3300005471	Bacteria	5035
77	Ga0070698_100117291	3300005471	Bacteria	2624
78	Ga0070698_100140806	3300005471	Bacteria	2363
79	Ga0070699_100009838	3300005518	Bacteria	8278
80	Ga0070699_100508570	3300005518	Bacteria	1095
81	Ga0070684_101654731	3300005535	Bacteria	604
82	Ga0070697_100532784	3300005536	Unclassified	1029
83	Ga0068853_100000987	3300005539	Bacteria	20023
84	Ga0068853_100034836	3300005539	Bacteria	4275
85	Ga0070672_100118868	3300005543	Bacteria	2161
86	Ga0070686_100009806	3300005544	Bacteria	5382
87	Ga0070686_100054056	3300005544	Bacteria	2567
88	Ga0070686_100301465	3300005544	Bacteria	1188
89	Ga0070695_100211121	3300005545	Bacteria	1393
90	Ga0070695_100272655	3300005545	Bacteria	1240
91	Ga0070696_100011752	3300005546	Bacteria	5867
92	Ga0070696_100039834	3300005546	Bacteria	3244
93	Ga0070693_100004095	3300005547	Bacteria	6862
94	Ga0070693_100007143	3300005547	Bacteria	5446
95	Ga0070693_100125793	3300005547	Bacteria	1596
96	Ga0070693_100736405	3300005547	Bacteria	725
97	Ga0070665_100222559	3300005548	Bacteria	1888
98	Ga0070704_100000610	3300005549	Bacteria	17219
99	Ga0070704_100577315	3300005549	Bacteria	985
100	Ga0068855_100923964	3300005563	Bacteria	921
101	Ga0068854_100079098	3300005578	Bacteria	2424
102	Ga0068856_100006917	3300005614	Bacteria	11095
103	Ga0068856_100052728	3300005614	Unclassified	4012
104	Ga0068856_101010656	3300005614	Bacteria	850
105	Ga0070702_100004650	3300005615	Bacteria	6294
106	Ga0070702_100042200	3300005615	Bacteria	2563
107	Ga0068852_100049669	3300005616	Bacteria	3589
108	Ga0068859_100056662	3300005617	Bacteria	3945
109	Ga0068864_100677811	3300005618	Bacteria	1006
110	Ga0068866_10000765	3300005718	Bacteria	14497
111	Ga0068861_100003826	3300005719	Bacteria	10045
112	Ga0068851_10190132	3300005834	Bacteria	1141
113	Ga0068851_10556606	3300005834	Unclassified	694
114	Ga0068863_100787904	3300005841	Unclassified	948
115	Ga0068858_100248583	3300005842	Bacteria	1689
116	Ga0068858_100296438	3300005842	Bacteria	1542
117	Ga0068860_100198671	3300005843	Bacteria	1943
118	Ga0068862_100034200	3300005844	Bacteria	4299
119	Ga0068862_100050851	3300005844	Bacteria	3543
120	Ga0081538_10016564	3300005981	Bacteria	5643
121	Ga0081538_10045765	3300005981	Bacteria	2708
122	Ga0070717_10006307	3300006028	Bacteria	8710
123	Ga0070717_10180087	3300006028	Bacteria	1842
124	Ga0070717_10287037	3300006028	Bacteria	1460
125	Ga0070717_10395386	3300006028	Bacteria	1241
126	Ga0070717_10487127	3300006028	Unclassified	1114
127	Ga0070717_10891618	3300006028	Bacteria	810
128	Ga0075432_10006101	3300006058	Bacteria	4097
129	Ga0075432_10047893	3300006058	Bacteria	1503
130	Ga0070715_10000179	3300006163	Bacteria	14766
131	Ga0070715_10339379	3300006163	Bacteria	817
132	Ga0070716_100013759	3300006173	Bacteria	4131
133	Ga0070716_100024596	3300006173	Bacteria	3207
134	Ga0070716_100054203	3300006173	Unclassified	2290
135	Ga0070716_100255654	3300006173	Bacteria	1196
136	Ga0070716_101206036	3300006173	Unclassified	608
137	Ga0070712_100031039	3300006175	Bacteria	3597
138	Ga0070712_100033519	3300006175	Bacteria	3476
139	Ga0070712_100220619	3300006175	Unclassified	1501
140	Ga0070712_100655790	3300006175	Bacteria	892
141	Ga0070712_101149467	3300006175	Bacteria	675
142	Ga0097621_100127003	3300006237	Bacteria	2167
143	Ga0068871_100003338	3300006358	Bacteria	11021
144	Ga0068871_100285830	3300006358	Bacteria	1444
145	Ga0075428_100146044	3300006844	Bacteria	2570
146	Ga0075431_100594022	3300006847	Unclassified	1091
147	Ga0075433_10057416	3300006852	Bacteria	3402
148	Ga0075433_11272004	3300006852	Unclassified	638
149	Ga0075434_100004052	3300006871	Bacteria	13142
150	Ga0075434_100015545	3300006871	Bacteria	7303
151	Ga0075434_100078666	3300006871	Bacteria	3293
152	Ga0075434_100110664	3300006871	Bacteria	2757
153	Ga0075434_100204309	3300006871	Bacteria	1996
154	Ga0075434_100477385	3300006871	Unclassified	1268
155	Ga0075434_101080159	3300006871	Unclassified	816
156	Ga0068865_100000326	3300006881	Bacteria	26329
157	Ga0068865_100613392	3300006881	Bacteria	921
158	Ga0075436_100029719	3300006914	Bacteria	3758
159	Ga0075436_100314330	3300006914	Bacteria	1124
160	Ga0097620_100056662	3300006931	Bacteria	3945
161	Ga0075435_100046617	3300007076	Bacteria	3477
162	Ga0075435_100061630	3300007076	Bacteria	3043
163	Ga0075435_100069764	3300007076	Bacteria	2867
164	Ga0075435_100146638	3300007076	Unclassified	1982
165	Ga0075435_100156468	3300007076	Bacteria	1918
166	Ga0099794_10011126	3300007265	Unclassified	3845
167	Ga0099794_10026853	3300007265	Bacteria	2665
168	Ga0099794_10059947	3300007265	Bacteria	1847
169	Ga0099795_10223051	3300007788	Bacteria	803
170	Ga0099795_10320393	3300007788	Bacteria	686
171	Ga0105244_10295488	3300009036	Unclassified	750
172	Ga0111539_10109919	3300009094	Bacteria	3235
173	Ga0111539_10593948	3300009094	Bacteria	1289
174	Ga0105245_10003888	3300009098	Bacteria	13281
175	Ga0105245_10118795	3300009098	Bacteria	2467
176	Ga0105245_10182441	3300009098	Bacteria	2006
177	Ga0105245_10216947	3300009098	Bacteria	1844
178	Ga0105245_10248214	3300009098	Bacteria	1728
179	Ga0105245_11053219	3300009098	Bacteria	859
180	Ga0105247_10074297	3300009101	Unclassified	2132
181	Ga0105247_10094773	3300009101	Bacteria	1900
182	Ga0105247_10114037	3300009101	Bacteria	1743
183	Ga0105247_10362624	3300009101	Bacteria	1022
184	Ga0105247_11018639	3300009101	Bacteria	648
185	Ga0114129_10270189	3300009147	Bacteria	2275
186	Ga0114129_10617074	3300009147	Unclassified	1403
187	Ga0114129_10762730	3300009147	Bacteria	1237
188	Ga0114129_11201897	3300009147	Bacteria	944
189	Ga0114129_11788843	3300009147	Bacteria	747
190	Ga0105243_10001953	3300009148	Bacteria	17555
191	Ga0105243_10337967	3300009148	Bacteria	1378
192	Ga0105243_10524329	3300009148	Bacteria	1127
193	Ga0105243_10861415	3300009148	Unclassified	898
194	Ga0105241_10022312	3300009174	Bacteria	4688
195	Ga0105241_10073206	3300009174	Unclassified	2664
196	Ga0105241_10106816	3300009174	Bacteria	2235
197	Ga0105241_10500493	3300009174	Unclassified	1083
198	Ga0105241_11228449	3300009174	Unclassified	711
199	Ga0105242_10000495	3300009176	Bacteria	31069
200	Ga0105242_10046200	3300009176	Bacteria	3532
201	Ga0105242_10147236	3300009176	Bacteria	2050
202	Ga0105242_10172950	3300009176	Bacteria	1899
203	Ga0105242_10174370	3300009176	Unclassified	1892
204	Ga0105242_10925108	3300009176	Bacteria	874
205	Ga0105242_11672427	3300009176	Bacteria	672
206	Ga0105242_12906592	3300009176	Bacteria	529
207	Ga0105248_10021759	3300009177	Bacteria	7104
208	Ga0105248_10054163	3300009177	Bacteria	4499
209	Ga0105237_10173841	3300009545	Bacteria	2154
210	Ga0105237_10291423	3300009545	Bacteria	1635
211	Ga0105237_11658512	3300009545	Bacteria	646
212	Ga0105238_10980129	3300009551	Unclassified	866
213	Ga0105238_11543232	3300009551	Bacteria	693
214	Ga0105238_11922561	3300009551	Bacteria	625
215	Ga0105249_10000837	3300009553	Bacteria	27653
216	Ga0105249_10152446	3300009553	Bacteria	2226
217	Ga0105249_10374094	3300009553	Bacteria	1449
218	Ga0105249_10704265	3300009553	Bacteria	1070
219	Ga0099796_10281064	3300010159	Unclassified	700
220	Ga0105239_10002075	3300010375	Bacteria	25965
221	Ga0105239_10260879	3300010375	Bacteria	1947
222	Ga0105239_10381486	3300010375	Bacteria	1593
223	Ga0105239_10404433	3300010375	Bacteria	1545
224	Ga0105246_10136249	3300011119	Bacteria	1841
225	Ga0157371_10237574	3300013102	Bacteria	1310
226	Ga0157369_10189828	3300013105	Unclassified	2159
227	Ga0157369_10485629	3300013105	Bacteria	1278
228	Ga0157374_10003121	3300013296	Bacteria	13917
229	Ga0157374_10074521	3300013296	Bacteria	3205
230	Ga0157374_10303350	3300013296	Bacteria	1580
231	Ga0157374_10437821	3300013296	Bacteria	1307
232	Ga0157374_10554621	3300013296	Bacteria	1157
233	Ga0157374_11233571	3300013296	Bacteria	769
234	Ga0157378_10000828	3300013297	Bacteria	28804
235	Ga0157378_10441121	3300013297	Bacteria	1290
236	Ga0163162_10002301	3300013306	Bacteria	17934
237	Ga0163162_10494806	3300013306	Bacteria	1353
238	Ga0163162_10515393	3300013306	Bacteria	1326
239	Ga0163162_11470375	3300013306	Bacteria	776
240	Ga0163162_12460241	3300013306	Bacteria	599
241	Ga0157372_10722870	3300013307	Bacteria	1158
242	Ga0157372_10783788	3300013307	Bacteria	1108
243	Ga0157375_10045817	3300013308	Bacteria	4258
244	Ga0157375_10055250	3300013308	Bacteria	3915
245	Ga0157380_10056034	3300014326	Bacteria	3133
246	Ga0157380_10751354	3300014326	Bacteria	987
247	Ga0157377_10041014	3300014745	Bacteria	2566
248	Ga0157377_10411003	3300014745	Bacteria	924
249	Ga0157376_10013513	3300014969	Bacteria	6094
250	Ga0157376_10290155	3300014969	Bacteria	1544
251	Ga0157376_12606252	3300014969	Bacteria	545
252	Ga0163161_10625960	3300017792	Bacteria	890
253	Ga0207692_10025389	3300025898	Bacteria	2767
254	Ga0207692_10036918	3300025898	Bacteria	2386
255	Ga0207692_10199661	3300025898	Unclassified	1175
256	Ga0207692_10425133	3300025898	Bacteria	832
257	Ga0207642_10000153	3300025899	Bacteria	19567
258	Ga0207710_10051015	3300025900	Unclassified	1857
259	Ga0207710_10192736	3300025900	Unclassified	1004
260	Ga0207688_10087963	3300025901	Bacteria	1781
261	Ga0207688_10131562	3300025901	Bacteria	1467
262	Ga0207680_10046302	3300025903	Bacteria	2570
263	Ga0207647_10116923	3300025904	Bacteria	1574
264	Ga0207685_10043552	3300025905	Bacteria	1692
265	Ga0207685_10426920	3300025905	Bacteria	685
266	Ga0207699_10068495	3300025906	Bacteria	2161
267	Ga0207699_10125491	3300025906	Bacteria	1666
268	Ga0207699_10552636	3300025906	Bacteria	835
269	Ga0207699_10565885	3300025906	Bacteria	825
270	Ga0207699_10853474	3300025906	Bacteria	671
271	Ga0207684_10120260	3300025910	Bacteria	2252
272	Ga0207684_10407197	3300025910	Bacteria	1169
273	Ga0207684_11032512	3300025910	Bacteria	687
274	Ga0207654_10009385	3300025911	Bacteria	4968
275	Ga0207654_10221325	3300025911	Bacteria	1256
276	Ga0207654_10575709	3300025911	Bacteria	802
277	Ga0207671_10742615	3300025914	Unclassified	780
278	Ga0207693_10000306	3300025915	Bacteria	45797
279	Ga0207693_10036074	3300025915	Bacteria	3897
280	Ga0207693_10154861	3300025915	Bacteria	1803
281	Ga0207693_10174099	3300025915	Bacteria	1694
282	Ga0207693_10213162	3300025915	Bacteria	1518
283	Ga0207693_10275383	3300025915	Unclassified	1319
284	Ga0207693_10387579	3300025915	Bacteria	1093
285	Ga0207693_10674141	3300025915	Archaea	802
286	Ga0207693_10867296	3300025915	Bacteria	694
287	Ga0207663_10015500	3300025916	Bacteria	4206
288	Ga0207663_10037374	3300025916	Bacteria	2927
289	Ga0207663_10093367	3300025916	Bacteria	2002
290	Ga0207663_10099793	3300025916	Bacteria	1947
291	Ga0207663_11034724	3300025916	Bacteria	659
292	Ga0207660_10006571	3300025917	Bacteria	7546
293	Ga0207662_10070522	3300025918	Bacteria	2114
294	Ga0207657_10006514	3300025919	Bacteria	12095
295	Ga0207646_10003334	3300025922	Bacteria	18241
296	Ga0207646_10268637	3300025922	Bacteria	1541
297	Ga0207646_10342958	3300025922	Bacteria	1350
298	Ga0207646_10513299	3300025922	Bacteria	1079
299	Ga0207646_10808155	3300025922	Bacteria	835
300	Ga0207687_10003080	3300025927	Bacteria	11311
301	Ga0207687_10159539	3300025927	Bacteria	1729
302	Ga0207687_11113404	3300025927	Bacteria	678
303	Ga0207700_10172420	3300025928	Bacteria	1806
304	Ga0207700_10474636	3300025928	Bacteria	1105
305	Ga0207664_10139143	3300025929	Bacteria	2051
306	Ga0207664_10279951	3300025929	Bacteria	1463
307	Ga0207664_10433406	3300025929	Bacteria	1172
308	Ga0207664_11685362	3300025929	Bacteria	556
309	Ga0207644_10025532	3300025931	Bacteria	4063
310	Ga0207644_10175682	3300025931	Bacteria	1675
311	Ga0207690_11342073	3300025932	Bacteria	598
312	Ga0207706_10016170	3300025933	Bacteria	6740
313	Ga0207706_10140158	3300025933	Bacteria	2127
314	Ga0207706_10295194	3300025933	Bacteria	1413
315	Ga0207686_10001410	3300025934	Bacteria	13654
316	Ga0207686_10018277	3300025934	Unclassified	3968
317	Ga0207686_10275694	3300025934	Unclassified	1239
318	Ga0207686_10358355	3300025934	Bacteria	1100
319	Ga0207709_10001113	3300025935	Bacteria	19692
320	Ga0207709_10425715	3300025935	Bacteria	1021
321	Ga0207709_10683874	3300025935	Bacteria	820
322	Ga0207670_10536256	3300025936	Unclassified	954
323	Ga0207669_10022203	3300025937	Bacteria	3366
324	Ga0207669_10369903	3300025937	Bacteria	1114
325	Ga0207704_10004452	3300025938	Bacteria	6405
326	Ga0207665_10001482	3300025939	Bacteria	15786
327	Ga0207665_10050348	3300025939	Archaea	2801
328	Ga0207665_10143455	3300025939	Bacteria	1705
329	Ga0207665_10224389	3300025939	Bacteria	1378
330	Ga0207691_10043721	3300025940	Bacteria	4127
331	Ga0207691_10234919	3300025940	Bacteria	1586
332	Ga0207711_10051731	3300025941	Bacteria	3519
333	Ga0207711_10092484	3300025941	Bacteria	2662
334	Ga0207689_10544876	3300025942	Unclassified	974
335	Ga0207667_10212330	3300025949	Bacteria	1984
336	Ga0207667_10805128	3300025949	Bacteria	936
337	Ga0207712_10001481	3300025961	Bacteria	15981
338	Ga0207712_10306571	3300025961	Bacteria	1305
339	Ga0207712_11254145	3300025961	Bacteria	662
340	Ga0207668_10098846	3300025972	Bacteria	2163
341	Ga0207668_10439780	3300025972	Bacteria	1111
342	Ga0207640_10315103	3300025981	Bacteria	1243
343	Ga0207658_10487013	3300025986	Bacteria	1097
344	Ga0207677_10051568	3300026023	Bacteria	2790
345	Ga0207677_10230015	3300026023	Bacteria	1493
346	Ga0207703_10078051	3300026035	Bacteria	2750
347	Ga0207639_10005997	3300026041	Bacteria	8244
348	Ga0207678_10026508	3300026067	Bacteria	5056
349	Ga0207678_10062184	3300026067	Bacteria	3210
350	Ga0207708_10001074	3300026075	Bacteria	20484
351	Ga0207708_10008318	3300026075	Bacteria	7682
352	Ga0207708_10178259	3300026075	Bacteria	1686
353	Ga0207708_10274228	3300026075	Bacteria	1365
354	Ga0207702_10003359	3300026078	Bacteria	14673
355	Ga0207702_10129646	3300026078	Unclassified	2268
356	Ga0207641_10739628	3300026088	Unclassified	970
357	Ga0207641_11553371	3300026088	Unclassified	664
358	Ga0207648_10000413	3300026089	Bacteria	47529
359	Ga0207648_10010123	3300026089	Bacteria	8966
360	Ga0207648_10956700	3300026089	Bacteria	801
361	Ga0207675_100160222	3300026118	Bacteria	2146
362	Ga0207683_10000358	3300026121	Bacteria	41937
363	Ga0207683_10020880	3300026121	Bacteria	5604
364	Ga0207683_11252625	3300026121	Bacteria	687
365	Ga0207698_10046805	3300026142	Bacteria	3270
366	Ga0207698_11378075	3300026142	Bacteria	720
367	Ga0209588_1008025	3300027671	Bacteria	3124
368	Ga0207428_10031536	3300027907	Bacteria	4370
369	Ga0207428_10034348	3300027907	Bacteria	4156
370	Ga0207428_10800148	3300027907	Bacteria	670
371	Ga0268266_10182166	3300028379	Bacteria	1913
372	Ga0268265_10869974	3300028380	Bacteria	883
373	Ga0268264_10167196	3300028381	Bacteria	1986
374	Ga0373948_0011468	3300034817	Bacteria	1568
375	Ga0373928_0085422	3300035084	Bacteria	802
376	Ga0373929_0026130	3300035085	Bacteria	1218
377	Ga0373934_0179526	3300035086	Bacteria	870
378	Ga0373951_0037252	3300035091	Bacteria	1163
379	Ga0373952_0020657	3300035092	Bacteria	1382
380	Ga0373941_0012206	3300035115	Bacteria	2240
381	Ga0373955_0312292	3300035172	Bacteria	949
382	Ga0373931_0094208	3300035691	Bacteria	1674
383	Ga0373927_0216258	3300035695	Bacteria	1259
384	Ga0373947_0129391	3300035725	Bacteria	1610
385	Ga0373947_0902728	3300035725	Bacteria	603
386	Ga0373937_0300524	3300036401	Unclassified	1517
387	Ga0451845_0080493	3300041501	Unclassified	513
388	Ga0453683_0018787	3300044673	Bacteria	4435
389	Ga0495592_0712457	3300046454	Bacteria	603
390	Ga0495629_0121314	3300046459	Bacteria	1821
391	Ga0495651_0167145	3300046462	Bacteria	1570
392	Ga0495653_0006965	3300046463	Bacteria	9283
393	Ga0495582_0014336	3300046473	Bacteria	4357
394	Ga0495639_0010529	3300046475	Bacteria	3983
395	Ga0495662_0077436	3300046476	Bacteria	1615
396	Ga0495662_0409921	3300046476	Bacteria	665
397	Ga0495596_0070616	3300046500	Unclassified	1357
398	Ga0495608_0575012	3300046511	Unclassified	678
399	Ga0495628_0157051	3300046516	Bacteria	1730
400	Ga0495637_0055987	3300046520	Bacteria	1634
401	Ga0495644_0125165	3300046523	Bacteria	979
402	Ga0495652_0103593	3300046529	Bacteria	2303
403	Ga0495652_0266615	3300046529	Bacteria	1261
404	Ga0495652_0627134	3300046529	Bacteria	730
405	Ga0495665_0017736	3300046531	Bacteria	3827
406	Ga0495640_0086574	3300046533	Bacteria	2074
407	Ga0495587_0061370	3300046536	Bacteria	2203
408	Ga0495587_0474548	3300046536	Unclassified	692
409	Ga0495609_0123366	3300046538	Unclassified	1113
410	Ga0495597_0088861	3300046542	Unclassified	1314
411	Ga0495645_0233417	3300046543	Bacteria	1231
412	Ga0495667_0415506	3300046559	Bacteria	847
413	Ga0495667_0496113	3300046559	Bacteria	765
414	Ga0495656_0147874	3300046615	Bacteria	1132
415	Ga0495656_0169672	3300046615	Bacteria	1066
416	Ga0495656_0214717	3300046615	Unclassified	960
417	Ga0495611_0257809	3300046648	Unclassified	808
418	Ga0495635_0105363	3300046663	Bacteria	1926
419	Ga0495659_0214252	3300046664	Bacteria	794
420	Ga0495646_0181305	3300046680	Bacteria	1156
421	Ga0495658_0127377	3300046683	Bacteria	1546
422	Ga0495589_0145145	3300046794	Unclassified	1135
423	Ga0495600_0214685	3300046809	Bacteria	1232
424	Ga0495581_0053002	3300047315	Bacteria	2343
425	Ga0495674_0176004	3300047319	Bacteria	1783
426	Ga0495680_0157035	3300047322	Bacteria	1654
427	Ga0495677_0217470	3300047445	Unclassified	744
428	Ga0495677_0245201	3300047445	Unclassified	700
429	Ga0495684_0036824	3300047471	Bacteria	3751
430	Ga0495593_0064920	3300047673	Bacteria	1904
431	Ga0495602_0242179	3300048088	Bacteria	1349
432	Ga0496100_0000411	3300048903	Bacteria	20683
433	Ga0496100_0013274	3300048903	Bacteria	4745
434	Ga0496100_0029831	3300048903	Bacteria	3377
435	Ga0496100_0519370	3300048903	Bacteria	919
436	Ga0496100_0683973	3300048903	Bacteria	800
437	Ga0496100_1227250	3300048903	Bacteria	591
438	Ga0496101_0001420	3300048904	Bacteria	14318
439	Ga0496101_0015169	3300048904	Bacteria	5187
440	Ga0496101_0025072	3300048904	Bacteria	4133
441	Ga0496101_0046854	3300048904	Bacteria	3101
442	Ga0496101_0289911	3300048904	Bacteria	1280
443	Ga0496101_0361295	3300048904	Bacteria	1141
444	Ga0496101_0366808	3300048904	Bacteria	1132
445	Ga0496101_0914727	3300048904	Archaea	691
446	Ga0496102_0004676	3300048905	Bacteria	11578
447	Ga0496102_0006369	3300048905	Bacteria	10062
448	Ga0496102_0016097	3300048905	Bacteria	6530
449	Ga0496102_0053084	3300048905	Bacteria	3695
450	Ga0496102_0159673	3300048905	Bacteria	2120
451	Ga0496102_0600756	3300048905	Bacteria	1023
452	Ga0496102_0861338	3300048905	Bacteria	828
453	Ga0496102_1304302	3300048905	Bacteria	645
454	Ga0496103_0005115	3300048906	Bacteria	7897
455	Ga0496103_0067362	3300048906	Bacteria	2236
456	Ga0496103_0132938	3300048906	Bacteria	1589
457	Ga0496104_0004936	3300048907	Bacteria	11640
458	Ga0496104_0010117	3300048907	Bacteria	8421
459	Ga0496104_0035818	3300048907	Bacteria	4636
460	Ga0496104_0082774	3300048907	Bacteria	3060
461	Ga0496104_0091343	3300048907	Bacteria	2910
462	Ga0496104_0397493	3300048907	Bacteria	1290
463	Ga0496104_0628123	3300048907	Bacteria	983
464	Ga0496105_0020790	3300048908	Bacteria	5306
465	Ga0496105_0063142	3300048908	Bacteria	3056
466	Ga0496105_0090659	3300048908	Unclassified	2525
467	Ga0496105_0812945	3300048908	Bacteria	710
468	Ga0496106_0001151	3300048909	Bacteria	19597
469	Ga0496106_0002735	3300048909	Bacteria	13070
470	Ga0496106_0020409	3300048909	Bacteria	4917
471	Ga0496106_0048442	3300048909	Bacteria	3200
472	Ga0496106_0120090	3300048909	Bacteria	2054
473	Ga0496106_0199209	3300048909	Bacteria	1593
474	Ga0496106_0791987	3300048909	Bacteria	752
475	Ga0496107_0000610	3300048910	Bacteria	19958
476	Ga0496107_0006196	3300048910	Bacteria	8219
477	Ga0496107_0010022	3300048910	Bacteria	6572
478	Ga0496107_0017553	3300048910	Bacteria	5033
479	Ga0496107_0046443	3300048910	Bacteria	3125
480	Ga0496107_0105113	3300048910	Bacteria	2072
481	Ga0496108_0006035	3300048911	Bacteria	9806
482	Ga0496108_0106424	3300048911	Bacteria	2395
483	Ga0496108_0155478	3300048911	Bacteria	1975
484	Ga0496108_0321769	3300048911	Bacteria	1348
485	Ga0496109_0008013	3300048912	Bacteria	8958
486	Ga0496109_0011946	3300048912	Bacteria	7477
487	Ga0496109_0030303	3300048912	Bacteria	4850
488	Ga0496109_0098665	3300048912	Bacteria	2708
489	Ga0496109_0675020	3300048912	Bacteria	970
490	Ga0496109_0753670	3300048912	Bacteria	911
491	Ga0496110_0193790	3300048913	Bacteria	1845
492	Ga0496110_0211789	3300048913	Bacteria	1762
493	Ga0496110_0388555	3300048913	Bacteria	1272
494	Ga0496110_0486998	3300048913	Bacteria	1123
495	Ga0496110_0726099	3300048913	Bacteria	896
496	Ga0496110_0829943	3300048913	Bacteria	829
497	Ga0496111_0063553	3300048914	Bacteria	2677
498	Ga0496111_0212729	3300048914	Bacteria	1436
499	Ga0496111_0317767	3300048914	Bacteria	1153
500	Ga0496111_0400657	3300048914	Bacteria	1014
501	Ga0496112_0013786	3300048915	Bacteria	7476
502	Ga0496112_0057808	3300048915	Unclassified	3819
503	Ga0496112_0173553	3300048915	Bacteria	2121
504	Ga0496112_0259939	3300048915	Bacteria	1686
505	Ga0496112_0891765	3300048915	Bacteria	812
506	Ga0496113_0038437	3300048916	Bacteria	3519
507	Ga0496113_0597612	3300048916	Unclassified	884
508	Ga0496114_0000788	3300048917	Bacteria	23678
509	Ga0496114_0000863	3300048917	Bacteria	22684
510	Ga0496114_0016000	3300048917	Bacteria	6036
511	Ga0496114_0121299	3300048917	Bacteria	2248
512	Ga0496114_0142070	3300048917	Bacteria	2079
513	Ga0496114_0334346	3300048917	Bacteria	1339
514	Ga0496114_0378211	3300048917	Bacteria	1253
515	Ga0496114_0561961	3300048917	Bacteria	1007
516	Ga0496115_0001547	3300048918	Bacteria	16512
517	Ga0496115_0003225	3300048918	Bacteria	11712
518	Ga0496115_0003634	3300048918	Bacteria	11100
519	Ga0496115_0030633	3300048918	Bacteria	4234
520	Ga0496115_0128783	3300048918	Bacteria	2085
521	Ga0496115_0156649	3300048918	Bacteria	1882
522	Ga0496115_0251536	3300048918	Unclassified	1455
523	Ga0496115_0312452	3300048918	Bacteria	1287
524	Ga0496115_0480954	3300048918	Bacteria	1000
525	nmdc:mga05p37_533329_c1	3300050507	Bacteria	1340
526	nmdc:mga05p37_71039_c1	3300050507	Bacteria	4282
527	nmdc:mga08y16_1010666_c1	3300050511	Bacteria	811
528	nmdc:mga08y16_1400645_c1	3300050511	Bacteria	662
529	nmdc:mga08y16_1955174_c1	3300050511	Unclassified	536
530	nmdc:mga08y16_28716_c1	3300050511	Bacteria	5863
531	nmdc:mga08y16_417368_c1	3300050511	Unclassified	1372
532	nmdc:mga0n895_1040183_c1	3300050512	Bacteria	798
533	nmdc:mga0n895_135033_c1	3300050512	Bacteria	2493
534	nmdc:mga0n895_287940_c1	3300050512	Bacteria	1666
535	nmdc:mga0n895_31094_c1	3300050512	Bacteria	5108
536	nmdc:mga0n895_33700_c1	3300050512	Bacteria	4923
537	nmdc:mga0n895_352_c1	3300050512	Bacteria	30946
538	nmdc:mga0n895_42399_c1	3300050512	Bacteria	4427
539	nmdc:mga0n895_44862_c1	3300050512	Bacteria	4311
540	nmdc:mga0rr50_135930_c1	3300050513	Bacteria	1973
541	nmdc:mga0rr50_1676_c1	3300050513	Bacteria	12210
542	nmdc:mga0rr50_362395_c1	3300050513	Bacteria	1220
543	nmdc:mga0rr50_467231_c1	3300050513	Unclassified	1071
544	nmdc:mga0rr50_5969_c1	3300050513	Bacteria	7343
545	nmdc:mga0rr50_60971_c1	3300050513	Bacteria	2840
546	nmdc:mga0rr50_935537_c1	3300050513	Unclassified	739
547	nmdc:mga08x19_138969_c1	3300050514	Bacteria	1640
548	nmdc:mga08x19_2908_c1	3300050514	Bacteria	10301
549	nmdc:mga08x19_381148_c1	3300050514	Unclassified	987
550	nmdc:mga08x19_987640_c1	3300050514	Unclassified	598
551	nmdc:mga0a205_1457942_c1	3300050515	Unclassified	532
552	nmdc:mga0a205_173450_c1	3300050515	Bacteria	2053
553	nmdc:mga0a205_244515_c1	3300050515	Bacteria	1675
554	Ga0495655_0030885	3300053083	Unclassified	1300
555	Ga0495595_0087614	3300053084	Archaea	1491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050513	nmdc:mga0rr50_135930_c1	nmdc:mga0rr50_135930_c1_1502_1957	148
2	3300006871	Ga0075434_100477385	Ga0075434_1004773854	151
3	3300044673	Ga0453683_0018787	Ga0453683_0018787_3700_4155	151
4	3300006028	Ga0070717_10180087	Ga0070717_101800872	152
5	3300005436	Ga0070713_100791699	Ga0070713_1007916991	153
6	3300005437	Ga0070710_10445465	Ga0070710_104454651	153
7	3300005439	Ga0070711_100197643	Ga0070711_1001976432	153
8	3300006028	Ga0070717_10891618	Ga0070717_108916182	153
9	3300006175	Ga0070712_101149467	Ga0070712_1011494672	153
10	3300013296	Ga0157374_10303350	Ga0157374_103033502	153
11	3300013296	Ga0157374_11233571	Ga0157374_112335711	153
12	3300013297	Ga0157378_10441121	Ga0157378_104411212	153
13	3300025915	Ga0207693_10867296	Ga0207693_108672961	153
14	3300025928	Ga0207700_10474636	Ga0207700_104746362	153
15	3300046615	Ga0495656_0169672	Ga0495656_0169672_586_1047	153
16	3300048903	Ga0496100_0000411	Ga0496100_0000411_1230_1691	153
17	3300048905	Ga0496102_0053084	Ga0496102_0053084_2947_3408	153
18	3300048906	Ga0496103_0067362	Ga0496103_0067362_690_1151	153
19	3300048907	Ga0496104_0004936	Ga0496104_0004936_1044_1505	153
20	3300048908	Ga0496105_0020790	Ga0496105_0020790_1921_2382	153
21	3300048909	Ga0496106_0020409	Ga0496106_0020409_1183_1644	153
22	3300048910	Ga0496107_0006196	Ga0496107_0006196_5102_5563	153
23	3300048911	Ga0496108_0006035	Ga0496108_0006035_1768_2229	153
24	3300048912	Ga0496109_0008013	Ga0496109_0008013_7569_8030	153
25	3300048913	Ga0496110_0193790	Ga0496110_0193790_1303_1764	153
26	3300048915	Ga0496112_0013786	Ga0496112_0013786_688_1149	153
27	3300048917	Ga0496114_0000788	Ga0496114_0000788_12437_12898	153
28	3300048918	Ga0496115_0003225	Ga0496115_0003225_10383_10844	153
29	3300005436	Ga0070713_101361647	Ga0070713_1013616471	154
30	3300005439	Ga0070711_100240850	Ga0070711_1002408502	154
31	3300005441	Ga0070700_100021999	Ga0070700_1000219992	154
32	3300005536	Ga0070697_100532784	Ga0070697_1005327842	154
33	3300005834	Ga0068851_10556606	Ga0068851_105566061	154
34	3300006871	Ga0075434_100015545	Ga0075434_1000155453	154
35	3300006871	Ga0075434_101080159	Ga0075434_1010801592	154
36	3300007076	Ga0075435_100146638	Ga0075435_1001466382	154
37	3300007265	Ga0099794_10011126	Ga0099794_100111261	154
38	3300007265	Ga0099794_10026853	Ga0099794_100268531	154
39	3300007788	Ga0099795_10223051	Ga0099795_102230512	154
40	3300009036	Ga0105244_10295488	Ga0105244_102954881	154
41	3300009098	Ga0105245_10248214	Ga0105245_102482142	154
42	3300009101	Ga0105247_10362624	Ga0105247_103626242	154
43	3300009176	Ga0105242_10925108	Ga0105242_109251081	154
44	3300009545	Ga0105237_10173841	Ga0105237_101738412	154
45	3300025903	Ga0207680_10046302	Ga0207680_100463023	154
46	3300025915	Ga0207693_10275383	Ga0207693_102753832	154
47	3300025928	Ga0207700_10172420	Ga0207700_101724201	154
48	3300025929	Ga0207664_10433406	Ga0207664_104334061	154
49	3300026075	Ga0207708_10178259	Ga0207708_101782592	154
50	3300026121	Ga0207683_10020880	Ga0207683_100208805	154
51	3300027671	Ga0209588_1008025	Ga0209588_10080254	154
52	3300035086	Ga0373934_0179526	Ga0373934_0179526_10_474	154
53	3300035172	Ga0373955_0312292	Ga0373955_0312292_59_523	154
54	3300035695	Ga0373927_0216258	Ga0373927_0216258_688_1152	154
55	3300035725	Ga0373947_0129391	Ga0373947_0129391_175_639	154
56	3300041501	Ga0451845_0080493	Ga0451845_0080493_15_479	154
57	3300046462	Ga0495651_0167145	Ga0495651_0167145_311_775	154
58	3300046463	Ga0495653_0006965	Ga0495653_0006965_2078_2542	154
59	3300046473	Ga0495582_0014336	Ga0495582_0014336_2930_3394	154
60	3300046475	Ga0495639_0010529	Ga0495639_0010529_610_1074	154
61	3300046476	Ga0495662_0077436	Ga0495662_0077436_1071_1535	154
62	3300046516	Ga0495628_0157051	Ga0495628_0157051_903_1367	154
63	3300046529	Ga0495652_0266615	Ga0495652_0266615_49_513	154
64	3300046529	Ga0495652_0627134	Ga0495652_0627134_14_478	154
65	3300046531	Ga0495665_0017736	Ga0495665_0017736_758_1222	154
66	3300046543	Ga0495645_0233417	Ga0495645_0233417_172_636	154
67	3300046663	Ga0495635_0105363	Ga0495635_0105363_781_1245	154
68	3300046680	Ga0495646_0181305	Ga0495646_0181305_382_846	154
69	3300046683	Ga0495658_0127377	Ga0495658_0127377_580_1044	154
70	3300046809	Ga0495600_0214685	Ga0495600_0214685_266_730	154
71	3300047315	Ga0495581_0053002	Ga0495581_0053002_1352_1816	154
72	3300047471	Ga0495684_0036824	Ga0495684_0036824_1039_1503	154
73	3300047673	Ga0495593_0064920	Ga0495593_0064920_860_1324	154
74	3300048088	Ga0495602_0242179	Ga0495602_0242179_332_796	154
75	3300048907	Ga0496104_0010117	Ga0496104_0010117_286_750	154
76	3300050511	nmdc:mga08y16_1955174_c1	nmdc:mga08y16_1955174_c1_30_494	154
77	3300050512	nmdc:mga0n895_1040183_c1	nmdc:mga0n895_1040183_c1_37_510	154
78	3300050512	nmdc:mga0n895_31094_c1	nmdc:mga0n895_31094_c1_4434_4904	154
79	3300050512	nmdc:mga0n895_33700_c1	nmdc:mga0n895_33700_c1_1502_1975	154
80	3300050513	nmdc:mga0rr50_467231_c1	nmdc:mga0rr50_467231_c1_36_506	154
81	3300050513	nmdc:mga0rr50_935537_c1	nmdc:mga0rr50_935537_c1_150_620	154
82	3300050514	nmdc:mga08x19_381148_c1	nmdc:mga08x19_381148_c1_364_834	154
83	3300005435	Ga0070714_101081374	Ga0070714_1010813741	155
84	3300005437	Ga0070710_10290815	Ga0070710_102908152	155
85	3300005439	Ga0070711_100838713	Ga0070711_1008387132	155
86	3300005459	Ga0068867_101305175	Ga0068867_1013051751	155
87	3300005535	Ga0070684_101654731	Ga0070684_1016547311	155
88	3300005544	Ga0070686_100301465	Ga0070686_1003014652	155
89	3300005547	Ga0070693_100004095	Ga0070693_1000040953	155
90	3300006028	Ga0070717_10487127	Ga0070717_104871272	155
91	3300009094	Ga0111539_10109919	Ga0111539_101099194	155
92	3300009101	Ga0105247_11018639	Ga0105247_110186391	155
93	3300009174	Ga0105241_10106816	Ga0105241_101068162	155
94	3300009176	Ga0105242_11672427	Ga0105242_116724271	155
95	3300025906	Ga0207699_10552636	Ga0207699_105526361	155
96	3300025939	Ga0207665_10143455	Ga0207665_101434553	155
97	3300026067	Ga0207678_10062184	Ga0207678_100621842	155
98	3300027907	Ga0207428_10034348	Ga0207428_100343485	155
99	3300034817	Ga0373948_0011468	Ga0373948_0011468_999_1466	155
100	3300035084	Ga0373928_0085422	Ga0373928_0085422_105_572	155
101	3300035085	Ga0373929_0026130	Ga0373929_0026130_171_638	155
102	3300035092	Ga0373952_0020657	Ga0373952_0020657_645_1112	155
103	3300035115	Ga0373941_0012206	Ga0373941_0012206_691_1158	155
104	3300035725	Ga0373947_0902728	Ga0373947_0902728_77_544	155
105	3300036401	Ga0373937_0300524	Ga0373937_0300524_771_1238	155
106	3300046454	Ga0495592_0712457	Ga0495592_0712457_118_585	155
107	3300046511	Ga0495608_0575012	Ga0495608_0575012_65_532	155
108	3300046559	Ga0495667_0496113	Ga0495667_0496113_103_570	155
109	3300047322	Ga0495680_0157035	Ga0495680_0157035_959_1426	155
110	3300048907	Ga0496104_0082774	Ga0496104_0082774_1797_2264	155
111	3300048912	Ga0496109_0753670	Ga0496109_0753670_397_864	155
112	3300048913	Ga0496110_0829943	Ga0496110_0829943_115_582	155
113	3300050507	nmdc:mga05p37_71039_c1	nmdc:mga05p37_71039_c1_2728_3213	155
114	3300050511	nmdc:mga08y16_417368_c1	nmdc:mga08y16_417368_c1_272_739	155
115	3300005467	Ga0070706_100753030	Ga0070706_1007530301	156
116	3300007076	Ga0075435_100156468	Ga0075435_1001564682	156
117	3300007788	Ga0099795_10320393	Ga0099795_103203932	156
118	3300010159	Ga0099796_10281064	Ga0099796_102810641	156
119	3300028380	Ga0268265_10869974	Ga0268265_108699742	156
120	3300046476	Ga0495662_0409921	Ga0495662_0409921_122_592	156
121	3300046523	Ga0495644_0125165	Ga0495644_0125165_61_531	156
122	3300046529	Ga0495652_0103593	Ga0495652_0103593_1297_1767	156
123	3300046533	Ga0495640_0086574	Ga0495640_0086574_1407_1877	156
124	3300046536	Ga0495587_0061370	Ga0495587_0061370_901_1371	156
125	3300046559	Ga0495667_0415506	Ga0495667_0415506_220_690	156
126	3300047319	Ga0495674_0176004	Ga0495674_0176004_1186_1656	156
127	3300005366	Ga0070659_100956895	Ga0070659_1009568951	157
128	3300005434	Ga0070709_10155110	Ga0070709_101551102	157
129	3300005468	Ga0070707_100463943	Ga0070707_1004639432	157
130	3300005544	Ga0070686_100054056	Ga0070686_1000540563	157
131	3300005614	Ga0068856_101010656	Ga0068856_1010106562	157
132	3300006028	Ga0070717_10006307	Ga0070717_100063074	157
133	3300006028	Ga0070717_10287037	Ga0070717_102870371	157
134	3300006163	Ga0070715_10000179	Ga0070715_100001794	157
135	3300006173	Ga0070716_100013759	Ga0070716_1000137592	157
136	3300006847	Ga0075431_100594022	Ga0075431_1005940222	157
137	3300006914	Ga0075436_100314330	Ga0075436_1003143302	157
138	3300007265	Ga0099794_10059947	Ga0099794_100599471	157
139	3300009101	Ga0105247_10094773	Ga0105247_100947732	157
140	3300009147	Ga0114129_11201897	Ga0114129_112018972	157
141	3300009147	Ga0114129_11788843	Ga0114129_117888431	157
142	3300009176	Ga0105242_10147236	Ga0105242_101472362	157
143	3300009176	Ga0105242_12906592	Ga0105242_129065921	157
144	3300009545	Ga0105237_11658512	Ga0105237_116585121	157
145	3300009553	Ga0105249_10374094	Ga0105249_103740943	157
146	3300013105	Ga0157369_10485629	Ga0157369_104856292	157
147	3300025905	Ga0207685_10426920	Ga0207685_104269201	157
148	3300025915	Ga0207693_10036074	Ga0207693_100360742	157
149	3300025916	Ga0207663_11034724	Ga0207663_110347242	157
150	3300025929	Ga0207664_10279951	Ga0207664_102799512	157
151	3300025929	Ga0207664_11685362	Ga0207664_116853621	157
152	3300025932	Ga0207690_11342073	Ga0207690_113420731	157
153	3300025934	Ga0207686_10358355	Ga0207686_103583552	157
154	3300025939	Ga0207665_10001482	Ga0207665_100014821	157
155	3300026088	Ga0207641_11553371	Ga0207641_115533712	157
156	3300048903	Ga0496100_1227250	Ga0496100_1227250_103_576	157
157	3300048904	Ga0496101_0361295	Ga0496101_0361295_217_690	157
158	3300048905	Ga0496102_0159673	Ga0496102_0159673_1319_1792	157
159	3300048907	Ga0496104_0628123	Ga0496104_0628123_40_513	157
160	3300048909	Ga0496106_0002735	Ga0496106_0002735_9567_10040	157
161	3300048910	Ga0496107_0046443	Ga0496107_0046443_2523_2996	157
162	3300048911	Ga0496108_0321769	Ga0496108_0321769_424_897	157
163	3300048912	Ga0496109_0675020	Ga0496109_0675020_367_840	157
164	3300048913	Ga0496110_0486998	Ga0496110_0486998_187_660	157
165	3300048914	Ga0496111_0317767	Ga0496111_0317767_55_528	157
166	3300048918	Ga0496115_0128783	Ga0496115_0128783_293_766	157
167	3300050507	nmdc:mga05p37_533329_c1	nmdc:mga05p37_533329_c1_188_661	157
168	3300000044	ARSoilOldRDRAFT_c009410	ARSoilOldRDRAFT_0094102	158
169	3300002077	JGI24744J21845_10001426	JGI24744J21845_100014263	158
170	3300005330	Ga0070690_100038284	Ga0070690_1000382843	158
171	3300005334	Ga0068869_100650003	Ga0068869_1006500032	158
172	3300005336	Ga0070680_100188849	Ga0070680_1001888492	158
173	3300005337	Ga0070682_100001835	Ga0070682_1000018359	158
174	3300005337	Ga0070682_100019352	Ga0070682_1000193523	158
175	3300005338	Ga0068868_100139590	Ga0068868_1001395903	158
176	3300005338	Ga0068868_100475240	Ga0068868_1004752402	158
177	3300005339	Ga0070660_100020344	Ga0070660_1000203446	158
178	3300005340	Ga0070689_100004021	Ga0070689_1000040219	158
179	3300005341	Ga0070691_10072744	Ga0070691_100727443	158
180	3300005343	Ga0070687_100034769	Ga0070687_1000347694	158
181	3300005343	Ga0070687_100049929	Ga0070687_1000499292	158
182	3300005345	Ga0070692_10006604	Ga0070692_100066046	158
183	3300005345	Ga0070692_10063868	Ga0070692_100638683	158
184	3300005347	Ga0070668_100032465	Ga0070668_1000324654	158
185	3300005355	Ga0070671_100069649	Ga0070671_1000696494	158
186	3300005355	Ga0070671_100088299	Ga0070671_1000882993	158
187	3300005356	Ga0070674_100025410	Ga0070674_1000254105	158
188	3300005356	Ga0070674_100169276	Ga0070674_1001692762	158
189	3300005356	Ga0070674_101402175	Ga0070674_1014021751	158
190	3300005364	Ga0070673_100293255	Ga0070673_1002932552	158
191	3300005365	Ga0070688_100224839	Ga0070688_1002248393	158
192	3300005365	Ga0070688_100616650	Ga0070688_1006166501	158
193	3300005366	Ga0070659_100114637	Ga0070659_1001146372	158
194	3300005367	Ga0070667_101031117	Ga0070667_1010311171	158
195	3300005406	Ga0070703_10026592	Ga0070703_100265921	158
196	3300005434	Ga0070709_10015839	Ga0070709_100158394	158
197	3300005435	Ga0070714_100386162	Ga0070714_1003861623	158
198	3300005435	Ga0070714_100781970	Ga0070714_1007819701	158
199	3300005437	Ga0070710_10001144	Ga0070710_1000114414	158
200	3300005437	Ga0070710_10063351	Ga0070710_100633513	158
201	3300005437	Ga0070710_10202942	Ga0070710_102029422	158
202	3300005438	Ga0070701_10001579	Ga0070701_100015799	158
203	3300005439	Ga0070711_100005621	Ga0070711_1000056215	158
204	3300005439	Ga0070711_100035740	Ga0070711_1000357402	158
205	3300005439	Ga0070711_100041236	Ga0070711_1000412363	158
206	3300005439	Ga0070711_100118178	Ga0070711_1001181782	158
207	3300005439	Ga0070711_100833661	Ga0070711_1008336611	158
208	3300005440	Ga0070705_100001791	Ga0070705_10000179111	158
209	3300005441	Ga0070700_100000342	Ga0070700_1000003428	158
210	3300005444	Ga0070694_100018481	Ga0070694_1000184816	158
211	3300005444	Ga0070694_100254153	Ga0070694_1002541533	158
212	3300005455	Ga0070663_100277552	Ga0070663_1002775523	158
213	3300005455	Ga0070663_100330109	Ga0070663_1003301091	158
214	3300005456	Ga0070678_100000759	Ga0070678_1000007599	158
215	3300005456	Ga0070678_100264597	Ga0070678_1002645971	158
216	3300005457	Ga0070662_100044925	Ga0070662_1000449254	158
217	3300005457	Ga0070662_100115655	Ga0070662_1001156552	158
218	3300005457	Ga0070662_101252437	Ga0070662_1012524371	158
219	3300005458	Ga0070681_10997847	Ga0070681_109978471	158
220	3300005459	Ga0068867_100001070	Ga0068867_10000107015	158
221	3300005459	Ga0068867_100051615	Ga0068867_1000516152	158
222	3300005466	Ga0070685_10003155	Ga0070685_100031553	158
223	3300005467	Ga0070706_100113643	Ga0070706_1001136433	158
224	3300005467	Ga0070706_100458232	Ga0070706_1004582323	158
225	3300005468	Ga0070707_100002302	Ga0070707_10000230217	158
226	3300005468	Ga0070707_100022260	Ga0070707_1000222605	158
227	3300005468	Ga0070707_101128581	Ga0070707_1011285811	158
228	3300005471	Ga0070698_100028283	Ga0070698_1000282835	158
229	3300005471	Ga0070698_100036991	Ga0070698_1000369915	158
230	3300005471	Ga0070698_100117291	Ga0070698_1001172913	158
231	3300005471	Ga0070698_100140806	Ga0070698_1001408063	158
232	3300005518	Ga0070699_100009838	Ga0070699_1000098384	158
233	3300005518	Ga0070699_100508570	Ga0070699_1005085702	158
234	3300005539	Ga0068853_100000987	Ga0068853_10000098728	158
235	3300005539	Ga0068853_100034836	Ga0068853_1000348364	158
236	3300005543	Ga0070672_100118868	Ga0070672_1001188683	158
237	3300005544	Ga0070686_100009806	Ga0070686_1000098065	158
238	3300005545	Ga0070695_100211121	Ga0070695_1002111212	158
239	3300005545	Ga0070695_100272655	Ga0070695_1002726552	158
240	3300005546	Ga0070696_100011752	Ga0070696_1000117528	158
241	3300005546	Ga0070696_100039834	Ga0070696_1000398343	158
242	3300005547	Ga0070693_100007143	Ga0070693_1000071438	158
243	3300005547	Ga0070693_100125793	Ga0070693_1001257932	158
244	3300005547	Ga0070693_100736405	Ga0070693_1007364052	158
245	3300005548	Ga0070665_100222559	Ga0070665_1002225592	158
246	3300005549	Ga0070704_100000610	Ga0070704_10000061010	158
247	3300005549	Ga0070704_100577315	Ga0070704_1005773152	158
248	3300005563	Ga0068855_100923964	Ga0068855_1009239641	158
249	3300005578	Ga0068854_100079098	Ga0068854_1000790987	158
250	3300005614	Ga0068856_100006917	Ga0068856_10000691710	158
251	3300005614	Ga0068856_100052728	Ga0068856_1000527283	158
252	3300005615	Ga0070702_100004650	Ga0070702_1000046506	158
253	3300005615	Ga0070702_100042200	Ga0070702_1000422006	158
254	3300005616	Ga0068852_100049669	Ga0068852_1000496695	158
255	3300005617	Ga0068859_100056662	Ga0068859_1000566625	158
256	3300005618	Ga0068864_100677811	Ga0068864_1006778111	158
257	3300005718	Ga0068866_10000765	Ga0068866_100007655	158
258	3300005719	Ga0068861_100003826	Ga0068861_10000382611	158
259	3300005834	Ga0068851_10190132	Ga0068851_101901322	158
260	3300005841	Ga0068863_100787904	Ga0068863_1007879042	158
261	3300005842	Ga0068858_100248583	Ga0068858_1002485832	158
262	3300005842	Ga0068858_100296438	Ga0068858_1002964382	158
263	3300005843	Ga0068860_100198671	Ga0068860_1001986714	158
264	3300005844	Ga0068862_100034200	Ga0068862_1000342005	158
265	3300005844	Ga0068862_100050851	Ga0068862_1000508517	158
266	3300005981	Ga0081538_10016564	Ga0081538_100165644	158
267	3300005981	Ga0081538_10045765	Ga0081538_100457653	158
268	3300006028	Ga0070717_10395386	Ga0070717_103953862	158
269	3300006058	Ga0075432_10006101	Ga0075432_100061015	158
270	3300006058	Ga0075432_10047893	Ga0075432_100478932	158
271	3300006163	Ga0070715_10339379	Ga0070715_103393791	158
272	3300006173	Ga0070716_100024596	Ga0070716_1000245965	158
273	3300006173	Ga0070716_100054203	Ga0070716_1000542032	158
274	3300006173	Ga0070716_100255654	Ga0070716_1002556543	158
275	3300006173	Ga0070716_101206036	Ga0070716_1012060361	158
276	3300006175	Ga0070712_100031039	Ga0070712_1000310394	158
277	3300006175	Ga0070712_100033519	Ga0070712_1000335192	158
278	3300006175	Ga0070712_100220619	Ga0070712_1002206192	158
279	3300006175	Ga0070712_100655790	Ga0070712_1006557902	158
280	3300006237	Ga0097621_100127003	Ga0097621_1001270033	158
281	3300006358	Ga0068871_100003338	Ga0068871_10000333813	158
282	3300006358	Ga0068871_100285830	Ga0068871_1002858301	158
283	3300006844	Ga0075428_100146044	Ga0075428_1001460442	158
284	3300006852	Ga0075433_10057416	Ga0075433_100574162	158
285	3300006852	Ga0075433_11272004	Ga0075433_112720041	158
286	3300006871	Ga0075434_100004052	Ga0075434_1000040523	158
287	3300006871	Ga0075434_100078666	Ga0075434_1000786663	158
288	3300006871	Ga0075434_100110664	Ga0075434_1001106643	158
289	3300006871	Ga0075434_100204309	Ga0075434_1002043091	158
290	3300006881	Ga0068865_100000326	Ga0068865_10000032615	158
291	3300006881	Ga0068865_100613392	Ga0068865_1006133922	158
292	3300006914	Ga0075436_100029719	Ga0075436_1000297193	158
293	3300006931	Ga0097620_100056662	Ga0097620_1000566625	158
294	3300007076	Ga0075435_100046617	Ga0075435_1000466172	158
295	3300007076	Ga0075435_100061630	Ga0075435_1000616302	158
296	3300007076	Ga0075435_100069764	Ga0075435_1000697643	158
297	3300009094	Ga0111539_10593948	Ga0111539_105939483	158
298	3300009098	Ga0105245_10003888	Ga0105245_100038883	158
299	3300009098	Ga0105245_10118795	Ga0105245_101187952	158
300	3300009098	Ga0105245_10182441	Ga0105245_101824413	158
301	3300009098	Ga0105245_10216947	Ga0105245_102169471	158
302	3300009098	Ga0105245_11053219	Ga0105245_110532191	158
303	3300009101	Ga0105247_10074297	Ga0105247_100742973	158
304	3300009101	Ga0105247_10114037	Ga0105247_101140372	158
305	3300009147	Ga0114129_10270189	Ga0114129_102701891	158
306	3300009147	Ga0114129_10617074	Ga0114129_106170742	158
307	3300009147	Ga0114129_10762730	Ga0114129_107627303	158
308	3300009148	Ga0105243_10001953	Ga0105243_1000195314	158
309	3300009148	Ga0105243_10337967	Ga0105243_103379672	158
310	3300009148	Ga0105243_10524329	Ga0105243_105243291	158
311	3300009148	Ga0105243_10861415	Ga0105243_108614151	158
312	3300009174	Ga0105241_10022312	Ga0105241_100223123	158
313	3300009174	Ga0105241_10073206	Ga0105241_100732063	158
314	3300009174	Ga0105241_10500493	Ga0105241_105004932	158
315	3300009174	Ga0105241_11228449	Ga0105241_112284491	158
316	3300009176	Ga0105242_10000495	Ga0105242_1000049518	158
317	3300009176	Ga0105242_10046200	Ga0105242_100462002	158
318	3300009176	Ga0105242_10172950	Ga0105242_101729502	158
319	3300009176	Ga0105242_10174370	Ga0105242_101743703	158
320	3300009177	Ga0105248_10021759	Ga0105248_100217599	158
321	3300009177	Ga0105248_10054163	Ga0105248_100541634	158
322	3300009545	Ga0105237_10291423	Ga0105237_102914233	158
323	3300009551	Ga0105238_10980129	Ga0105238_109801291	158
324	3300009551	Ga0105238_11543232	Ga0105238_115432321	158
325	3300009551	Ga0105238_11922561	Ga0105238_119225611	158
326	3300009553	Ga0105249_10000837	Ga0105249_1000083716	158
327	3300009553	Ga0105249_10152446	Ga0105249_101524463	158
328	3300009553	Ga0105249_10704265	Ga0105249_107042652	158
329	3300010375	Ga0105239_10002075	Ga0105239_1000207517	158
330	3300010375	Ga0105239_10260879	Ga0105239_102608793	158
331	3300010375	Ga0105239_10381486	Ga0105239_103814862	158
332	3300010375	Ga0105239_10404433	Ga0105239_104044333	158
333	3300011119	Ga0105246_10136249	Ga0105246_101362492	158
334	3300013102	Ga0157371_10237574	Ga0157371_102375743	158
335	3300013105	Ga0157369_10189828	Ga0157369_101898285	158
336	3300013296	Ga0157374_10003121	Ga0157374_100031214	158
337	3300013296	Ga0157374_10074521	Ga0157374_100745213	158
338	3300013296	Ga0157374_10437821	Ga0157374_104378212	158
339	3300013296	Ga0157374_10554621	Ga0157374_105546212	158
340	3300013297	Ga0157378_10000828	Ga0157378_1000082822	158
341	3300013306	Ga0163162_10002301	Ga0163162_100023016	158
342	3300013306	Ga0163162_10494806	Ga0163162_104948063	158
343	3300013306	Ga0163162_10515393	Ga0163162_105153932	158
344	3300013306	Ga0163162_11470375	Ga0163162_114703751	158
345	3300013306	Ga0163162_12460241	Ga0163162_124602411	158
346	3300013307	Ga0157372_10722870	Ga0157372_107228702	158
347	3300013307	Ga0157372_10783788	Ga0157372_107837882	158
348	3300013308	Ga0157375_10045817	Ga0157375_100458176	158
349	3300013308	Ga0157375_10055250	Ga0157375_100552503	158
350	3300014326	Ga0157380_10056034	Ga0157380_100560343	158
351	3300014326	Ga0157380_10751354	Ga0157380_107513542	158
352	3300014745	Ga0157377_10041014	Ga0157377_100410142	158
353	3300014745	Ga0157377_10411003	Ga0157377_104110031	158
354	3300014969	Ga0157376_10013513	Ga0157376_100135139	158
355	3300014969	Ga0157376_10290155	Ga0157376_102901553	158
356	3300014969	Ga0157376_12606252	Ga0157376_126062521	158
357	3300017792	Ga0163161_10625960	Ga0163161_106259602	158
358	3300025898	Ga0207692_10025389	Ga0207692_100253893	158
359	3300025898	Ga0207692_10036918	Ga0207692_100369183	158
360	3300025898	Ga0207692_10199661	Ga0207692_101996611	158
361	3300025898	Ga0207692_10425133	Ga0207692_104251331	158
362	3300025899	Ga0207642_10000153	Ga0207642_100001539	158
363	3300025900	Ga0207710_10051015	Ga0207710_100510152	158
364	3300025900	Ga0207710_10192736	Ga0207710_101927362	158
365	3300025901	Ga0207688_10087963	Ga0207688_100879632	158
366	3300025901	Ga0207688_10131562	Ga0207688_101315622	158
367	3300025904	Ga0207647_10116923	Ga0207647_101169233	158
368	3300025905	Ga0207685_10043552	Ga0207685_100435522	158
369	3300025906	Ga0207699_10068495	Ga0207699_100684954	158
370	3300025906	Ga0207699_10125491	Ga0207699_101254913	158
371	3300025906	Ga0207699_10565885	Ga0207699_105658851	158
372	3300025906	Ga0207699_10853474	Ga0207699_108534741	158
373	3300025910	Ga0207684_10120260	Ga0207684_101202604	158
374	3300025910	Ga0207684_10407197	Ga0207684_104071972	158
375	3300025910	Ga0207684_11032512	Ga0207684_110325121	158
376	3300025911	Ga0207654_10009385	Ga0207654_100093853	158
377	3300025911	Ga0207654_10221325	Ga0207654_102213251	158
378	3300025911	Ga0207654_10575709	Ga0207654_105757092	158
379	3300025914	Ga0207671_10742615	Ga0207671_107426152	158
380	3300025915	Ga0207693_10000306	Ga0207693_1000030630	158
381	3300025915	Ga0207693_10154861	Ga0207693_101548612	158
382	3300025915	Ga0207693_10174099	Ga0207693_101740992	158
383	3300025915	Ga0207693_10213162	Ga0207693_102131622	158
384	3300025915	Ga0207693_10387579	Ga0207693_103875792	158
385	3300025915	Ga0207693_10674141	Ga0207693_106741412	158
386	3300025916	Ga0207663_10015500	Ga0207663_100155004	158
387	3300025916	Ga0207663_10037374	Ga0207663_100373742	158
388	3300025916	Ga0207663_10093367	Ga0207663_100933672	158
389	3300025916	Ga0207663_10099793	Ga0207663_100997932	158
390	3300025917	Ga0207660_10006571	Ga0207660_100065717	158
391	3300025918	Ga0207662_10070522	Ga0207662_100705223	158
392	3300025919	Ga0207657_10006514	Ga0207657_100065147	158
393	3300025922	Ga0207646_10003334	Ga0207646_100033345	158
394	3300025922	Ga0207646_10268637	Ga0207646_102686373	158
395	3300025922	Ga0207646_10342958	Ga0207646_103429582	158
396	3300025922	Ga0207646_10513299	Ga0207646_105132992	158
397	3300025922	Ga0207646_10808155	Ga0207646_108081551	158
398	3300025927	Ga0207687_10003080	Ga0207687_100030806	158
399	3300025927	Ga0207687_10159539	Ga0207687_101595392	158
400	3300025927	Ga0207687_11113404	Ga0207687_111134041	158
401	3300025929	Ga0207664_10139143	Ga0207664_101391431	158
402	3300025931	Ga0207644_10025532	Ga0207644_100255326	158
403	3300025931	Ga0207644_10175682	Ga0207644_101756822	158
404	3300025933	Ga0207706_10016170	Ga0207706_100161705	158
405	3300025933	Ga0207706_10140158	Ga0207706_101401582	158
406	3300025933	Ga0207706_10295194	Ga0207706_102951941	158
407	3300025934	Ga0207686_10001410	Ga0207686_100014101	158
408	3300025934	Ga0207686_10018277	Ga0207686_100182775	158
409	3300025934	Ga0207686_10275694	Ga0207686_102756941	158
410	3300025935	Ga0207709_10001113	Ga0207709_100011133	158
411	3300025935	Ga0207709_10425715	Ga0207709_104257152	158
412	3300025935	Ga0207709_10683874	Ga0207709_106838741	158
413	3300025936	Ga0207670_10536256	Ga0207670_105362562	158
414	3300025937	Ga0207669_10022203	Ga0207669_100222034	158
415	3300025937	Ga0207669_10369903	Ga0207669_103699033	158
416	3300025938	Ga0207704_10004452	Ga0207704_100044526	158
417	3300025939	Ga0207665_10050348	Ga0207665_100503482	158
418	3300025939	Ga0207665_10224389	Ga0207665_102243893	158
419	3300025940	Ga0207691_10043721	Ga0207691_100437212	158
420	3300025940	Ga0207691_10234919	Ga0207691_102349192	158
421	3300025941	Ga0207711_10051731	Ga0207711_100517313	158
422	3300025941	Ga0207711_10092484	Ga0207711_100924842	158
423	3300025942	Ga0207689_10544876	Ga0207689_105448762	158
424	3300025949	Ga0207667_10212330	Ga0207667_102123302	158
425	3300025949	Ga0207667_10805128	Ga0207667_108051281	158
426	3300025961	Ga0207712_10001481	Ga0207712_100014817	158
427	3300025961	Ga0207712_10306571	Ga0207712_103065712	158
428	3300025961	Ga0207712_11254145	Ga0207712_112541451	158
429	3300025972	Ga0207668_10098846	Ga0207668_100988464	158
430	3300025972	Ga0207668_10439780	Ga0207668_104397803	158
431	3300025981	Ga0207640_10315103	Ga0207640_103151032	158
432	3300025986	Ga0207658_10487013	Ga0207658_104870132	158
433	3300026023	Ga0207677_10051568	Ga0207677_100515683	158
434	3300026023	Ga0207677_10230015	Ga0207677_102300152	158
435	3300026035	Ga0207703_10078051	Ga0207703_100780514	158
436	3300026041	Ga0207639_10005997	Ga0207639_100059972	158
437	3300026067	Ga0207678_10026508	Ga0207678_100265084	158
438	3300026075	Ga0207708_10001074	Ga0207708_1000107420	158
439	3300026075	Ga0207708_10008318	Ga0207708_100083187	158
440	3300026075	Ga0207708_10274228	Ga0207708_102742282	158
441	3300026078	Ga0207702_10003359	Ga0207702_1000335920	158
442	3300026078	Ga0207702_10129646	Ga0207702_101296462	158
443	3300026088	Ga0207641_10739628	Ga0207641_107396282	158
444	3300026089	Ga0207648_10000413	Ga0207648_1000041332	158
445	3300026089	Ga0207648_10010123	Ga0207648_100101234	158
446	3300026089	Ga0207648_10956700	Ga0207648_109567001	158
447	3300026118	Ga0207675_100160222	Ga0207675_1001602222	158
448	3300026121	Ga0207683_10000358	Ga0207683_1000035823	158
449	3300026121	Ga0207683_11252625	Ga0207683_112526252	158
450	3300026142	Ga0207698_10046805	Ga0207698_100468053	158
451	3300026142	Ga0207698_11378075	Ga0207698_113780751	158
452	3300027907	Ga0207428_10031536	Ga0207428_100315361	158
453	3300027907	Ga0207428_10800148	Ga0207428_108001481	158
454	3300028379	Ga0268266_10182166	Ga0268266_101821662	158
455	3300028381	Ga0268264_10167196	Ga0268264_101671964	158
456	3300035091	Ga0373951_0037252	Ga0373951_0037252_65_541	158
457	3300035691	Ga0373931_0094208	Ga0373931_0094208_1104_1580	158
458	3300046459	Ga0495629_0121314	Ga0495629_0121314_114_590	158
459	3300046500	Ga0495596_0070616	Ga0495596_0070616_294_770	158
460	3300046520	Ga0495637_0055987	Ga0495637_0055987_724_1200	158
461	3300046536	Ga0495587_0474548	Ga0495587_0474548_193_669	158
462	3300046538	Ga0495609_0123366	Ga0495609_0123366_447_923	158
463	3300046542	Ga0495597_0088861	Ga0495597_0088861_87_563	158
464	3300046615	Ga0495656_0147874	Ga0495656_0147874_425_901	158
465	3300046615	Ga0495656_0214717	Ga0495656_0214717_10_486	158
466	3300046648	Ga0495611_0257809	Ga0495611_0257809_77_553	158
467	3300046664	Ga0495659_0214252	Ga0495659_0214252_46_522	158
468	3300046794	Ga0495589_0145145	Ga0495589_0145145_285_761	158
469	3300047445	Ga0495677_0217470	Ga0495677_0217470_57_533	158
470	3300047445	Ga0495677_0245201	Ga0495677_0245201_51_527	158
471	3300048903	Ga0496100_0013274	Ga0496100_0013274_2359_2835	158
472	3300048903	Ga0496100_0029831	Ga0496100_0029831_1912_2394	158
473	3300048903	Ga0496100_0519370	Ga0496100_0519370_12_488	158
474	3300048903	Ga0496100_0683973	Ga0496100_0683973_257_733	158
475	3300048904	Ga0496101_0001420	Ga0496101_0001420_556_1032	158
476	3300048904	Ga0496101_0015169	Ga0496101_0015169_2950_3426	158
477	3300048904	Ga0496101_0025072	Ga0496101_0025072_3468_3950	158
478	3300048904	Ga0496101_0046854	Ga0496101_0046854_924_1400	158
479	3300048904	Ga0496101_0289911	Ga0496101_0289911_202_678	158
480	3300048904	Ga0496101_0366808	Ga0496101_0366808_629_1105	158
481	3300048904	Ga0496101_0914727	Ga0496101_0914727_140_616	158
482	3300048905	Ga0496102_0004676	Ga0496102_0004676_9826_10302	158
483	3300048905	Ga0496102_0006369	Ga0496102_0006369_3290_3766	158
484	3300048905	Ga0496102_0016097	Ga0496102_0016097_3726_4202	158
485	3300048905	Ga0496102_0600756	Ga0496102_0600756_50_535	158
486	3300048905	Ga0496102_0861338	Ga0496102_0861338_115_591	158
487	3300048905	Ga0496102_1304302	Ga0496102_1304302_132_608	158
488	3300048906	Ga0496103_0005115	Ga0496103_0005115_1634_2110	158
489	3300048906	Ga0496103_0132938	Ga0496103_0132938_922_1404	158
490	3300048907	Ga0496104_0035818	Ga0496104_0035818_3675_4151	158
491	3300048907	Ga0496104_0091343	Ga0496104_0091343_1478_1954	158
492	3300048907	Ga0496104_0397493	Ga0496104_0397493_575_1051	158
493	3300048908	Ga0496105_0063142	Ga0496105_0063142_1947_2423	158
494	3300048908	Ga0496105_0090659	Ga0496105_0090659_588_1064	158
495	3300048908	Ga0496105_0812945	Ga0496105_0812945_41_517	158
496	3300048909	Ga0496106_0001151	Ga0496106_0001151_12909_13385	158
497	3300048909	Ga0496106_0048442	Ga0496106_0048442_1003_1479	158
498	3300048909	Ga0496106_0120090	Ga0496106_0120090_1146_1622	158
499	3300048909	Ga0496106_0199209	Ga0496106_0199209_1029_1511	158
500	3300048909	Ga0496106_0791987	Ga0496106_0791987_115_591	158
501	3300048910	Ga0496107_0000610	Ga0496107_0000610_12205_12681	158
502	3300048910	Ga0496107_0010022	Ga0496107_0010022_947_1423	158
503	3300048910	Ga0496107_0017553	Ga0496107_0017553_3135_3611	158
504	3300048910	Ga0496107_0105113	Ga0496107_0105113_633_1115	158
505	3300048911	Ga0496108_0106424	Ga0496108_0106424_1737_2213	158
506	3300048911	Ga0496108_0155478	Ga0496108_0155478_722_1198	158
507	3300048912	Ga0496109_0011946	Ga0496109_0011946_5285_5761	158
508	3300048912	Ga0496109_0030303	Ga0496109_0030303_1553_2029	158
509	3300048912	Ga0496109_0098665	Ga0496109_0098665_1245_1721	158
510	3300048913	Ga0496110_0211789	Ga0496110_0211789_510_986	158
511	3300048913	Ga0496110_0388555	Ga0496110_0388555_532_1008	158
512	3300048913	Ga0496110_0726099	Ga0496110_0726099_403_879	158
513	3300048914	Ga0496111_0063553	Ga0496111_0063553_58_534	158
514	3300048914	Ga0496111_0212729	Ga0496111_0212729_678_1163	158
515	3300048914	Ga0496111_0400657	Ga0496111_0400657_483_959	158
516	3300048915	Ga0496112_0057808	Ga0496112_0057808_2759_3235	158
517	3300048915	Ga0496112_0173553	Ga0496112_0173553_541_1026	158
518	3300048915	Ga0496112_0259939	Ga0496112_0259939_741_1226	158
519	3300048915	Ga0496112_0891765	Ga0496112_0891765_308_784	158
520	3300048916	Ga0496113_0038437	Ga0496113_0038437_2990_3475	158
521	3300048916	Ga0496113_0597612	Ga0496113_0597612_28_504	158
522	3300048917	Ga0496114_0000863	Ga0496114_0000863_11961_12437	158
523	3300048917	Ga0496114_0016000	Ga0496114_0016000_2288_2770	158
524	3300048917	Ga0496114_0121299	Ga0496114_0121299_161_637	158
525	3300048917	Ga0496114_0142070	Ga0496114_0142070_1581_2057	158
526	3300048917	Ga0496114_0334346	Ga0496114_0334346_371_847	158
527	3300048917	Ga0496114_0378211	Ga0496114_0378211_391_945	158
528	3300048917	Ga0496114_0561961	Ga0496114_0561961_444_920	158
529	3300048918	Ga0496115_0001547	Ga0496115_0001547_1256_1732	158
530	3300048918	Ga0496115_0003634	Ga0496115_0003634_683_1159	158
531	3300048918	Ga0496115_0030633	Ga0496115_0030633_1210_1686	158
532	3300048918	Ga0496115_0156649	Ga0496115_0156649_761_1243	158
533	3300048918	Ga0496115_0251536	Ga0496115_0251536_904_1380	158
534	3300048918	Ga0496115_0312452	Ga0496115_0312452_306_791	158
535	3300048918	Ga0496115_0480954	Ga0496115_0480954_476_952	158
536	3300050511	nmdc:mga08y16_1010666_c1	nmdc:mga08y16_1010666_c1_18_494	158
537	3300050511	nmdc:mga08y16_1400645_c1	nmdc:mga08y16_1400645_c1_57_533	158
538	3300050511	nmdc:mga08y16_28716_c1	nmdc:mga08y16_28716_c1_5085_5561	158
539	3300050512	nmdc:mga0n895_135033_c1	nmdc:mga0n895_135033_c1_1858_2334	158
540	3300050512	nmdc:mga0n895_287940_c1	nmdc:mga0n895_287940_c1_889_1365	158
541	3300050512	nmdc:mga0n895_352_c1	nmdc:mga0n895_352_c1_18710_19186	158
542	3300050512	nmdc:mga0n895_42399_c1	nmdc:mga0n895_42399_c1_2964_3440	158
543	3300050512	nmdc:mga0n895_44862_c1	nmdc:mga0n895_44862_c1_2128_2604	158
544	3300050513	nmdc:mga0rr50_1676_c1	nmdc:mga0rr50_1676_c1_10544_11020	158
545	3300050513	nmdc:mga0rr50_362395_c1	nmdc:mga0rr50_362395_c1_550_1026	158
546	3300050513	nmdc:mga0rr50_5969_c1	nmdc:mga0rr50_5969_c1_1573_2049	158
547	3300050513	nmdc:mga0rr50_60971_c1	nmdc:mga0rr50_60971_c1_2038_2514	158
548	3300050514	nmdc:mga08x19_138969_c1	nmdc:mga08x19_138969_c1_456_932	158
549	3300050514	nmdc:mga08x19_2908_c1	nmdc:mga08x19_2908_c1_3847_4323	158
550	3300050514	nmdc:mga08x19_987640_c1	nmdc:mga08x19_987640_c1_88_564	158
551	3300050515	nmdc:mga0a205_1457942_c1	nmdc:mga0a205_1457942_c1_10_486	158
552	3300050515	nmdc:mga0a205_173450_c1	nmdc:mga0a205_173450_c1_1468_1944	158
553	3300050515	nmdc:mga0a205_244515_c1	nmdc:mga0a205_244515_c1_1047_1523	158
554	3300053083	Ga0495655_0030885	Ga0495655_0030885_352_828	158
555	3300053084	Ga0495595_0087614	Ga0495595_0087614_278_754	158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

10

142

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ef8-assembly1.cif.gz_A	crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution	0.866	7	148
3a76-assembly1.cif.gz_A	the crystal structure of lina	0.8509	12	147
1ask-assembly1.cif.gz_B	nuclear transport factor 2 (ntf2) h66a mutant	0.8502	14	146
1ar0-assembly1.cif.gz_B	nuclear transport factor 2 (ntf2) e42k mutant	0.8456	14	146
5kvb-assembly1.cif.gz_A	the crystal structure of hexachlorocyclohexane dehydrochlorinase lina-type3 from novosphingobium barchaimii ll02	0.8449	12	150

ID	Description	Score	Start	End	Superfamily
af_O07237_11_153_3.10.450.50	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8678	12	156	3.10.450.50
4lehA00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8542	14	151	3.10.450.50
2chcB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8539	13	145	3.10.450.50
2r4iB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8516	14	144	3.10.450.50
3a76A01	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8509	12	147	3.10.450.50

ID	Description	Score	Start	End
AF-A0A191TPE1-F1-model_v4	SnoaL-like domain-containing protein	0.9441	13	154
AF-A0A171ANQ8-F1-model_v4	SnoaL-like domain-containing protein	0.944	10	153
AF-A0A7R7EL60-F1-model_v4	SnoaL-like domain-containing protein	0.9422	7	154
AF-A0A1I0S4B8-F1-model_v4	SnoaL-like domain-containing protein	0.9419	10	150
AF-A0A7R7EL60-F1-model_v4	SnoaL-like domain-containing protein	0.9361	7	154

Feature Viewer

pLDDT	pTM	Quality
92.27	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F463075

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13577

SnoaL_4

SnoaL-like domain

10

142

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map