F461920
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 545 | 250 | 541 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300049824|Ga0501045_0359951|Ga0501045_0359951_113_970 |
| Length | 285 |
| Sequence | MKRFRPSSTASTWARIERSARRADFRQPIAHARIFAMSGHSKWHSIKHKKAAIDAKRGKAFTQIIKEITVAARSGGGDPNFNPRLRLAVDKAKAENMPKDNIERAIKKGTGELEGFNLEEVNYEGYGPGGVAVFMQATTDNRNRTVGEVRHLFAKYGGNLGESGSVGWMFDKKGYIVIERKNASEETLLEIVLEAGGEDVKEDGSNWEIYTAPEAFQAVRDALKSKGIAIAAEEVGMIPQTSVKLEGKQAQQMLKLMEALEEHDDVTHVWANFDIEEKEIEAAIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 2 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 3 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 4 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 163 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 167 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 172 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 176 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 179 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 180 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 231 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 246 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 247 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 248 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0.18 |
| Rhizoplane | 0.37 |
| Rhizosphere | 98.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055524_1000302 | 3300003775 | Bacteria | 47410 |
| 2 | Ga0065714_10208562 | 3300005288 | Bacteria | 873 |
| 3 | Ga0065704_10112734 | 3300005289 | Bacteria | 1928 |
| 4 | Ga0065704_10119522 | 3300005289 | Bacteria | 1773 |
| 5 | Ga0065704_10137363 | 3300005289 | Unclassified | 1556 |
| 6 | Ga0065712_10162156 | 3300005290 | Bacteria | 1295 |
| 7 | Ga0065715_10151376 | 3300005293 | Bacteria | 1725 |
| 8 | Ga0065715_10190051 | 3300005293 | Bacteria | 1421 |
| 9 | Ga0065707_10001479 | 3300005295 | Bacteria | 9195 |
| 10 | Ga0065707_10307627 | 3300005295 | Bacteria | 987 |
| 11 | Ga0070676_10103756 | 3300005328 | Bacteria | 1761 |
| 12 | Ga0070683_100042467 | 3300005329 | Bacteria | 4186 |
| 13 | Ga0070690_100309756 | 3300005330 | Bacteria | 1135 |
| 14 | Ga0070670_100005693 | 3300005331 | Bacteria | 10524 |
| 15 | Ga0070670_100126508 | 3300005331 | Bacteria | 2206 |
| 16 | Ga0070670_100365220 | 3300005331 | Bacteria | 1270 |
| 17 | Ga0068869_100070110 | 3300005334 | Bacteria | 2593 |
| 18 | Ga0070680_100123763 | 3300005336 | Bacteria | 2160 |
| 19 | Ga0070680_100144026 | 3300005336 | Bacteria | 1999 |
| 20 | Ga0070680_100540020 | 3300005336 | Bacteria | 999 |
| 21 | Ga0070660_100010099 | 3300005339 | Bacteria | 6661 |
| 22 | Ga0070689_100004883 | 3300005340 | Bacteria | 9101 |
| 23 | Ga0070687_100170020 | 3300005343 | Bacteria | 1296 |
| 24 | Ga0070687_100186966 | 3300005343 | Bacteria | 1245 |
| 25 | Ga0070692_10001349 | 3300005345 | Bacteria | 8852 |
| 26 | Ga0070692_10036489 | 3300005345 | Bacteria | 2495 |
| 27 | Ga0070669_100002591 | 3300005353 | Bacteria | 13067 |
| 28 | Ga0070669_100070667 | 3300005353 | Bacteria | 2581 |
| 29 | Ga0070675_100000239 | 3300005354 | Bacteria | 35505 |
| 30 | Ga0070675_100000675 | 3300005354 | Bacteria | 23691 |
| 31 | Ga0070675_100001024 | 3300005354 | Bacteria | 20115 |
| 32 | Ga0070675_100002487 | 3300005354 | Bacteria | 13793 |
| 33 | Ga0070675_100050508 | 3300005354 | Bacteria | 3414 |
| 34 | Ga0070675_100083543 | 3300005354 | Unclassified | 2666 |
| 35 | Ga0070675_100383897 | 3300005354 | Bacteria | 1251 |
| 36 | Ga0070671_100005201 | 3300005355 | Bacteria | 10367 |
| 37 | Ga0070674_100412587 | 3300005356 | Bacteria | 1106 |
| 38 | Ga0070673_100011449 | 3300005364 | Bacteria | 6052 |
| 39 | Ga0070673_100064027 | 3300005364 | Bacteria | 2928 |
| 40 | Ga0070688_100009725 | 3300005365 | Bacteria | 5277 |
| 41 | Ga0070688_100066611 | 3300005365 | Bacteria | 2292 |
| 42 | Ga0070688_100090717 | 3300005365 | Bacteria | 1996 |
| 43 | Ga0070659_100270201 | 3300005366 | Bacteria | 1412 |
| 44 | Ga0070667_100001499 | 3300005367 | Bacteria | 20904 |
| 45 | Ga0070703_10000223 | 3300005406 | Bacteria | 27460 |
| 46 | Ga0070703_10045385 | 3300005406 | Bacteria | 1386 |
| 47 | Ga0070709_10000019 | 3300005434 | Bacteria | 142246 |
| 48 | Ga0070713_100026018 | 3300005436 | Bacteria | 4587 |
| 49 | Ga0070701_10043244 | 3300005438 | Bacteria | 2303 |
| 50 | Ga0070701_10052380 | 3300005438 | Bacteria | 2120 |
| 51 | Ga0070711_100000071 | 3300005439 | Bacteria | 58870 |
| 52 | Ga0070705_100000036 | 3300005440 | Bacteria | 67281 |
| 53 | Ga0070705_100000288 | 3300005440 | Bacteria | 30044 |
| 54 | Ga0070705_100024644 | 3300005440 | Bacteria | 3251 |
| 55 | Ga0070705_100032846 | 3300005440 | Bacteria | 2887 |
| 56 | Ga0070705_100056266 | 3300005440 | Bacteria | 2316 |
| 57 | Ga0070705_100118788 | 3300005440 | Bacteria | 1703 |
| 58 | Ga0070705_100191409 | 3300005440 | Bacteria | 1394 |
| 59 | Ga0070705_100210623 | 3300005440 | Bacteria | 1339 |
| 60 | Ga0070705_100292108 | 3300005440 | Unclassified | 1164 |
| 61 | Ga0070700_100010664 | 3300005441 | Bacteria | 5075 |
| 62 | Ga0070700_100207695 | 3300005441 | Bacteria | 1380 |
| 63 | Ga0070700_100549644 | 3300005441 | Bacteria | 897 |
| 64 | Ga0070694_100003725 | 3300005444 | Bacteria | 9092 |
| 65 | Ga0070694_100014189 | 3300005444 | Bacteria | 4985 |
| 66 | Ga0070694_100021729 | 3300005444 | Bacteria | 4105 |
| 67 | Ga0070694_100032377 | 3300005444 | Bacteria | 3434 |
| 68 | Ga0070694_100056767 | 3300005444 | Bacteria | 2660 |
| 69 | Ga0070694_100069869 | 3300005444 | Bacteria | 2416 |
| 70 | Ga0070694_100153039 | 3300005444 | Bacteria | 1686 |
| 71 | Ga0070678_100317790 | 3300005456 | Bacteria | 1329 |
| 72 | Ga0070662_100047672 | 3300005457 | Bacteria | 3083 |
| 73 | Ga0070662_100055980 | 3300005457 | Bacteria | 2863 |
| 74 | Ga0070681_10005093 | 3300005458 | Bacteria | 12679 |
| 75 | Ga0068867_100378251 | 3300005459 | Bacteria | 1189 |
| 76 | Ga0070685_10144478 | 3300005466 | Bacteria | 1501 |
| 77 | Ga0070685_10269351 | 3300005466 | Bacteria | 1136 |
| 78 | Ga0070685_10301659 | 3300005466 | Bacteria | 1080 |
| 79 | Ga0070685_10385744 | 3300005466 | Bacteria | 966 |
| 80 | Ga0070706_100000042 | 3300005467 | Bacteria | 147128 |
| 81 | Ga0070707_100037700 | 3300005468 | Bacteria | 4615 |
| 82 | Ga0070707_100918298 | 3300005468 | Unclassified | 840 |
| 83 | Ga0070698_100002474 | 3300005471 | Bacteria | 20388 |
| 84 | Ga0070698_100711485 | 3300005471 | Bacteria | 947 |
| 85 | Ga0070699_100000088 | 3300005518 | Bacteria | 88268 |
| 86 | Ga0070699_100000558 | 3300005518 | Bacteria | 35133 |
| 87 | Ga0070699_100234096 | 3300005518 | Bacteria | 1638 |
| 88 | Ga0070699_100281551 | 3300005518 | Bacteria | 1489 |
| 89 | Ga0070697_100001756 | 3300005536 | Bacteria | 16543 |
| 90 | Ga0070697_100075097 | 3300005536 | Bacteria | 2778 |
| 91 | Ga0070697_100219681 | 3300005536 | Bacteria | 1619 |
| 92 | Ga0068853_100637197 | 3300005539 | Bacteria | 1014 |
| 93 | Ga0070672_100014662 | 3300005543 | Bacteria | 5560 |
| 94 | Ga0070672_100112438 | 3300005543 | Bacteria | 2221 |
| 95 | Ga0070672_100135677 | 3300005543 | Bacteria | 2026 |
| 96 | Ga0070686_100025311 | 3300005544 | Bacteria | 3570 |
| 97 | Ga0070686_100118897 | 3300005544 | Bacteria | 1812 |
| 98 | Ga0070695_100005834 | 3300005545 | Bacteria | 7262 |
| 99 | Ga0070695_100033314 | 3300005545 | Bacteria | 3223 |
| 100 | Ga0070695_100041504 | 3300005545 | Bacteria | 2917 |
| 101 | Ga0070695_100176308 | 3300005545 | Bacteria | 1511 |
| 102 | Ga0070696_100000160 | 3300005546 | Bacteria | 37837 |
| 103 | Ga0070696_100001518 | 3300005546 | Bacteria | 15229 |
| 104 | Ga0070696_100001520 | 3300005546 | Bacteria | 15227 |
| 105 | Ga0070696_100020973 | 3300005546 | Bacteria | 4429 |
| 106 | Ga0070696_100029392 | 3300005546 | Bacteria | 3756 |
| 107 | Ga0070696_100072673 | 3300005546 | Bacteria | 2423 |
| 108 | Ga0070696_100555592 | 3300005546 | Bacteria | 920 |
| 109 | Ga0070693_100001018 | 3300005547 | Bacteria | 12489 |
| 110 | Ga0070704_100000802 | 3300005549 | Bacteria | 15581 |
| 111 | Ga0070704_100001323 | 3300005549 | Bacteria | 13119 |
| 112 | Ga0070704_100064726 | 3300005549 | Bacteria | 2629 |
| 113 | Ga0070704_100067263 | 3300005549 | Bacteria | 2587 |
| 114 | Ga0070704_100078752 | 3300005549 | Bacteria | 2419 |
| 115 | Ga0070704_100092536 | 3300005549 | Bacteria | 2257 |
| 116 | Ga0070704_100137481 | 3300005549 | Bacteria | 1903 |
| 117 | Ga0070664_100075546 | 3300005564 | Bacteria | 2894 |
| 118 | Ga0070664_100637990 | 3300005564 | Bacteria | 989 |
| 119 | Ga0070664_100836629 | 3300005564 | Bacteria | 861 |
| 120 | Ga0068857_100096665 | 3300005577 | Bacteria | 2647 |
| 121 | Ga0068857_100233117 | 3300005577 | Bacteria | 1684 |
| 122 | Ga0068857_100312785 | 3300005577 | Bacteria | 1449 |
| 123 | Ga0068857_100479428 | 3300005577 | Bacteria | 1165 |
| 124 | Ga0068854_100061695 | 3300005578 | Bacteria | 2716 |
| 125 | Ga0070702_100022961 | 3300005615 | Bacteria | 3308 |
| 126 | Ga0068859_100001859 | 3300005617 | Bacteria | 21461 |
| 127 | Ga0068859_100004314 | 3300005617 | Bacteria | 14503 |
| 128 | Ga0068859_100020763 | 3300005617 | Bacteria | 6592 |
| 129 | Ga0068859_100072849 | 3300005617 | Bacteria | 3472 |
| 130 | Ga0068859_100451546 | 3300005617 | Bacteria | 1382 |
| 131 | Ga0068859_100481890 | 3300005617 | Bacteria | 1336 |
| 132 | Ga0068859_100703660 | 3300005617 | Bacteria | 1101 |
| 133 | Ga0068864_100097318 | 3300005618 | Bacteria | 2605 |
| 134 | Ga0068864_100284096 | 3300005618 | Bacteria | 1545 |
| 135 | Ga0068864_100415310 | 3300005618 | Bacteria | 1281 |
| 136 | Ga0068861_100001024 | 3300005719 | Bacteria | 17105 |
| 137 | Ga0068870_10002841 | 3300005840 | Bacteria | 7291 |
| 138 | Ga0068863_100003032 | 3300005841 | Bacteria | 16605 |
| 139 | Ga0068863_100016991 | 3300005841 | Bacteria | 6978 |
| 140 | Ga0068863_100473616 | 3300005841 | Bacteria | 1231 |
| 141 | Ga0068858_100114672 | 3300005842 | Bacteria | 2518 |
| 142 | Ga0068858_100226740 | 3300005842 | Bacteria | 1771 |
| 143 | Ga0068858_100379717 | 3300005842 | Bacteria | 1356 |
| 144 | Ga0068858_100793656 | 3300005842 | Bacteria | 924 |
| 145 | Ga0068860_100014506 | 3300005843 | Bacteria | 7712 |
| 146 | Ga0068860_100015659 | 3300005843 | Bacteria | 7403 |
| 147 | Ga0068860_100078115 | 3300005843 | Unclassified | 3148 |
| 148 | Ga0068860_100340937 | 3300005843 | Bacteria | 1474 |
| 149 | Ga0068862_100002475 | 3300005844 | Bacteria | 16354 |
| 150 | Ga0081539_10000790 | 3300005985 | Bacteria | 61618 |
| 151 | Ga0081539_10026575 | 3300005985 | Bacteria | 3689 |
| 152 | Ga0070712_100039347 | 3300006175 | Bacteria | 3236 |
| 153 | Ga0097621_100092378 | 3300006237 | Bacteria | 2534 |
| 154 | Ga0097621_100228491 | 3300006237 | Bacteria | 1624 |
| 155 | Ga0097621_100421593 | 3300006237 | Bacteria | 1198 |
| 156 | Ga0097621_100427729 | 3300006237 | Bacteria | 1189 |
| 157 | Ga0068871_100061983 | 3300006358 | Bacteria | 3056 |
| 158 | Ga0075428_100002473 | 3300006844 | Bacteria | 20060 |
| 159 | Ga0075428_100007293 | 3300006844 | Bacteria | 12246 |
| 160 | Ga0075428_100014799 | 3300006844 | Bacteria | 8669 |
| 161 | Ga0075428_100037261 | 3300006844 | Bacteria | 5355 |
| 162 | Ga0075430_100050504 | 3300006846 | Bacteria | 3507 |
| 163 | Ga0075430_100353618 | 3300006846 | Bacteria | 1213 |
| 164 | Ga0075431_100003641 | 3300006847 | Bacteria | 14938 |
| 165 | Ga0075431_100032234 | 3300006847 | Bacteria | 5400 |
| 166 | Ga0075431_100495299 | 3300006847 | Bacteria | 1214 |
| 167 | Ga0075433_10022639 | 3300006852 | Bacteria | 5277 |
| 168 | Ga0075433_10103328 | 3300006852 | Bacteria | 2524 |
| 169 | Ga0075433_10105300 | 3300006852 | Unclassified | 2499 |
| 170 | Ga0075433_10574059 | 3300006852 | Bacteria | 991 |
| 171 | Ga0075434_100000919 | 3300006871 | Bacteria | 23605 |
| 172 | Ga0075434_100017203 | 3300006871 | Bacteria | 6961 |
| 173 | Ga0075434_100062148 | 3300006871 | Bacteria | 3717 |
| 174 | Ga0075434_100102722 | 3300006871 | Bacteria | 2866 |
| 175 | Ga0075434_100461230 | 3300006871 | Bacteria | 1292 |
| 176 | Ga0075429_100003923 | 3300006880 | Bacteria | 12713 |
| 177 | Ga0075429_100827350 | 3300006880 | Bacteria | 811 |
| 178 | Ga0075436_100000483 | 3300006914 | Bacteria | 25759 |
| 179 | Ga0075436_100025340 | 3300006914 | Bacteria | 4081 |
| 180 | Ga0097620_100001859 | 3300006931 | Bacteria | 21461 |
| 181 | Ga0097620_100004314 | 3300006931 | Bacteria | 14503 |
| 182 | Ga0097620_100020763 | 3300006931 | Bacteria | 6592 |
| 183 | Ga0097620_100072859 | 3300006931 | Bacteria | 3472 |
| 184 | Ga0097620_100451555 | 3300006931 | Bacteria | 1382 |
| 185 | Ga0097620_100481911 | 3300006931 | Bacteria | 1336 |
| 186 | Ga0097620_100703559 | 3300006931 | Bacteria | 1101 |
| 187 | Ga0075435_100065838 | 3300007076 | Bacteria | 2946 |
| 188 | Ga0075435_100122427 | 3300007076 | Bacteria | 2171 |
| 189 | Ga0105251_10127115 | 3300009011 | Bacteria | 1157 |
| 190 | Ga0105240_10005852 | 3300009093 | Bacteria | 18231 |
| 191 | Ga0105240_10099572 | 3300009093 | Bacteria | 3538 |
| 192 | Ga0111539_10002588 | 3300009094 | Bacteria | 23957 |
| 193 | Ga0111539_10024703 | 3300009094 | Bacteria | 7370 |
| 194 | Ga0111539_10032749 | 3300009094 | Bacteria | 6312 |
| 195 | Ga0111539_10047335 | 3300009094 | Bacteria | 5139 |
| 196 | Ga0111539_10095648 | 3300009094 | Bacteria | 3489 |
| 197 | Ga0111539_10174585 | 3300009094 | Bacteria | 2510 |
| 198 | Ga0105247_10114987 | 3300009101 | Bacteria | 1736 |
| 199 | Ga0114129_10001096 | 3300009147 | Bacteria | 35569 |
| 200 | Ga0114129_10001790 | 3300009147 | Bacteria | 29271 |
| 201 | Ga0114129_10003742 | 3300009147 | Bacteria | 21453 |
| 202 | Ga0114129_10012572 | 3300009147 | Bacteria | 12055 |
| 203 | Ga0114129_10103084 | 3300009147 | Bacteria | 3945 |
| 204 | Ga0114129_10130755 | 3300009147 | Bacteria | 3448 |
| 205 | Ga0114129_10210393 | 3300009147 | Bacteria | 2629 |
| 206 | Ga0114129_10245658 | 3300009147 | Bacteria | 2404 |
| 207 | Ga0114129_10329954 | 3300009147 | Bacteria | 2026 |
| 208 | Ga0114129_10439988 | 3300009147 | Bacteria | 1712 |
| 209 | Ga0105243_10027395 | 3300009148 | Bacteria | 4366 |
| 210 | Ga0105243_10031314 | 3300009148 | Bacteria | 4101 |
| 211 | Ga0105243_10250283 | 3300009148 | Bacteria | 1581 |
| 212 | Ga0105243_10306046 | 3300009148 | Bacteria | 1442 |
| 213 | Ga0105242_10287045 | 3300009176 | Bacteria | 1497 |
| 214 | Ga0105248_10000355 | 3300009177 | Bacteria | 53533 |
| 215 | Ga0105248_10011176 | 3300009177 | Bacteria | 9902 |
| 216 | Ga0105248_10016732 | 3300009177 | Bacteria | 8075 |
| 217 | Ga0105248_10080722 | 3300009177 | Bacteria | 3656 |
| 218 | Ga0105237_10085586 | 3300009545 | Bacteria | 3142 |
| 219 | Ga0105237_10186996 | 3300009545 | Bacteria | 2071 |
| 220 | Ga0105238_10146768 | 3300009551 | Bacteria | 2335 |
| 221 | Ga0105249_10016780 | 3300009553 | Bacteria | 6498 |
| 222 | Ga0105249_10095660 | 3300009553 | Bacteria | 2785 |
| 223 | Ga0105249_10123254 | 3300009553 | Bacteria | 2465 |
| 224 | Ga0105249_10488688 | 3300009553 | Bacteria | 1275 |
| 225 | Ga0105239_10173167 | 3300010375 | Bacteria | 2414 |
| 226 | Ga0105246_10585913 | 3300011119 | Bacteria | 961 |
| 227 | Ga0157378_10067437 | 3300013297 | Bacteria | 3207 |
| 228 | Ga0163162_10283910 | 3300013306 | Bacteria | 1787 |
| 229 | Ga0163162_10990363 | 3300013306 | Bacteria | 950 |
| 230 | Ga0157375_10005573 | 3300013308 | Bacteria | 10954 |
| 231 | Ga0157375_11394055 | 3300013308 | Bacteria | 825 |
| 232 | Ga0163163_10000023 | 3300014325 | Bacteria | 185843 |
| 233 | Ga0163163_10043557 | 3300014325 | Bacteria | 4400 |
| 234 | Ga0157380_10014504 | 3300014326 | Bacteria | 5766 |
| 235 | Ga0157380_10100559 | 3300014326 | Unclassified | 2407 |
| 236 | Ga0157380_10731013 | 3300014326 | Bacteria | 999 |
| 237 | Ga0157377_10034627 | 3300014745 | Bacteria | 2763 |
| 238 | Ga0157377_10158651 | 3300014745 | Bacteria | 1405 |
| 239 | Ga0157379_10000517 | 3300014968 | Bacteria | 31255 |
| 240 | Ga0157376_10151751 | 3300014969 | Bacteria | 2090 |
| 241 | Ga0157376_10156607 | 3300014969 | Unclassified | 2061 |
| 242 | Ga0157376_10374250 | 3300014969 | Bacteria | 1370 |
| 243 | Ga0157376_10409052 | 3300014969 | Bacteria | 1314 |
| 244 | Ga0163161_10035588 | 3300017792 | Bacteria | 3564 |
| 245 | Ga0163161_10182247 | 3300017792 | Bacteria | 1611 |
| 246 | Ga0206356_10282298 | 3300020070 | Bacteria | 881 |
| 247 | Ga0207666_1003846 | 3300025271 | Bacteria | 1859 |
| 248 | Ga0207697_10053047 | 3300025315 | Bacteria | 1679 |
| 249 | Ga0207653_10000235 | 3300025885 | Bacteria | 36762 |
| 250 | Ga0207653_10059414 | 3300025885 | Bacteria | 1287 |
| 251 | Ga0207710_10120736 | 3300025900 | Bacteria | 1251 |
| 252 | Ga0207688_10206141 | 3300025901 | Bacteria | 1180 |
| 253 | Ga0207680_10265629 | 3300025903 | Bacteria | 1189 |
| 254 | Ga0207699_10000005 | 3300025906 | Bacteria | 534560 |
| 255 | Ga0207643_10035802 | 3300025908 | Bacteria | 2784 |
| 256 | Ga0207684_10000061 | 3300025910 | Bacteria | 203286 |
| 257 | Ga0207684_10109979 | 3300025910 | Bacteria | 2359 |
| 258 | Ga0207684_10118177 | 3300025910 | Bacteria | 2272 |
| 259 | Ga0207684_10482389 | 3300025910 | Bacteria | 1063 |
| 260 | Ga0207707_10022422 | 3300025912 | Bacteria | 5520 |
| 261 | Ga0207695_10032437 | 3300025913 | Bacteria | 5715 |
| 262 | Ga0207695_10035428 | 3300025913 | Bacteria | 5411 |
| 263 | Ga0207693_10109696 | 3300025915 | Bacteria | 2164 |
| 264 | Ga0207663_10000051 | 3300025916 | Bacteria | 63011 |
| 265 | Ga0207660_10302818 | 3300025917 | Bacteria | 1273 |
| 266 | Ga0207662_10056781 | 3300025918 | Unclassified | 2339 |
| 267 | Ga0207662_10273837 | 3300025918 | Bacteria | 1115 |
| 268 | Ga0207662_10336210 | 3300025918 | Bacteria | 1011 |
| 269 | Ga0207662_10504131 | 3300025918 | Bacteria | 834 |
| 270 | Ga0207646_10101750 | 3300025922 | Bacteria | 2576 |
| 271 | Ga0207646_10173306 | 3300025922 | Bacteria | 1948 |
| 272 | Ga0207681_10000705 | 3300025923 | Bacteria | 21963 |
| 273 | Ga0207681_10044057 | 3300025923 | Bacteria | 2989 |
| 274 | Ga0207681_10150739 | 3300025923 | Bacteria | 1742 |
| 275 | Ga0207681_10239972 | 3300025923 | Bacteria | 1410 |
| 276 | Ga0207681_10256772 | 3300025923 | Unclassified | 1367 |
| 277 | Ga0207650_10017612 | 3300025925 | Bacteria | 5003 |
| 278 | Ga0207650_10248869 | 3300025925 | Bacteria | 1438 |
| 279 | Ga0207650_10433596 | 3300025925 | Bacteria | 1092 |
| 280 | Ga0207650_10577510 | 3300025925 | Bacteria | 944 |
| 281 | Ga0207659_10001290 | 3300025926 | Bacteria | 14972 |
| 282 | Ga0207659_10001420 | 3300025926 | Bacteria | 14274 |
| 283 | Ga0207659_10001687 | 3300025926 | Bacteria | 13104 |
| 284 | Ga0207659_10057832 | 3300025926 | Unclassified | 2782 |
| 285 | Ga0207659_10169798 | 3300025926 | Bacteria | 1720 |
| 286 | Ga0207659_10496652 | 3300025926 | Bacteria | 1032 |
| 287 | Ga0207644_10397545 | 3300025931 | Bacteria | 1126 |
| 288 | Ga0207690_10062065 | 3300025932 | Bacteria | 2543 |
| 289 | Ga0207706_10039316 | 3300025933 | Bacteria | 4193 |
| 290 | Ga0207670_10018458 | 3300025936 | Bacteria | 4240 |
| 291 | Ga0207691_10007064 | 3300025940 | Bacteria | 10834 |
| 292 | Ga0207691_10058264 | 3300025940 | Bacteria | 3513 |
| 293 | Ga0207691_10072170 | 3300025940 | Bacteria | 3114 |
| 294 | Ga0207691_10478990 | 3300025940 | Bacteria | 1058 |
| 295 | Ga0207711_10006411 | 3300025941 | Bacteria | 9915 |
| 296 | Ga0207711_10096517 | 3300025941 | Bacteria | 2609 |
| 297 | Ga0207689_10092280 | 3300025942 | Bacteria | 2487 |
| 298 | Ga0207689_10175941 | 3300025942 | Bacteria | 1765 |
| 299 | Ga0207661_10361402 | 3300025944 | Bacteria | 1311 |
| 300 | Ga0207679_10033416 | 3300025945 | Bacteria | 3619 |
| 301 | Ga0207679_10104857 | 3300025945 | Bacteria | 2219 |
| 302 | Ga0207679_10107508 | 3300025945 | Bacteria | 2195 |
| 303 | Ga0207679_10760151 | 3300025945 | Bacteria | 882 |
| 304 | Ga0207651_10022771 | 3300025960 | Bacteria | 3839 |
| 305 | Ga0207651_10216523 | 3300025960 | Bacteria | 1545 |
| 306 | Ga0207651_10381816 | 3300025960 | Bacteria | 1194 |
| 307 | Ga0207712_10066974 | 3300025961 | Bacteria | 2569 |
| 308 | Ga0207712_10236608 | 3300025961 | Bacteria | 1469 |
| 309 | Ga0207640_10014196 | 3300025981 | Bacteria | 4579 |
| 310 | Ga0207640_10326307 | 3300025981 | Bacteria | 1224 |
| 311 | Ga0207658_10034675 | 3300025986 | Bacteria | 3608 |
| 312 | Ga0207703_10043145 | 3300026035 | Bacteria | 3618 |
| 313 | Ga0207703_10165231 | 3300026035 | Bacteria | 1941 |
| 314 | Ga0207708_10112634 | 3300026075 | Bacteria | 2113 |
| 315 | Ga0207708_10514461 | 3300026075 | Bacteria | 1005 |
| 316 | Ga0207641_10003549 | 3300026088 | Bacteria | 13792 |
| 317 | Ga0207641_10132801 | 3300026088 | Bacteria | 2237 |
| 318 | Ga0207641_10573872 | 3300026088 | Bacteria | 1102 |
| 319 | Ga0207648_10003537 | 3300026089 | Bacteria | 16338 |
| 320 | Ga0207676_10072022 | 3300026095 | Bacteria | 2776 |
| 321 | Ga0207676_10074116 | 3300026095 | Bacteria | 2741 |
| 322 | Ga0207676_10124903 | 3300026095 | Bacteria | 2177 |
| 323 | Ga0207674_10028476 | 3300026116 | Bacteria | 5897 |
| 324 | Ga0207674_10103950 | 3300026116 | Bacteria | 2819 |
| 325 | Ga0207674_10790231 | 3300026116 | Bacteria | 916 |
| 326 | Ga0207675_100002780 | 3300026118 | Bacteria | 17190 |
| 327 | Ga0207675_100016366 | 3300026118 | Bacteria | 6923 |
| 328 | Ga0207675_100200104 | 3300026118 | Bacteria | 1918 |
| 329 | Ga0207683_10170588 | 3300026121 | Bacteria | 1970 |
| 330 | Ga0207428_10005347 | 3300027907 | Bacteria | 11972 |
| 331 | Ga0207428_10020023 | 3300027907 | Bacteria | 5697 |
| 332 | Ga0207428_10076799 | 3300027907 | Bacteria | 2615 |
| 333 | Ga0207428_10093232 | 3300027907 | Bacteria | 2336 |
| 334 | Ga0207428_10102620 | 3300027907 | Unclassified | 2209 |
| 335 | Ga0207428_10549252 | 3300027907 | Bacteria | 836 |
| 336 | Ga0268265_10000714 | 3300028380 | Bacteria | 32686 |
| 337 | Ga0268264_10001966 | 3300028381 | Bacteria | 18469 |
| 338 | Ga0268264_10009945 | 3300028381 | Bacteria | 7875 |
| 339 | Ga0268264_10077760 | 3300028381 | Unclassified | 2827 |
| 340 | Ga0268264_10102874 | 3300028381 | Bacteria | 2486 |
| 341 | Ga0265331_10039781 | 3300031250 | Bacteria | 2291 |
| 342 | Ga0265327_10209083 | 3300031251 | Bacteria | 881 |
| 343 | Ga0265313_10019358 | 3300031595 | Bacteria | 3790 |
| 344 | Ga0265314_10067460 | 3300031711 | Bacteria | 2410 |
| 345 | Ga0316578_10098934 | 3300031728 | Bacteria | 1748 |
| 346 | Ga0316578_10175392 | 3300031728 | Unclassified | 1292 |
| 347 | Ga0307405_10007210 | 3300031731 | Bacteria | 5538 |
| 348 | Ga0307405_10046672 | 3300031731 | Bacteria | 2663 |
| 349 | Ga0307405_10069489 | 3300031731 | Unclassified | 2258 |
| 350 | Ga0307405_10071706 | 3300031731 | Bacteria | 2230 |
| 351 | Ga0316577_10116362 | 3300031733 | Bacteria | 1501 |
| 352 | Ga0316577_10162157 | 3300031733 | Bacteria | 1261 |
| 353 | Ga0316577_10262783 | 3300031733 | Bacteria | 976 |
| 354 | Ga0307413_10002032 | 3300031824 | Bacteria | 8053 |
| 355 | Ga0307413_10059094 | 3300031824 | Bacteria | 2354 |
| 356 | Ga0307410_10004776 | 3300031852 | Bacteria | 7070 |
| 357 | Ga0307410_10178860 | 3300031852 | Bacteria | 1604 |
| 358 | Ga0307406_10008064 | 3300031901 | Bacteria | 5866 |
| 359 | Ga0307406_10008262 | 3300031901 | Bacteria | 5802 |
| 360 | Ga0307406_10012021 | 3300031901 | Bacteria | 4924 |
| 361 | Ga0307406_10083915 | 3300031901 | Bacteria | 2126 |
| 362 | Ga0307407_10005775 | 3300031903 | Bacteria | 5412 |
| 363 | Ga0307407_10010616 | 3300031903 | Bacteria | 4352 |
| 364 | Ga0307407_10059019 | 3300031903 | Bacteria | 2232 |
| 365 | Ga0307412_10018616 | 3300031911 | Bacteria | 4184 |
| 366 | Ga0307412_10028414 | 3300031911 | Bacteria | 3498 |
| 367 | Ga0307412_10176888 | 3300031911 | Bacteria | 1601 |
| 368 | Ga0307409_100016000 | 3300031995 | Unclassified | 4947 |
| 369 | Ga0307409_100033255 | 3300031995 | Bacteria | 3750 |
| 370 | Ga0307409_100033673 | 3300031995 | Bacteria | 3731 |
| 371 | Ga0307409_100344736 | 3300031995 | Bacteria | 1403 |
| 372 | Ga0307416_100033527 | 3300032002 | Bacteria | 3894 |
| 373 | Ga0307416_100076722 | 3300032002 | Bacteria | 2802 |
| 374 | Ga0307416_100310236 | 3300032002 | Bacteria | 1574 |
| 375 | Ga0307416_100583767 | 3300032002 | Bacteria | 1195 |
| 376 | Ga0307414_10047854 | 3300032004 | Bacteria | 2946 |
| 377 | Ga0307411_10034010 | 3300032005 | Bacteria | 3167 |
| 378 | Ga0307411_10041999 | 3300032005 | Bacteria | 2914 |
| 379 | Ga0307411_10202339 | 3300032005 | Bacteria | 1526 |
| 380 | Ga0307415_100012541 | 3300032126 | Bacteria | 4905 |
| 381 | Ga0307415_100247326 | 3300032126 | Bacteria | 1447 |
| 382 | Ga0316583_10040018 | 3300032133 | Bacteria | 1660 |
| 383 | Ga0316583_10047810 | 3300032133 | Bacteria | 1508 |
| 384 | Ga0316583_10049658 | 3300032133 | Bacteria | 1477 |
| 385 | Ga0373940_0020405 | 3300035088 | Bacteria | 1684 |
| 386 | Ga0373952_0038376 | 3300035092 | Bacteria | 1097 |
| 387 | Ga0373936_0107600 | 3300035113 | Bacteria | 1181 |
| 388 | Ga0373939_0181600 | 3300035114 | Bacteria | 785 |
| 389 | Ga0373945_0044179 | 3300035116 | Bacteria | 1619 |
| 390 | Ga0373945_0061022 | 3300035116 | Bacteria | 1408 |
| 391 | Ga0373943_0016323 | 3300035170 | Bacteria | 3385 |
| 392 | Ga0373947_0018355 | 3300035725 | Bacteria | 4026 |
| 393 | Ga0373947_0171153 | 3300035725 | Bacteria | 1409 |
| 394 | Ga0373937_0019700 | 3300036401 | Bacteria | 6042 |
| 395 | Ga0373937_0291140 | 3300036401 | Bacteria | 1543 |
| 396 | Ga0316582_0080180 | 3300036647 | Bacteria | 2130 |
| 397 | Ga0316582_0266535 | 3300036647 | Bacteria | 1175 |
| 398 | Ga0316584_0006871 | 3300036712 | Bacteria | 7733 |
| 399 | Ga0316584_0024723 | 3300036712 | Bacteria | 4399 |
| 400 | Ga0373925_0013930 | 3300037068 | Bacteria | 5821 |
| 401 | Ga0373925_0136676 | 3300037068 | Bacteria | 1916 |
| 402 | Ga0395905_0145155 | 3300037471 | Bacteria | 2233 |
| 403 | Ga0395905_0188973 | 3300037471 | Bacteria | 1933 |
| 404 | Ga0400483_286307 | 3300039062 | Bacteria | 4703 |
| 405 | Ga0400489_90685 | 3300039093 | Bacteria | 1584 |
| 406 | Ga0451807_0137355 | 3300041486 | Bacteria | 1225 |
| 407 | Ga0439446_0051611 | 3300042156 | Bacteria | 1229 |
| 408 | Ga0439458_0028596 | 3300042157 | Bacteria | 1320 |
| 409 | Ga0450918_000954 | 3300042531 | Bacteria | 6042 |
| 410 | Ga0451577_0004406 | 3300042876 | Bacteria | 14882 |
| 411 | Ga0451577_0005948 | 3300042876 | Bacteria | 12302 |
| 412 | Ga0451577_0092441 | 3300042876 | Bacteria | 2701 |
| 413 | Ga0453684_0000354 | 3300044712 | Bacteria | 190599 |
| 414 | Ga0453684_0000441 | 3300044712 | Bacteria | 169068 |
| 415 | Ga0453684_0363228 | 3300044712 | Bacteria | 1629 |
| 416 | Ga0451576_0007133 | 3300045051 | Bacteria | 13485 |
| 417 | Ga0451576_0013998 | 3300045051 | Bacteria | 8945 |
| 418 | Ga0451576_0017863 | 3300045051 | Bacteria | 7792 |
| 419 | Ga0451576_0023122 | 3300045051 | Bacteria | 6734 |
| 420 | Ga0451576_0055845 | 3300045051 | Bacteria | 4130 |
| 421 | Ga0451576_0268525 | 3300045051 | Bacteria | 1783 |
| 422 | Ga0451576_0360059 | 3300045051 | Bacteria | 1523 |
| 423 | Ga0451576_0773076 | 3300045051 | Bacteria | 1009 |
| 424 | Ga0495603_0010906 | 3300046455 | Bacteria | 5513 |
| 425 | Ga0495629_0000002 | 3300046459 | Bacteria | 686975 |
| 426 | Ga0495629_0009367 | 3300046459 | Bacteria | 7162 |
| 427 | Ga0495580_0039588 | 3300046472 | Bacteria | 3373 |
| 428 | Ga0495580_0242721 | 3300046472 | Bacteria | 1235 |
| 429 | Ga0495639_0001606 | 3300046475 | Bacteria | 10062 |
| 430 | Ga0495584_0031423 | 3300046491 | Bacteria | 2687 |
| 431 | Ga0495594_0027482 | 3300046499 | Bacteria | 3066 |
| 432 | Ga0495618_0007761 | 3300046514 | Bacteria | 6492 |
| 433 | Ga0495644_0047878 | 3300046523 | Bacteria | 1605 |
| 434 | Ga0495663_0005606 | 3300046525 | Bacteria | 3477 |
| 435 | Ga0495666_0000363 | 3300046526 | Bacteria | 19992 |
| 436 | Ga0495642_0013615 | 3300046528 | Bacteria | 3150 |
| 437 | Ga0495640_0129133 | 3300046533 | Bacteria | 1637 |
| 438 | Ga0495640_0416753 | 3300046533 | Bacteria | 823 |
| 439 | Ga0495586_0000300 | 3300046535 | Bacteria | 31407 |
| 440 | Ga0495586_0214681 | 3300046535 | Bacteria | 1092 |
| 441 | Ga0495598_0020498 | 3300046537 | Bacteria | 1746 |
| 442 | Ga0495609_0029630 | 3300046538 | Bacteria | 2492 |
| 443 | Ga0495621_0033932 | 3300046539 | Bacteria | 1761 |
| 444 | Ga0495621_0089364 | 3300046539 | Bacteria | 1160 |
| 445 | Ga0495645_0087860 | 3300046543 | Bacteria | 2224 |
| 446 | Ga0495622_0023042 | 3300046557 | Bacteria | 2902 |
| 447 | Ga0495656_0164170 | 3300046615 | Bacteria | 1081 |
| 448 | Ga0495635_0000960 | 3300046663 | Bacteria | 19029 |
| 449 | Ga0495659_0007090 | 3300046664 | Bacteria | 3546 |
| 450 | Ga0495659_0007662 | 3300046664 | Bacteria | 3422 |
| 451 | Ga0495659_0041931 | 3300046664 | Bacteria | 1636 |
| 452 | Ga0495599_0177300 | 3300046678 | Bacteria | 1314 |
| 453 | Ga0495658_0049335 | 3300046683 | Bacteria | 2377 |
| 454 | Ga0495658_0049656 | 3300046683 | Bacteria | 2370 |
| 455 | Ga0495669_0025398 | 3300046684 | Bacteria | 2584 |
| 456 | Ga0495669_0040750 | 3300046684 | Bacteria | 2061 |
| 457 | Ga0495613_0110874 | 3300046689 | Bacteria | 1977 |
| 458 | Ga0495600_0014772 | 3300046809 | Bacteria | 4924 |
| 459 | Ga0495581_0031930 | 3300047315 | Bacteria | 3051 |
| 460 | Ga0495581_0032038 | 3300047315 | Bacteria | 3044 |
| 461 | Ga0495636_0005248 | 3300047318 | Bacteria | 5086 |
| 462 | Ga0495636_0070696 | 3300047318 | Bacteria | 1489 |
| 463 | Ga0495676_0002152 | 3300047321 | Bacteria | 17431 |
| 464 | Ga0495676_0005978 | 3300047321 | Bacteria | 11182 |
| 465 | Ga0495680_0017238 | 3300047322 | Bacteria | 6175 |
| 466 | Ga0495677_0045300 | 3300047445 | Bacteria | 1613 |
| 467 | Ga0495685_051367 | 3300047447 | Bacteria | 1398 |
| 468 | Ga0495684_0043036 | 3300047471 | Bacteria | 3457 |
| 469 | Ga0495686_0080704 | 3300047472 | Bacteria | 1988 |
| 470 | Ga0496112_0105430 | 3300048915 | Bacteria | 2789 |
| 471 | Ga0501031_0196139 | 3300049568 | Bacteria | 1318 |
| 472 | Ga0501036_0250919 | 3300049572 | Unclassified | 1483 |
| 473 | Ga0501038_0122109 | 3300049574 | Unclassified | 2147 |
| 474 | Ga0501042_0014760 | 3300049578 | Bacteria | 5334 |
| 475 | Ga0501046_0066040 | 3300049580 | Unclassified | 2821 |
| 476 | Ga0501048_0085307 | 3300049582 | Unclassified | 2227 |
| 477 | Ga0501067_0041572 | 3300049583 | Bacteria | 2553 |
| 478 | Ga0501068_0078182 | 3300049584 | Bacteria | 2027 |
| 479 | Ga0501072_0018264 | 3300049588 | Bacteria | 5396 |
| 480 | Ga0501072_0262103 | 3300049588 | Bacteria | 1376 |
| 481 | Ga0501072_0651514 | 3300049588 | Bacteria | 829 |
| 482 | Ga0501075_0112173 | 3300049591 | Unclassified | 2073 |
| 483 | Ga0501076_0033001 | 3300049592 | Bacteria | 4042 |
| 484 | Ga0501239_015023 | 3300049672 | Bacteria | 901 |
| 485 | Ga0501081_0450688 | 3300049743 | Bacteria | 956 |
| 486 | Ga0501045_0128103 | 3300049824 | Unclassified | 1886 |
| 487 | Ga0501045_0359951 | 3300049824 | Bacteria | 1083 |
| 488 | nmdc:mga05p37_1018144_c1 | 3300050507 | Bacteria | 878 |
| 489 | nmdc:mga05p37_135829_c1 | 3300050507 | Bacteria | 3016 |
| 490 | nmdc:mga05p37_1433_c1 | 3300050507 | Bacteria | 27689 |
| 491 | nmdc:mga05p37_181281_c1 | 3300050507 | Bacteria | 2562 |
| 492 | nmdc:mga05p37_287040_c1 | 3300050507 | Bacteria | 1960 |
| 493 | nmdc:mga05p37_2888_c1 | 3300050507 | Bacteria | 19926 |
| 494 | nmdc:mga05p37_3825_c1 | 3300050507 | Bacteria | 17603 |
| 495 | nmdc:mga05p37_39052_c1 | 3300050507 | Bacteria | 5824 |
| 496 | nmdc:mga05p37_40576_c1 | 3300050507 | Bacteria | 5716 |
| 497 | nmdc:mga05p37_76956_c1 | 3300050507 | Bacteria | 4107 |
| 498 | nmdc:mga05p37_90897_c1 | 3300050507 | Bacteria | 3762 |
| 499 | nmdc:mga05p37_92481_c1 | 3300050507 | Bacteria | 3727 |
| 500 | nmdc:mga09592_1848_c1 | 3300050508 | Bacteria | 17028 |
| 501 | nmdc:mga09592_203864_c1 | 3300050508 | Bacteria | 1713 |
| 502 | nmdc:mga0qj67_20350_c1 | 3300050509 | Bacteria | 5078 |
| 503 | nmdc:mga0qj67_36800_c1 | 3300050509 | Bacteria | 3831 |
| 504 | nmdc:mga06r32_15525_c1 | 3300050510 | Bacteria | 6916 |
| 505 | nmdc:mga06r32_222695_c1 | 3300050510 | Bacteria | 1875 |
| 506 | nmdc:mga06r32_569652_c1 | 3300050510 | Bacteria | 1105 |
| 507 | nmdc:mga08y16_24168_c1 | 3300050511 | Bacteria | 6415 |
| 508 | nmdc:mga08y16_29258_c1 | 3300050511 | Bacteria | 5805 |
| 509 | nmdc:mga08y16_31876_c1 | 3300050511 | Bacteria | 5542 |
| 510 | nmdc:mga08y16_35593_c1 | 3300050511 | Bacteria | 5228 |
| 511 | nmdc:mga08y16_86973_c1 | 3300050511 | Bacteria | 3257 |
| 512 | nmdc:mga08y16_978150_c1 | 3300050511 | Bacteria | 828 |
| 513 | nmdc:mga0n895_107801_c1 | 3300050512 | Bacteria | 2799 |
| 514 | nmdc:mga0n895_108871_c1 | 3300050512 | Bacteria | 2786 |
| 515 | nmdc:mga0n895_1110_c1 | 3300050512 | Bacteria | 19640 |
| 516 | nmdc:mga0n895_123651_c1 | 3300050512 | Bacteria | 2610 |
| 517 | nmdc:mga0n895_15420_c1 | 3300050512 | Bacteria | 6967 |
| 518 | nmdc:mga0n895_175954_c1 | 3300050512 | Bacteria | 2171 |
| 519 | nmdc:mga0n895_32770_c1 | 3300050512 | Bacteria | 4988 |
| 520 | nmdc:mga0n895_420889_c1 | 3300050512 | Bacteria | 1350 |
| 521 | nmdc:mga0n895_570576_c1 | 3300050512 | Bacteria | 1136 |
| 522 | nmdc:mga08x19_2_c1 | 3300050514 | Bacteria | 741277 |
| 523 | nmdc:mga08x19_69507_c1 | 3300050514 | Unclassified | 2294 |
| 524 | nmdc:mga0a205_201817_c1 | 3300050515 | Bacteria | 1879 |
| 525 | nmdc:mga0a205_2103_c1 | 3300050515 | Bacteria | 17454 |
| 526 | nmdc:mga0a205_279592_c1 | 3300050515 | Bacteria | 1545 |
| 527 | nmdc:mga0a205_331434_c1 | 3300050515 | Bacteria | 1392 |
| 528 | nmdc:mga0a205_409923_c1 | 3300050515 | Bacteria | 1218 |
| 529 | nmdc:mga0a205_59430_c1 | 3300050515 | Bacteria | 3692 |
| 530 | nmdc:mga0a205_94195_c1 | 3300050515 | Unclassified | 2523 |
| 531 | Ga0495595_0155103 | 3300053084 | Bacteria | 1128 |
| 532 | Ga0495619_0051228 | 3300053085 | Bacteria | 2728 |
| 533 | Ga0500595_005343 | 3300053119 | Bacteria | 5618 |
| 534 | Ga0501084_0048971 | 3300054114 | Bacteria | 3537 |
| 535 | Ga0590071_000184 | 3300059421 | Bacteria | 18178 |
| 536 | Ga0590074_000189 | 3300059423 | Bacteria | 7784 |
| 537 | Ga0590075_001239 | 3300059424 | Bacteria | 6430 |
| 538 | Ga0590077_000704 | 3300059426 | Bacteria | 8838 |
| 539 | Ga0501082_0191557 | 3300060353 | Unclassified | 1779 |
| 540 | Ga0530510_0120545 | 3300061734 | Bacteria | 1925 |
| 541 | Ga0530510_0126632 | 3300061734 | Bacteria | 1878 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032126 | Ga0307415_100247326 | Ga0307415_1002473263 | 206 |
| 2 | 3300032002 | Ga0307416_100310236 | Ga0307416_1003102361 | 216 |
| 3 | 3300047472 | Ga0495686_0080704 | Ga0495686_0080704_415_1221 | 216 |
| 4 | 3300041486 | Ga0451807_0137355 | Ga0451807_0137355_323_1156 | 217 |
| 5 | 3300009553 | Ga0105249_10488688 | Ga0105249_104886882 | 219 |
| 6 | 3300037471 | Ga0395905_0145155 | Ga0395905_0145155_1202_1948 | 219 |
| 7 | 3300037471 | Ga0395905_0188973 | Ga0395905_0188973_986_1732 | 219 |
| 8 | 3300009177 | Ga0105248_10011176 | Ga0105248_100111762 | 220 |
| 9 | 3300025941 | Ga0207711_10006411 | Ga0207711_100064119 | 220 |
| 10 | 3300013297 | Ga0157378_10067437 | Ga0157378_100674372 | 222 |
| 11 | 3300032133 | Ga0316583_10040018 | Ga0316583_100400182 | 222 |
| 12 | 3300032133 | Ga0316583_10049658 | Ga0316583_100496581 | 222 |
| 13 | 3300005289 | Ga0065704_10137363 | Ga0065704_101373631 | 225 |
| 14 | 3300031251 | Ga0265327_10209083 | Ga0265327_102090831 | 225 |
| 15 | 3300046678 | Ga0495599_0177300 | Ga0495599_0177300_313_1062 | 227 |
| 16 | 3300042876 | Ga0451577_0005948 | Ga0451577_0005948_7917_8657 | 230 |
| 17 | 3300044712 | Ga0453684_0000441 | Ga0453684_0000441_49514_50254 | 230 |
| 18 | iso_pu_bacteria | 2713897090 | 2715498888 | 230 |
| 19 | iso_pu_bacteria | 2899259804 | 2899261212 | 230 |
| 20 | 3300005539 | Ga0068853_100637197 | Ga0068853_1006371971 | 233 |
| 21 | 3300009093 | Ga0105240_10099572 | Ga0105240_100995721 | 233 |
| 22 | 3300009545 | Ga0105237_10186996 | Ga0105237_101869962 | 233 |
| 23 | 3300009551 | Ga0105238_10146768 | Ga0105238_101467683 | 233 |
| 24 | 3300010375 | Ga0105239_10173167 | Ga0105239_101731673 | 233 |
| 25 | 3300025913 | Ga0207695_10032437 | Ga0207695_100324377 | 233 |
| 26 | 3300025913 | Ga0207695_10035428 | Ga0207695_100354284 | 233 |
| 27 | iso_pu_bacteria | 2929297113 | 2929298636 | 233 |
| 28 | 3300005289 | Ga0065704_10119522 | Ga0065704_101195222 | 234 |
| 29 | 3300005295 | Ga0065707_10307627 | Ga0065707_103076272 | 234 |
| 30 | 3300005336 | Ga0070680_100540020 | Ga0070680_1005400201 | 234 |
| 31 | 3300005339 | Ga0070660_100010099 | Ga0070660_1000100996 | 234 |
| 32 | 3300005406 | Ga0070703_10000223 | Ga0070703_1000022324 | 234 |
| 33 | 3300005434 | Ga0070709_10000019 | Ga0070709_1000001985 | 234 |
| 34 | 3300005439 | Ga0070711_100000071 | Ga0070711_10000007150 | 234 |
| 35 | 3300005440 | Ga0070705_100000036 | Ga0070705_10000003642 | 234 |
| 36 | 3300005440 | Ga0070705_100024644 | Ga0070705_1000246443 | 234 |
| 37 | 3300005440 | Ga0070705_100210623 | Ga0070705_1002106231 | 234 |
| 38 | 3300005440 | Ga0070705_100292108 | Ga0070705_1002921082 | 234 |
| 39 | 3300005467 | Ga0070706_100000042 | Ga0070706_10000004295 | 234 |
| 40 | 3300005468 | Ga0070707_100918298 | Ga0070707_1009182981 | 234 |
| 41 | 3300005471 | Ga0070698_100711485 | Ga0070698_1007114851 | 234 |
| 42 | 3300005518 | Ga0070699_100000088 | Ga0070699_10000008836 | 234 |
| 43 | 3300005546 | Ga0070696_100000160 | Ga0070696_10000016029 | 234 |
| 44 | 3300005546 | Ga0070696_100020973 | Ga0070696_1000209732 | 234 |
| 45 | 3300005546 | Ga0070696_100555592 | Ga0070696_1005555921 | 234 |
| 46 | 3300005547 | Ga0070693_100001018 | Ga0070693_1000010186 | 234 |
| 47 | 3300005549 | Ga0070704_100078752 | Ga0070704_1000787521 | 234 |
| 48 | 3300005549 | Ga0070704_100137481 | Ga0070704_1001374813 | 234 |
| 49 | 3300005577 | Ga0068857_100312785 | Ga0068857_1003127853 | 234 |
| 50 | 3300005617 | Ga0068859_100703660 | Ga0068859_1007036602 | 234 |
| 51 | 3300005985 | Ga0081539_10026575 | Ga0081539_100265751 | 234 |
| 52 | 3300006175 | Ga0070712_100039347 | Ga0070712_1000393475 | 234 |
| 53 | 3300006844 | Ga0075428_100007293 | Ga0075428_1000072933 | 234 |
| 54 | 3300006852 | Ga0075433_10103328 | Ga0075433_101033284 | 234 |
| 55 | 3300006852 | Ga0075433_10105300 | Ga0075433_101053003 | 234 |
| 56 | 3300006871 | Ga0075434_100461230 | Ga0075434_1004612301 | 234 |
| 57 | 3300006914 | Ga0075436_100000483 | Ga0075436_1000004837 | 234 |
| 58 | 3300006914 | Ga0075436_100025340 | Ga0075436_1000253405 | 234 |
| 59 | 3300006931 | Ga0097620_100703559 | Ga0097620_1007035592 | 234 |
| 60 | 3300009093 | Ga0105240_10005852 | Ga0105240_1000585219 | 234 |
| 61 | 3300009094 | Ga0111539_10024703 | Ga0111539_100247036 | 234 |
| 62 | 3300009147 | Ga0114129_10003742 | Ga0114129_1000374213 | 234 |
| 63 | 3300009147 | Ga0114129_10130755 | Ga0114129_101307553 | 234 |
| 64 | 3300014969 | Ga0157376_10151751 | Ga0157376_101517512 | 234 |
| 65 | 3300025885 | Ga0207653_10000235 | Ga0207653_1000023516 | 234 |
| 66 | 3300025906 | Ga0207699_10000005 | Ga0207699_10000005223 | 234 |
| 67 | 3300025910 | Ga0207684_10000061 | Ga0207684_10000061113 | 234 |
| 68 | 3300025915 | Ga0207693_10109696 | Ga0207693_101096961 | 234 |
| 69 | 3300025916 | Ga0207663_10000051 | Ga0207663_1000005113 | 234 |
| 70 | 3300025917 | Ga0207660_10302818 | Ga0207660_103028182 | 234 |
| 71 | 3300026116 | Ga0207674_10790231 | Ga0207674_107902312 | 234 |
| 72 | 3300027907 | Ga0207428_10076799 | Ga0207428_100767994 | 234 |
| 73 | 3300050507 | nmdc:mga05p37_3825_c1 | nmdc:mga05p37_3825_c1_9728_10471 | 234 |
| 74 | 3300050507 | nmdc:mga05p37_76956_c1 | nmdc:mga05p37_76956_c1_2803_3546 | 234 |
| 75 | 3300050511 | nmdc:mga08y16_31876_c1 | nmdc:mga08y16_31876_c1_3615_4358 | 234 |
| 76 | 3300050512 | nmdc:mga0n895_420889_c1 | nmdc:mga0n895_420889_c1_408_1151 | 234 |
| 77 | 3300050512 | nmdc:mga0n895_570576_c1 | nmdc:mga0n895_570576_c1_344_1087 | 234 |
| 78 | 3300050514 | nmdc:mga08x19_2_c1 | nmdc:mga08x19_2_c1_600120_600863 | 234 |
| 79 | 3300050514 | nmdc:mga08x19_69507_c1 | nmdc:mga08x19_69507_c1_1513_2256 | 234 |
| 80 | 3300050515 | nmdc:mga0a205_409923_c1 | nmdc:mga0a205_409923_c1_231_974 | 234 |
| 81 | 3300050515 | nmdc:mga0a205_59430_c1 | nmdc:mga0a205_59430_c1_431_1174 | 234 |
| 82 | 3300050515 | nmdc:mga0a205_94195_c1 | nmdc:mga0a205_94195_c1_463_1206 | 234 |
| 83 | 3300005288 | Ga0065714_10208562 | Ga0065714_102085621 | 235 |
| 84 | 3300005289 | Ga0065704_10112734 | Ga0065704_101127342 | 235 |
| 85 | 3300005290 | Ga0065712_10162156 | Ga0065712_101621562 | 235 |
| 86 | 3300005293 | Ga0065715_10151376 | Ga0065715_101513762 | 235 |
| 87 | 3300005293 | Ga0065715_10190051 | Ga0065715_101900512 | 235 |
| 88 | 3300005295 | Ga0065707_10001479 | Ga0065707_100014795 | 235 |
| 89 | 3300005328 | Ga0070676_10103756 | Ga0070676_101037563 | 235 |
| 90 | 3300005329 | Ga0070683_100042467 | Ga0070683_1000424675 | 235 |
| 91 | 3300005330 | Ga0070690_100309756 | Ga0070690_1003097561 | 235 |
| 92 | 3300005331 | Ga0070670_100005693 | Ga0070670_1000056937 | 235 |
| 93 | 3300005331 | Ga0070670_100126508 | Ga0070670_1001265084 | 235 |
| 94 | 3300005331 | Ga0070670_100365220 | Ga0070670_1003652201 | 235 |
| 95 | 3300005334 | Ga0068869_100070110 | Ga0068869_1000701102 | 235 |
| 96 | 3300005336 | Ga0070680_100123763 | Ga0070680_1001237631 | 235 |
| 97 | 3300005336 | Ga0070680_100144026 | Ga0070680_1001440262 | 235 |
| 98 | 3300005340 | Ga0070689_100004883 | Ga0070689_1000048832 | 235 |
| 99 | 3300005343 | Ga0070687_100170020 | Ga0070687_1001700202 | 235 |
| 100 | 3300005343 | Ga0070687_100186966 | Ga0070687_1001869662 | 235 |
| 101 | 3300005345 | Ga0070692_10001349 | Ga0070692_100013495 | 235 |
| 102 | 3300005345 | Ga0070692_10036489 | Ga0070692_100364893 | 235 |
| 103 | 3300005353 | Ga0070669_100002591 | Ga0070669_10000259110 | 235 |
| 104 | 3300005353 | Ga0070669_100070667 | Ga0070669_1000706672 | 235 |
| 105 | 3300005354 | Ga0070675_100000239 | Ga0070675_1000002397 | 235 |
| 106 | 3300005354 | Ga0070675_100000675 | Ga0070675_10000067512 | 235 |
| 107 | 3300005354 | Ga0070675_100001024 | Ga0070675_10000102413 | 235 |
| 108 | 3300005354 | Ga0070675_100002487 | Ga0070675_1000024875 | 235 |
| 109 | 3300005354 | Ga0070675_100050508 | Ga0070675_1000505081 | 235 |
| 110 | 3300005354 | Ga0070675_100083543 | Ga0070675_1000835433 | 235 |
| 111 | 3300005354 | Ga0070675_100383897 | Ga0070675_1003838972 | 235 |
| 112 | 3300005355 | Ga0070671_100005201 | Ga0070671_10000520112 | 235 |
| 113 | 3300005356 | Ga0070674_100412587 | Ga0070674_1004125871 | 235 |
| 114 | 3300005364 | Ga0070673_100011449 | Ga0070673_1000114496 | 235 |
| 115 | 3300005364 | Ga0070673_100064027 | Ga0070673_1000640272 | 235 |
| 116 | 3300005365 | Ga0070688_100009725 | Ga0070688_1000097257 | 235 |
| 117 | 3300005365 | Ga0070688_100066611 | Ga0070688_1000666112 | 235 |
| 118 | 3300005365 | Ga0070688_100090717 | Ga0070688_1000907172 | 235 |
| 119 | 3300005366 | Ga0070659_100270201 | Ga0070659_1002702012 | 235 |
| 120 | 3300005367 | Ga0070667_100001499 | Ga0070667_1000014996 | 235 |
| 121 | 3300005406 | Ga0070703_10045385 | Ga0070703_100453852 | 235 |
| 122 | 3300005436 | Ga0070713_100026018 | Ga0070713_1000260184 | 235 |
| 123 | 3300005438 | Ga0070701_10043244 | Ga0070701_100432443 | 235 |
| 124 | 3300005438 | Ga0070701_10052380 | Ga0070701_100523801 | 235 |
| 125 | 3300005440 | Ga0070705_100000288 | Ga0070705_10000028813 | 235 |
| 126 | 3300005440 | Ga0070705_100032846 | Ga0070705_1000328463 | 235 |
| 127 | 3300005440 | Ga0070705_100056266 | Ga0070705_1000562661 | 235 |
| 128 | 3300005440 | Ga0070705_100118788 | Ga0070705_1001187883 | 235 |
| 129 | 3300005440 | Ga0070705_100191409 | Ga0070705_1001914092 | 235 |
| 130 | 3300005441 | Ga0070700_100010664 | Ga0070700_1000106647 | 235 |
| 131 | 3300005441 | Ga0070700_100207695 | Ga0070700_1002076951 | 235 |
| 132 | 3300005441 | Ga0070700_100549644 | Ga0070700_1005496441 | 235 |
| 133 | 3300005444 | Ga0070694_100003725 | Ga0070694_1000037252 | 235 |
| 134 | 3300005444 | Ga0070694_100014189 | Ga0070694_1000141891 | 235 |
| 135 | 3300005444 | Ga0070694_100021729 | Ga0070694_1000217294 | 235 |
| 136 | 3300005444 | Ga0070694_100032377 | Ga0070694_1000323771 | 235 |
| 137 | 3300005444 | Ga0070694_100056767 | Ga0070694_1000567672 | 235 |
| 138 | 3300005444 | Ga0070694_100069869 | Ga0070694_1000698693 | 235 |
| 139 | 3300005444 | Ga0070694_100153039 | Ga0070694_1001530392 | 235 |
| 140 | 3300005456 | Ga0070678_100317790 | Ga0070678_1003177902 | 235 |
| 141 | 3300005457 | Ga0070662_100047672 | Ga0070662_1000476723 | 235 |
| 142 | 3300005457 | Ga0070662_100055980 | Ga0070662_1000559802 | 235 |
| 143 | 3300005458 | Ga0070681_10005093 | Ga0070681_100050935 | 235 |
| 144 | 3300005459 | Ga0068867_100378251 | Ga0068867_1003782511 | 235 |
| 145 | 3300005466 | Ga0070685_10144478 | Ga0070685_101444782 | 235 |
| 146 | 3300005466 | Ga0070685_10269351 | Ga0070685_102693512 | 235 |
| 147 | 3300005466 | Ga0070685_10301659 | Ga0070685_103016591 | 235 |
| 148 | 3300005466 | Ga0070685_10385744 | Ga0070685_103857441 | 235 |
| 149 | 3300005468 | Ga0070707_100037700 | Ga0070707_1000377005 | 235 |
| 150 | 3300005471 | Ga0070698_100002474 | Ga0070698_1000024746 | 235 |
| 151 | 3300005518 | Ga0070699_100000558 | Ga0070699_10000055832 | 235 |
| 152 | 3300005518 | Ga0070699_100234096 | Ga0070699_1002340963 | 235 |
| 153 | 3300005518 | Ga0070699_100281551 | Ga0070699_1002815512 | 235 |
| 154 | 3300005536 | Ga0070697_100001756 | Ga0070697_1000017567 | 235 |
| 155 | 3300005536 | Ga0070697_100075097 | Ga0070697_1000750972 | 235 |
| 156 | 3300005536 | Ga0070697_100219681 | Ga0070697_1002196811 | 235 |
| 157 | 3300005543 | Ga0070672_100014662 | Ga0070672_1000146625 | 235 |
| 158 | 3300005543 | Ga0070672_100112438 | Ga0070672_1001124384 | 235 |
| 159 | 3300005543 | Ga0070672_100135677 | Ga0070672_1001356772 | 235 |
| 160 | 3300005544 | Ga0070686_100025311 | Ga0070686_1000253114 | 235 |
| 161 | 3300005544 | Ga0070686_100118897 | Ga0070686_1001188972 | 235 |
| 162 | 3300005545 | Ga0070695_100005834 | Ga0070695_1000058343 | 235 |
| 163 | 3300005545 | Ga0070695_100033314 | Ga0070695_1000333143 | 235 |
| 164 | 3300005545 | Ga0070695_100041504 | Ga0070695_1000415043 | 235 |
| 165 | 3300005545 | Ga0070695_100176308 | Ga0070695_1001763082 | 235 |
| 166 | 3300005546 | Ga0070696_100001518 | Ga0070696_10000151815 | 235 |
| 167 | 3300005546 | Ga0070696_100001520 | Ga0070696_10000152011 | 235 |
| 168 | 3300005546 | Ga0070696_100029392 | Ga0070696_1000293923 | 235 |
| 169 | 3300005546 | Ga0070696_100072673 | Ga0070696_1000726731 | 235 |
| 170 | 3300005549 | Ga0070704_100000802 | Ga0070704_1000008024 | 235 |
| 171 | 3300005549 | Ga0070704_100001323 | Ga0070704_1000013234 | 235 |
| 172 | 3300005549 | Ga0070704_100064726 | Ga0070704_1000647262 | 235 |
| 173 | 3300005549 | Ga0070704_100067263 | Ga0070704_1000672633 | 235 |
| 174 | 3300005549 | Ga0070704_100092536 | Ga0070704_1000925362 | 235 |
| 175 | 3300005564 | Ga0070664_100075546 | Ga0070664_1000755463 | 235 |
| 176 | 3300005564 | Ga0070664_100637990 | Ga0070664_1006379901 | 235 |
| 177 | 3300005564 | Ga0070664_100836629 | Ga0070664_1008366291 | 235 |
| 178 | 3300005577 | Ga0068857_100096665 | Ga0068857_1000966653 | 235 |
| 179 | 3300005577 | Ga0068857_100233117 | Ga0068857_1002331172 | 235 |
| 180 | 3300005577 | Ga0068857_100479428 | Ga0068857_1004794281 | 235 |
| 181 | 3300005578 | Ga0068854_100061695 | Ga0068854_1000616953 | 235 |
| 182 | 3300005615 | Ga0070702_100022961 | Ga0070702_1000229614 | 235 |
| 183 | 3300005617 | Ga0068859_100001859 | Ga0068859_10000185920 | 235 |
| 184 | 3300005617 | Ga0068859_100004314 | Ga0068859_1000043141 | 235 |
| 185 | 3300005617 | Ga0068859_100020763 | Ga0068859_1000207636 | 235 |
| 186 | 3300005617 | Ga0068859_100072849 | Ga0068859_1000728491 | 235 |
| 187 | 3300005617 | Ga0068859_100451546 | Ga0068859_1004515461 | 235 |
| 188 | 3300005617 | Ga0068859_100481890 | Ga0068859_1004818902 | 235 |
| 189 | 3300005618 | Ga0068864_100097318 | Ga0068864_1000973184 | 235 |
| 190 | 3300005618 | Ga0068864_100284096 | Ga0068864_1002840961 | 235 |
| 191 | 3300005618 | Ga0068864_100415310 | Ga0068864_1004153102 | 235 |
| 192 | 3300005719 | Ga0068861_100001024 | Ga0068861_10000102415 | 235 |
| 193 | 3300005840 | Ga0068870_10002841 | Ga0068870_100028412 | 235 |
| 194 | 3300005841 | Ga0068863_100003032 | Ga0068863_10000303218 | 235 |
| 195 | 3300005841 | Ga0068863_100016991 | Ga0068863_1000169914 | 235 |
| 196 | 3300005841 | Ga0068863_100473616 | Ga0068863_1004736162 | 235 |
| 197 | 3300005842 | Ga0068858_100114672 | Ga0068858_1001146722 | 235 |
| 198 | 3300005842 | Ga0068858_100226740 | Ga0068858_1002267403 | 235 |
| 199 | 3300005842 | Ga0068858_100379717 | Ga0068858_1003797172 | 235 |
| 200 | 3300005842 | Ga0068858_100793656 | Ga0068858_1007936562 | 235 |
| 201 | 3300005843 | Ga0068860_100014506 | Ga0068860_1000145065 | 235 |
| 202 | 3300005843 | Ga0068860_100015659 | Ga0068860_1000156597 | 235 |
| 203 | 3300005843 | Ga0068860_100078115 | Ga0068860_1000781154 | 235 |
| 204 | 3300005843 | Ga0068860_100340937 | Ga0068860_1003409372 | 235 |
| 205 | 3300005844 | Ga0068862_100002475 | Ga0068862_1000024757 | 235 |
| 206 | 3300005985 | Ga0081539_10000790 | Ga0081539_100007902 | 235 |
| 207 | 3300006237 | Ga0097621_100092378 | Ga0097621_1000923784 | 235 |
| 208 | 3300006237 | Ga0097621_100228491 | Ga0097621_1002284912 | 235 |
| 209 | 3300006237 | Ga0097621_100421593 | Ga0097621_1004215932 | 235 |
| 210 | 3300006237 | Ga0097621_100427729 | Ga0097621_1004277291 | 235 |
| 211 | 3300006358 | Ga0068871_100061983 | Ga0068871_1000619834 | 235 |
| 212 | 3300006844 | Ga0075428_100002473 | Ga0075428_1000024739 | 235 |
| 213 | 3300006844 | Ga0075428_100014799 | Ga0075428_1000147994 | 235 |
| 214 | 3300006844 | Ga0075428_100037261 | Ga0075428_1000372611 | 235 |
| 215 | 3300006846 | Ga0075430_100050504 | Ga0075430_1000505042 | 235 |
| 216 | 3300006846 | Ga0075430_100353618 | Ga0075430_1003536181 | 235 |
| 217 | 3300006847 | Ga0075431_100003641 | Ga0075431_1000036414 | 235 |
| 218 | 3300006847 | Ga0075431_100032234 | Ga0075431_1000322345 | 235 |
| 219 | 3300006847 | Ga0075431_100495299 | Ga0075431_1004952991 | 235 |
| 220 | 3300006852 | Ga0075433_10022639 | Ga0075433_100226396 | 235 |
| 221 | 3300006852 | Ga0075433_10574059 | Ga0075433_105740592 | 235 |
| 222 | 3300006871 | Ga0075434_100000919 | Ga0075434_1000009195 | 235 |
| 223 | 3300006871 | Ga0075434_100017203 | Ga0075434_1000172036 | 235 |
| 224 | 3300006871 | Ga0075434_100062148 | Ga0075434_1000621482 | 235 |
| 225 | 3300006871 | Ga0075434_100102722 | Ga0075434_1001027224 | 235 |
| 226 | 3300006880 | Ga0075429_100003923 | Ga0075429_10000392313 | 235 |
| 227 | 3300006880 | Ga0075429_100827350 | Ga0075429_1008273501 | 235 |
| 228 | 3300006931 | Ga0097620_100001859 | Ga0097620_10000185920 | 235 |
| 229 | 3300006931 | Ga0097620_100004314 | Ga0097620_10000431415 | 235 |
| 230 | 3300006931 | Ga0097620_100020763 | Ga0097620_1000207633 | 235 |
| 231 | 3300006931 | Ga0097620_100072859 | Ga0097620_1000728591 | 235 |
| 232 | 3300006931 | Ga0097620_100451555 | Ga0097620_1004515551 | 235 |
| 233 | 3300006931 | Ga0097620_100481911 | Ga0097620_1004819112 | 235 |
| 234 | 3300007076 | Ga0075435_100065838 | Ga0075435_1000658381 | 235 |
| 235 | 3300007076 | Ga0075435_100122427 | Ga0075435_1001224273 | 235 |
| 236 | 3300009011 | Ga0105251_10127115 | Ga0105251_101271152 | 235 |
| 237 | 3300009094 | Ga0111539_10002588 | Ga0111539_1000258818 | 235 |
| 238 | 3300009094 | Ga0111539_10032749 | Ga0111539_100327494 | 235 |
| 239 | 3300009094 | Ga0111539_10047335 | Ga0111539_100473354 | 235 |
| 240 | 3300009094 | Ga0111539_10095648 | Ga0111539_100956482 | 235 |
| 241 | 3300009094 | Ga0111539_10174585 | Ga0111539_101745854 | 235 |
| 242 | 3300009101 | Ga0105247_10114987 | Ga0105247_101149872 | 235 |
| 243 | 3300009147 | Ga0114129_10001096 | Ga0114129_100010969 | 235 |
| 244 | 3300009147 | Ga0114129_10001790 | Ga0114129_1000179023 | 235 |
| 245 | 3300009147 | Ga0114129_10012572 | Ga0114129_100125724 | 235 |
| 246 | 3300009147 | Ga0114129_10103084 | Ga0114129_101030845 | 235 |
| 247 | 3300009147 | Ga0114129_10210393 | Ga0114129_102103934 | 235 |
| 248 | 3300009147 | Ga0114129_10245658 | Ga0114129_102456582 | 235 |
| 249 | 3300009147 | Ga0114129_10329954 | Ga0114129_103299541 | 235 |
| 250 | 3300009147 | Ga0114129_10439988 | Ga0114129_104399882 | 235 |
| 251 | 3300009148 | Ga0105243_10027395 | Ga0105243_100273955 | 235 |
| 252 | 3300009148 | Ga0105243_10031314 | Ga0105243_100313146 | 235 |
| 253 | 3300009148 | Ga0105243_10250283 | Ga0105243_102502832 | 235 |
| 254 | 3300009148 | Ga0105243_10306046 | Ga0105243_103060462 | 235 |
| 255 | 3300009176 | Ga0105242_10287045 | Ga0105242_102870452 | 235 |
| 256 | 3300009177 | Ga0105248_10000355 | Ga0105248_1000035532 | 235 |
| 257 | 3300009177 | Ga0105248_10016732 | Ga0105248_100167326 | 235 |
| 258 | 3300009177 | Ga0105248_10080722 | Ga0105248_100807224 | 235 |
| 259 | 3300009545 | Ga0105237_10085586 | Ga0105237_100855863 | 235 |
| 260 | 3300009553 | Ga0105249_10016780 | Ga0105249_100167802 | 235 |
| 261 | 3300009553 | Ga0105249_10095660 | Ga0105249_100956603 | 235 |
| 262 | 3300009553 | Ga0105249_10123254 | Ga0105249_101232542 | 235 |
| 263 | 3300011119 | Ga0105246_10585913 | Ga0105246_105859131 | 235 |
| 264 | 3300013306 | Ga0163162_10283910 | Ga0163162_102839102 | 235 |
| 265 | 3300013306 | Ga0163162_10990363 | Ga0163162_109903632 | 235 |
| 266 | 3300013308 | Ga0157375_10005573 | Ga0157375_1000557311 | 235 |
| 267 | 3300013308 | Ga0157375_11394055 | Ga0157375_113940551 | 235 |
| 268 | 3300014325 | Ga0163163_10000023 | Ga0163163_1000002384 | 235 |
| 269 | 3300014325 | Ga0163163_10043557 | Ga0163163_100435573 | 235 |
| 270 | 3300014326 | Ga0157380_10014504 | Ga0157380_100145044 | 235 |
| 271 | 3300014326 | Ga0157380_10100559 | Ga0157380_101005593 | 235 |
| 272 | 3300014326 | Ga0157380_10731013 | Ga0157380_107310132 | 235 |
| 273 | 3300014745 | Ga0157377_10034627 | Ga0157377_100346275 | 235 |
| 274 | 3300014745 | Ga0157377_10158651 | Ga0157377_101586512 | 235 |
| 275 | 3300014968 | Ga0157379_10000517 | Ga0157379_1000051724 | 235 |
| 276 | 3300014969 | Ga0157376_10156607 | Ga0157376_101566073 | 235 |
| 277 | 3300014969 | Ga0157376_10374250 | Ga0157376_103742502 | 235 |
| 278 | 3300014969 | Ga0157376_10409052 | Ga0157376_104090522 | 235 |
| 279 | 3300017792 | Ga0163161_10035588 | Ga0163161_100355885 | 235 |
| 280 | 3300017792 | Ga0163161_10182247 | Ga0163161_101822472 | 235 |
| 281 | 3300020070 | Ga0206356_10282298 | Ga0206356_102822981 | 235 |
| 282 | 3300025271 | Ga0207666_1003846 | Ga0207666_10038462 | 235 |
| 283 | 3300025315 | Ga0207697_10053047 | Ga0207697_100530472 | 235 |
| 284 | 3300025885 | Ga0207653_10059414 | Ga0207653_100594142 | 235 |
| 285 | 3300025900 | Ga0207710_10120736 | Ga0207710_101207362 | 235 |
| 286 | 3300025901 | Ga0207688_10206141 | Ga0207688_102061412 | 235 |
| 287 | 3300025903 | Ga0207680_10265629 | Ga0207680_102656292 | 235 |
| 288 | 3300025908 | Ga0207643_10035802 | Ga0207643_100358022 | 235 |
| 289 | 3300025910 | Ga0207684_10109979 | Ga0207684_101099792 | 235 |
| 290 | 3300025910 | Ga0207684_10118177 | Ga0207684_101181771 | 235 |
| 291 | 3300025910 | Ga0207684_10482389 | Ga0207684_104823892 | 235 |
| 292 | 3300025912 | Ga0207707_10022422 | Ga0207707_100224223 | 235 |
| 293 | 3300025918 | Ga0207662_10056781 | Ga0207662_100567812 | 235 |
| 294 | 3300025918 | Ga0207662_10273837 | Ga0207662_102738371 | 235 |
| 295 | 3300025918 | Ga0207662_10336210 | Ga0207662_103362101 | 235 |
| 296 | 3300025918 | Ga0207662_10504131 | Ga0207662_105041312 | 235 |
| 297 | 3300025922 | Ga0207646_10101750 | Ga0207646_101017503 | 235 |
| 298 | 3300025922 | Ga0207646_10173306 | Ga0207646_101733062 | 235 |
| 299 | 3300025923 | Ga0207681_10000705 | Ga0207681_1000070519 | 235 |
| 300 | 3300025923 | Ga0207681_10044057 | Ga0207681_100440572 | 235 |
| 301 | 3300025923 | Ga0207681_10150739 | Ga0207681_101507391 | 235 |
| 302 | 3300025923 | Ga0207681_10239972 | Ga0207681_102399722 | 235 |
| 303 | 3300025923 | Ga0207681_10256772 | Ga0207681_102567721 | 235 |
| 304 | 3300025925 | Ga0207650_10017612 | Ga0207650_100176125 | 235 |
| 305 | 3300025925 | Ga0207650_10248869 | Ga0207650_102488692 | 235 |
| 306 | 3300025925 | Ga0207650_10433596 | Ga0207650_104335962 | 235 |
| 307 | 3300025925 | Ga0207650_10577510 | Ga0207650_105775102 | 235 |
| 308 | 3300025926 | Ga0207659_10001290 | Ga0207659_1000129014 | 235 |
| 309 | 3300025926 | Ga0207659_10001420 | Ga0207659_1000142014 | 235 |
| 310 | 3300025926 | Ga0207659_10001687 | Ga0207659_100016874 | 235 |
| 311 | 3300025926 | Ga0207659_10057832 | Ga0207659_100578323 | 235 |
| 312 | 3300025926 | Ga0207659_10169798 | Ga0207659_101697982 | 235 |
| 313 | 3300025926 | Ga0207659_10496652 | Ga0207659_104966521 | 235 |
| 314 | 3300025931 | Ga0207644_10397545 | Ga0207644_103975452 | 235 |
| 315 | 3300025932 | Ga0207690_10062065 | Ga0207690_100620653 | 235 |
| 316 | 3300025933 | Ga0207706_10039316 | Ga0207706_100393162 | 235 |
| 317 | 3300025936 | Ga0207670_10018458 | Ga0207670_100184581 | 235 |
| 318 | 3300025940 | Ga0207691_10007064 | Ga0207691_100070646 | 235 |
| 319 | 3300025940 | Ga0207691_10058264 | Ga0207691_100582644 | 235 |
| 320 | 3300025940 | Ga0207691_10072170 | Ga0207691_100721701 | 235 |
| 321 | 3300025940 | Ga0207691_10478990 | Ga0207691_104789902 | 235 |
| 322 | 3300025941 | Ga0207711_10096517 | Ga0207711_100965173 | 235 |
| 323 | 3300025942 | Ga0207689_10092280 | Ga0207689_100922803 | 235 |
| 324 | 3300025942 | Ga0207689_10175941 | Ga0207689_101759412 | 235 |
| 325 | 3300025944 | Ga0207661_10361402 | Ga0207661_103614022 | 235 |
| 326 | 3300025945 | Ga0207679_10033416 | Ga0207679_100334164 | 235 |
| 327 | 3300025945 | Ga0207679_10104857 | Ga0207679_101048573 | 235 |
| 328 | 3300025945 | Ga0207679_10107508 | Ga0207679_101075083 | 235 |
| 329 | 3300025945 | Ga0207679_10760151 | Ga0207679_107601511 | 235 |
| 330 | 3300025960 | Ga0207651_10022771 | Ga0207651_100227714 | 235 |
| 331 | 3300025960 | Ga0207651_10216523 | Ga0207651_102165232 | 235 |
| 332 | 3300025960 | Ga0207651_10381816 | Ga0207651_103818161 | 235 |
| 333 | 3300025961 | Ga0207712_10066974 | Ga0207712_100669742 | 235 |
| 334 | 3300025961 | Ga0207712_10236608 | Ga0207712_102366082 | 235 |
| 335 | 3300025981 | Ga0207640_10014196 | Ga0207640_100141963 | 235 |
| 336 | 3300025981 | Ga0207640_10326307 | Ga0207640_103263072 | 235 |
| 337 | 3300025986 | Ga0207658_10034675 | Ga0207658_100346754 | 235 |
| 338 | 3300026035 | Ga0207703_10043145 | Ga0207703_100431453 | 235 |
| 339 | 3300026035 | Ga0207703_10165231 | Ga0207703_101652312 | 235 |
| 340 | 3300026075 | Ga0207708_10112634 | Ga0207708_101126342 | 235 |
| 341 | 3300026075 | Ga0207708_10514461 | Ga0207708_105144611 | 235 |
| 342 | 3300026088 | Ga0207641_10003549 | Ga0207641_100035492 | 235 |
| 343 | 3300026088 | Ga0207641_10132801 | Ga0207641_101328012 | 235 |
| 344 | 3300026088 | Ga0207641_10573872 | Ga0207641_105738722 | 235 |
| 345 | 3300026089 | Ga0207648_10003537 | Ga0207648_100035377 | 235 |
| 346 | 3300026095 | Ga0207676_10072022 | Ga0207676_100720221 | 235 |
| 347 | 3300026095 | Ga0207676_10074116 | Ga0207676_100741162 | 235 |
| 348 | 3300026095 | Ga0207676_10124903 | Ga0207676_101249033 | 235 |
| 349 | 3300026116 | Ga0207674_10028476 | Ga0207674_100284767 | 235 |
| 350 | 3300026116 | Ga0207674_10103950 | Ga0207674_101039502 | 235 |
| 351 | 3300026118 | Ga0207675_100002780 | Ga0207675_1000027809 | 235 |
| 352 | 3300026118 | Ga0207675_100016366 | Ga0207675_1000163666 | 235 |
| 353 | 3300026118 | Ga0207675_100200104 | Ga0207675_1002001042 | 235 |
| 354 | 3300026121 | Ga0207683_10170588 | Ga0207683_101705882 | 235 |
| 355 | 3300027907 | Ga0207428_10005347 | Ga0207428_100053472 | 235 |
| 356 | 3300027907 | Ga0207428_10020023 | Ga0207428_100200232 | 235 |
| 357 | 3300027907 | Ga0207428_10093232 | Ga0207428_100932322 | 235 |
| 358 | 3300027907 | Ga0207428_10102620 | Ga0207428_101026203 | 235 |
| 359 | 3300027907 | Ga0207428_10549252 | Ga0207428_105492521 | 235 |
| 360 | 3300028380 | Ga0268265_10000714 | Ga0268265_1000071417 | 235 |
| 361 | 3300028381 | Ga0268264_10001966 | Ga0268264_100019667 | 235 |
| 362 | 3300028381 | Ga0268264_10009945 | Ga0268264_100099455 | 235 |
| 363 | 3300028381 | Ga0268264_10077760 | Ga0268264_100777603 | 235 |
| 364 | 3300028381 | Ga0268264_10102874 | Ga0268264_101028744 | 235 |
| 365 | 3300031250 | Ga0265331_10039781 | Ga0265331_100397811 | 235 |
| 366 | 3300031595 | Ga0265313_10019358 | Ga0265313_100193582 | 235 |
| 367 | 3300031711 | Ga0265314_10067460 | Ga0265314_100674602 | 235 |
| 368 | 3300031728 | Ga0316578_10098934 | Ga0316578_100989341 | 235 |
| 369 | 3300031728 | Ga0316578_10175392 | Ga0316578_101753921 | 235 |
| 370 | 3300031731 | Ga0307405_10007210 | Ga0307405_100072101 | 235 |
| 371 | 3300031731 | Ga0307405_10046672 | Ga0307405_100466724 | 235 |
| 372 | 3300031731 | Ga0307405_10069489 | Ga0307405_100694894 | 235 |
| 373 | 3300031731 | Ga0307405_10071706 | Ga0307405_100717063 | 235 |
| 374 | 3300031733 | Ga0316577_10116362 | Ga0316577_101163622 | 235 |
| 375 | 3300031733 | Ga0316577_10162157 | Ga0316577_101621572 | 235 |
| 376 | 3300031733 | Ga0316577_10262783 | Ga0316577_102627832 | 235 |
| 377 | 3300031824 | Ga0307413_10002032 | Ga0307413_100020326 | 235 |
| 378 | 3300031824 | Ga0307413_10059094 | Ga0307413_100590942 | 235 |
| 379 | 3300031852 | Ga0307410_10004776 | Ga0307410_100047766 | 235 |
| 380 | 3300031852 | Ga0307410_10178860 | Ga0307410_101788601 | 235 |
| 381 | 3300031901 | Ga0307406_10008064 | Ga0307406_100080647 | 235 |
| 382 | 3300031901 | Ga0307406_10008262 | Ga0307406_100082623 | 235 |
| 383 | 3300031901 | Ga0307406_10012021 | Ga0307406_100120214 | 235 |
| 384 | 3300031901 | Ga0307406_10083915 | Ga0307406_100839152 | 235 |
| 385 | 3300031903 | Ga0307407_10005775 | Ga0307407_100057754 | 235 |
| 386 | 3300031903 | Ga0307407_10010616 | Ga0307407_100106165 | 235 |
| 387 | 3300031903 | Ga0307407_10059019 | Ga0307407_100590191 | 235 |
| 388 | 3300031911 | Ga0307412_10018616 | Ga0307412_100186164 | 235 |
| 389 | 3300031911 | Ga0307412_10028414 | Ga0307412_100284146 | 235 |
| 390 | 3300031911 | Ga0307412_10176888 | Ga0307412_101768882 | 235 |
| 391 | 3300031995 | Ga0307409_100016000 | Ga0307409_1000160003 | 235 |
| 392 | 3300031995 | Ga0307409_100033255 | Ga0307409_1000332552 | 235 |
| 393 | 3300031995 | Ga0307409_100033673 | Ga0307409_1000336733 | 235 |
| 394 | 3300031995 | Ga0307409_100344736 | Ga0307409_1003447362 | 235 |
| 395 | 3300032002 | Ga0307416_100033527 | Ga0307416_1000335275 | 235 |
| 396 | 3300032002 | Ga0307416_100076722 | Ga0307416_1000767222 | 235 |
| 397 | 3300032002 | Ga0307416_100583767 | Ga0307416_1005837671 | 235 |
| 398 | 3300032004 | Ga0307414_10047854 | Ga0307414_100478541 | 235 |
| 399 | 3300032005 | Ga0307411_10034010 | Ga0307411_100340104 | 235 |
| 400 | 3300032005 | Ga0307411_10041999 | Ga0307411_100419994 | 235 |
| 401 | 3300032005 | Ga0307411_10202339 | Ga0307411_102023392 | 235 |
| 402 | 3300032126 | Ga0307415_100012541 | Ga0307415_1000125417 | 235 |
| 403 | 3300032133 | Ga0316583_10047810 | Ga0316583_100478101 | 235 |
| 404 | 3300035088 | Ga0373940_0020405 | Ga0373940_0020405_480_1229 | 235 |
| 405 | 3300035092 | Ga0373952_0038376 | Ga0373952_0038376_169_918 | 235 |
| 406 | 3300035113 | Ga0373936_0107600 | Ga0373936_0107600_21_776 | 235 |
| 407 | 3300035114 | Ga0373939_0181600 | Ga0373939_0181600_24_767 | 235 |
| 408 | 3300035116 | Ga0373945_0044179 | Ga0373945_0044179_518_1273 | 235 |
| 409 | 3300035116 | Ga0373945_0061022 | Ga0373945_0061022_137_886 | 235 |
| 410 | 3300035170 | Ga0373943_0016323 | Ga0373943_0016323_2030_2785 | 235 |
| 411 | 3300035725 | Ga0373947_0018355 | Ga0373947_0018355_1529_2278 | 235 |
| 412 | 3300035725 | Ga0373947_0171153 | Ga0373947_0171153_499_1254 | 235 |
| 413 | 3300036401 | Ga0373937_0019700 | Ga0373937_0019700_4806_5555 | 235 |
| 414 | 3300036401 | Ga0373937_0291140 | Ga0373937_0291140_528_1277 | 235 |
| 415 | 3300036647 | Ga0316582_0080180 | Ga0316582_0080180_1012_1758 | 235 |
| 416 | 3300036647 | Ga0316582_0266535 | Ga0316582_0266535_290_1039 | 235 |
| 417 | 3300036712 | Ga0316584_0006871 | Ga0316584_0006871_5022_5771 | 235 |
| 418 | 3300036712 | Ga0316584_0024723 | Ga0316584_0024723_412_1164 | 235 |
| 419 | 3300037068 | Ga0373925_0013930 | Ga0373925_0013930_3288_4043 | 235 |
| 420 | 3300037068 | Ga0373925_0136676 | Ga0373925_0136676_991_1740 | 235 |
| 421 | 3300039062 | Ga0400483_286307 | Ga0400483_286307_3725_4459 | 235 |
| 422 | 3300039093 | Ga0400489_90685 | Ga0400489_90685_733_1482 | 235 |
| 423 | 3300042876 | Ga0451577_0004406 | Ga0451577_0004406_12602_13351 | 235 |
| 424 | 3300042876 | Ga0451577_0092441 | Ga0451577_0092441_1023_1772 | 235 |
| 425 | 3300044712 | Ga0453684_0000354 | Ga0453684_0000354_43271_44020 | 235 |
| 426 | 3300044712 | Ga0453684_0363228 | Ga0453684_0363228_617_1372 | 235 |
| 427 | 3300045051 | Ga0451576_0007133 | Ga0451576_0007133_9078_9827 | 235 |
| 428 | 3300045051 | Ga0451576_0013998 | Ga0451576_0013998_4089_4838 | 235 |
| 429 | 3300045051 | Ga0451576_0017863 | Ga0451576_0017863_3786_4535 | 235 |
| 430 | 3300045051 | Ga0451576_0023122 | Ga0451576_0023122_5216_5965 | 235 |
| 431 | 3300045051 | Ga0451576_0055845 | Ga0451576_0055845_1251_2000 | 235 |
| 432 | 3300045051 | Ga0451576_0268525 | Ga0451576_0268525_786_1535 | 235 |
| 433 | 3300045051 | Ga0451576_0360059 | Ga0451576_0360059_383_1132 | 235 |
| 434 | 3300045051 | Ga0451576_0773076 | Ga0451576_0773076_76_825 | 235 |
| 435 | 3300046455 | Ga0495603_0010906 | Ga0495603_0010906_3868_4617 | 235 |
| 436 | 3300046459 | Ga0495629_0000002 | Ga0495629_0000002_317626_318381 | 235 |
| 437 | 3300046459 | Ga0495629_0009367 | Ga0495629_0009367_2903_3652 | 235 |
| 438 | 3300046472 | Ga0495580_0039588 | Ga0495580_0039588_533_1282 | 235 |
| 439 | 3300046472 | Ga0495580_0242721 | Ga0495580_0242721_263_1018 | 235 |
| 440 | 3300046475 | Ga0495639_0001606 | Ga0495639_0001606_3978_4733 | 235 |
| 441 | 3300046491 | Ga0495584_0031423 | Ga0495584_0031423_1636_2385 | 235 |
| 442 | 3300046499 | Ga0495594_0027482 | Ga0495594_0027482_620_1369 | 235 |
| 443 | 3300046514 | Ga0495618_0007761 | Ga0495618_0007761_4854_5603 | 235 |
| 444 | 3300046523 | Ga0495644_0047878 | Ga0495644_0047878_198_947 | 235 |
| 445 | 3300046525 | Ga0495663_0005606 | Ga0495663_0005606_1297_2046 | 235 |
| 446 | 3300046526 | Ga0495666_0000363 | Ga0495666_0000363_2291_3046 | 235 |
| 447 | 3300046528 | Ga0495642_0013615 | Ga0495642_0013615_647_1396 | 235 |
| 448 | 3300046533 | Ga0495640_0129133 | Ga0495640_0129133_340_1095 | 235 |
| 449 | 3300046533 | Ga0495640_0416753 | Ga0495640_0416753_36_785 | 235 |
| 450 | 3300046535 | Ga0495586_0000300 | Ga0495586_0000300_27494_28249 | 235 |
| 451 | 3300046535 | Ga0495586_0214681 | Ga0495586_0214681_98_847 | 235 |
| 452 | 3300046537 | Ga0495598_0020498 | Ga0495598_0020498_544_1293 | 235 |
| 453 | 3300046538 | Ga0495609_0029630 | Ga0495609_0029630_510_1259 | 235 |
| 454 | 3300046539 | Ga0495621_0033932 | Ga0495621_0033932_571_1320 | 235 |
| 455 | 3300046539 | Ga0495621_0089364 | Ga0495621_0089364_284_1033 | 235 |
| 456 | 3300046543 | Ga0495645_0087860 | Ga0495645_0087860_402_1151 | 235 |
| 457 | 3300046557 | Ga0495622_0023042 | Ga0495622_0023042_2080_2835 | 235 |
| 458 | 3300046615 | Ga0495656_0164170 | Ga0495656_0164170_308_1057 | 235 |
| 459 | 3300046663 | Ga0495635_0000960 | Ga0495635_0000960_11701_12456 | 235 |
| 460 | 3300046664 | Ga0495659_0007090 | Ga0495659_0007090_2166_2915 | 235 |
| 461 | 3300046664 | Ga0495659_0007662 | Ga0495659_0007662_1077_1826 | 235 |
| 462 | 3300046664 | Ga0495659_0041931 | Ga0495659_0041931_198_947 | 235 |
| 463 | 3300046683 | Ga0495658_0049335 | Ga0495658_0049335_836_1591 | 235 |
| 464 | 3300046683 | Ga0495658_0049656 | Ga0495658_0049656_697_1446 | 235 |
| 465 | 3300046684 | Ga0495669_0025398 | Ga0495669_0025398_150_899 | 235 |
| 466 | 3300046684 | Ga0495669_0040750 | Ga0495669_0040750_233_982 | 235 |
| 467 | 3300046689 | Ga0495613_0110874 | Ga0495613_0110874_597_1352 | 235 |
| 468 | 3300046809 | Ga0495600_0014772 | Ga0495600_0014772_3571_4326 | 235 |
| 469 | 3300047315 | Ga0495581_0031930 | Ga0495581_0031930_989_1738 | 235 |
| 470 | 3300047315 | Ga0495581_0032038 | Ga0495581_0032038_1751_2506 | 235 |
| 471 | 3300047318 | Ga0495636_0005248 | Ga0495636_0005248_2131_2880 | 235 |
| 472 | 3300047318 | Ga0495636_0070696 | Ga0495636_0070696_350_1099 | 235 |
| 473 | 3300047321 | Ga0495676_0002152 | Ga0495676_0002152_534_1289 | 235 |
| 474 | 3300047321 | Ga0495676_0005978 | Ga0495676_0005978_5386_6135 | 235 |
| 475 | 3300047322 | Ga0495680_0017238 | Ga0495680_0017238_1963_2718 | 235 |
| 476 | 3300047445 | Ga0495677_0045300 | Ga0495677_0045300_205_954 | 235 |
| 477 | 3300047447 | Ga0495685_051367 | Ga0495685_051367_145_894 | 235 |
| 478 | 3300047471 | Ga0495684_0043036 | Ga0495684_0043036_732_1487 | 235 |
| 479 | 3300048915 | Ga0496112_0105430 | Ga0496112_0105430_1929_2672 | 235 |
| 480 | 3300049568 | Ga0501031_0196139 | Ga0501031_0196139_359_1108 | 235 |
| 481 | 3300049572 | Ga0501036_0250919 | Ga0501036_0250919_637_1386 | 235 |
| 482 | 3300049574 | Ga0501038_0122109 | Ga0501038_0122109_1235_1984 | 235 |
| 483 | 3300049578 | Ga0501042_0014760 | Ga0501042_0014760_1305_2054 | 235 |
| 484 | 3300049580 | Ga0501046_0066040 | Ga0501046_0066040_840_1589 | 235 |
| 485 | 3300049582 | Ga0501048_0085307 | Ga0501048_0085307_1365_2114 | 235 |
| 486 | 3300049583 | Ga0501067_0041572 | Ga0501067_0041572_1205_1954 | 235 |
| 487 | 3300049584 | Ga0501068_0078182 | Ga0501068_0078182_425_1174 | 235 |
| 488 | 3300049588 | Ga0501072_0018264 | Ga0501072_0018264_374_1123 | 235 |
| 489 | 3300049588 | Ga0501072_0262103 | Ga0501072_0262103_13_759 | 235 |
| 490 | 3300049588 | Ga0501072_0651514 | Ga0501072_0651514_26_778 | 235 |
| 491 | 3300049591 | Ga0501075_0112173 | Ga0501075_0112173_354_1103 | 235 |
| 492 | 3300049592 | Ga0501076_0033001 | Ga0501076_0033001_2675_3424 | 235 |
| 493 | 3300049672 | Ga0501239_015023 | Ga0501239_015023_112_861 | 235 |
| 494 | 3300049743 | Ga0501081_0450688 | Ga0501081_0450688_151_900 | 235 |
| 495 | 3300049824 | Ga0501045_0128103 | Ga0501045_0128103_341_1090 | 235 |
| 496 | 3300049824 | Ga0501045_0359951 | Ga0501045_0359951_113_970 | 235 |
| 497 | 3300050507 | nmdc:mga05p37_1018144_c1 | nmdc:mga05p37_1018144_c1_80_829 | 235 |
| 498 | 3300050507 | nmdc:mga05p37_135829_c1 | nmdc:mga05p37_135829_c1_803_1552 | 235 |
| 499 | 3300050507 | nmdc:mga05p37_1433_c1 | nmdc:mga05p37_1433_c1_25265_26014 | 235 |
| 500 | 3300050507 | nmdc:mga05p37_181281_c1 | nmdc:mga05p37_181281_c1_1453_2202 | 235 |
| 501 | 3300050507 | nmdc:mga05p37_287040_c1 | nmdc:mga05p37_287040_c1_293_1042 | 235 |
| 502 | 3300050507 | nmdc:mga05p37_2888_c1 | nmdc:mga05p37_2888_c1_6369_7118 | 235 |
| 503 | 3300050507 | nmdc:mga05p37_39052_c1 | nmdc:mga05p37_39052_c1_3072_3821 | 235 |
| 504 | 3300050507 | nmdc:mga05p37_40576_c1 | nmdc:mga05p37_40576_c1_4210_4965 | 235 |
| 505 | 3300050507 | nmdc:mga05p37_90897_c1 | nmdc:mga05p37_90897_c1_248_997 | 235 |
| 506 | 3300050507 | nmdc:mga05p37_92481_c1 | nmdc:mga05p37_92481_c1_1551_2300 | 235 |
| 507 | 3300050508 | nmdc:mga09592_1848_c1 | nmdc:mga09592_1848_c1_2221_2970 | 235 |
| 508 | 3300050508 | nmdc:mga09592_203864_c1 | nmdc:mga09592_203864_c1_949_1698 | 235 |
| 509 | 3300050509 | nmdc:mga0qj67_20350_c1 | nmdc:mga0qj67_20350_c1_1195_1986 | 235 |
| 510 | 3300050509 | nmdc:mga0qj67_36800_c1 | nmdc:mga0qj67_36800_c1_523_1278 | 235 |
| 511 | 3300050510 | nmdc:mga06r32_15525_c1 | nmdc:mga06r32_15525_c1_5788_6537 | 235 |
| 512 | 3300050510 | nmdc:mga06r32_222695_c1 | nmdc:mga06r32_222695_c1_423_1178 | 235 |
| 513 | 3300050510 | nmdc:mga06r32_569652_c1 | nmdc:mga06r32_569652_c1_28_777 | 235 |
| 514 | 3300050511 | nmdc:mga08y16_24168_c1 | nmdc:mga08y16_24168_c1_903_1652 | 235 |
| 515 | 3300050511 | nmdc:mga08y16_29258_c1 | nmdc:mga08y16_29258_c1_2662_3411 | 235 |
| 516 | 3300050511 | nmdc:mga08y16_35593_c1 | nmdc:mga08y16_35593_c1_1914_2669 | 235 |
| 517 | 3300050511 | nmdc:mga08y16_86973_c1 | nmdc:mga08y16_86973_c1_1698_2447 | 235 |
| 518 | 3300050511 | nmdc:mga08y16_978150_c1 | nmdc:mga08y16_978150_c1_69_818 | 235 |
| 519 | 3300050512 | nmdc:mga0n895_107801_c1 | nmdc:mga0n895_107801_c1_44_793 | 235 |
| 520 | 3300050512 | nmdc:mga0n895_108871_c1 | nmdc:mga0n895_108871_c1_1409_2158 | 235 |
| 521 | 3300050512 | nmdc:mga0n895_1110_c1 | nmdc:mga0n895_1110_c1_16108_16857 | 235 |
| 522 | 3300050512 | nmdc:mga0n895_123651_c1 | nmdc:mga0n895_123651_c1_541_1290 | 235 |
| 523 | 3300050512 | nmdc:mga0n895_15420_c1 | nmdc:mga0n895_15420_c1_814_1563 | 235 |
| 524 | 3300050512 | nmdc:mga0n895_175954_c1 | nmdc:mga0n895_175954_c1_1393_2142 | 235 |
| 525 | 3300050512 | nmdc:mga0n895_32770_c1 | nmdc:mga0n895_32770_c1_10_759 | 235 |
| 526 | 3300050515 | nmdc:mga0a205_201817_c1 | nmdc:mga0a205_201817_c1_710_1459 | 235 |
| 527 | 3300050515 | nmdc:mga0a205_2103_c1 | nmdc:mga0a205_2103_c1_8592_9341 | 235 |
| 528 | 3300050515 | nmdc:mga0a205_279592_c1 | nmdc:mga0a205_279592_c1_361_1110 | 235 |
| 529 | 3300050515 | nmdc:mga0a205_331434_c1 | nmdc:mga0a205_331434_c1_103_852 | 235 |
| 530 | 3300053084 | Ga0495595_0155103 | Ga0495595_0155103_211_960 | 235 |
| 531 | 3300053085 | Ga0495619_0051228 | Ga0495619_0051228_1548_2303 | 235 |
| 532 | 3300053119 | Ga0500595_005343 | Ga0500595_005343_767_1516 | 235 |
| 533 | 3300054114 | Ga0501084_0048971 | Ga0501084_0048971_1318_2067 | 235 |
| 534 | 3300059421 | Ga0590071_000184 | Ga0590071_000184_14128_14877 | 235 |
| 535 | 3300059423 | Ga0590074_000189 | Ga0590074_000189_3050_3799 | 235 |
| 536 | 3300059424 | Ga0590075_001239 | Ga0590075_001239_4364_5113 | 235 |
| 537 | 3300059426 | Ga0590077_000704 | Ga0590077_000704_3034_3783 | 235 |
| 538 | 3300060353 | Ga0501082_0191557 | Ga0501082_0191557_660_1409 | 235 |
| 539 | 3300061734 | Ga0530510_0120545 | Ga0530510_0120545_338_1087 | 235 |
| 540 | 3300061734 | Ga0530510_0126632 | Ga0530510_0126632_961_1710 | 235 |
| 541 | iso_pu_bacteria | 2643221644 | 2644243614 | 236 |
| 542 | 3300003775 | Ga0055524_1000302 | Ga0055524_100030234 | 240 |
| 543 | 3300042156 | Ga0439446_0051611 | Ga0439446_0051611_319_1041 | 240 |
| 544 | 3300042157 | Ga0439458_0028596 | Ga0439458_0028596_41_814 | 240 |
| 545 | 3300042531 | Ga0450918_000954 | Ga0450918_000954_1844_2566 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lfp-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus | 0.8693 | 18 | 240 |
| 4f3q-assembly1.cif.gz_A | structure of a yebc family protein (cbu_1566) from coxiella burnetii | 0.8615 | 6 | 240 |
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.8557 | 3 | 240 |
| 4f3q-assembly1.cif.gz_A | structure of a yebc family protein (cbu_1566) from coxiella burnetii | 0.8448 | 6 | 240 |
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.828 | 3 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mw7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9695 | 28 | 75 | 1.10.10.200 |
| 1lfpA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9623 | 83 | 240 | 3.30.70.980 |
| 4f3qA03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9391 | 130 | 205 | 3.30.70.980 |
| 4f3qA03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9273 | 130 | 205 | 3.30.70.980 |
| 1lfpA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9197 | 19 | 79 | 1.10.10.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q8P6E3-F1-model_v4 | Probable transcriptional regulatory protein XCC3027 | 0.9918 | 18 | 237 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-A0A2D6IY08-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9907 | 125 | 240 |
GO:0003677
GO:0005829 |
| AF-A0A377V8M7-F1-model_v4 | Probable transcriptional regulatory protein YebC | 0.9823 | 83 | 190 |
GO:0005829
|
| AF-A0A3B9L7U6-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9811 | 62 | 240 |
GO:0003677
GO:0005829 |
| AF-A0A536RP66-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9802 | 1 | 135 |
GO:0003677
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar