F461920

General Info

Members Datasets Scaffolds Average Seq Length
545 250 541 248

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0359951|Ga0501045_0359951_113_970
Length 285
Sequence MKRFRPSSTASTWARIERSARRADFRQPIAHARIFAMSGHSKWHSIKHKKAAIDAKRGKAFTQIIKEITVAARSGGGDPNFNPRLRLAVDKAKAENMPKDNIERAIKKGTGELEGFNLEEVNYEGYGPGGVAVFMQATTDNRNRTVGEVRHLFAKYGGNLGESGSVGWMFDKKGYIVIERKNASEETLLEIVLEAGGEDVKEDGSNWEIYTAPEAFQAVRDALKSKGIAIAAEEVGMIPQTSVKLEGKQAQQMLKLMEALEEHDDVTHVWANFDIEEKEIEAAIS

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
3 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
4 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
176 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.18
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0.18
Rhizoplane 0.37
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1000302 3300003775 Bacteria 47410
2 Ga0065714_10208562 3300005288 Bacteria 873
3 Ga0065704_10112734 3300005289 Bacteria 1928
4 Ga0065704_10119522 3300005289 Bacteria 1773
5 Ga0065704_10137363 3300005289 Unclassified 1556
6 Ga0065712_10162156 3300005290 Bacteria 1295
7 Ga0065715_10151376 3300005293 Bacteria 1725
8 Ga0065715_10190051 3300005293 Bacteria 1421
9 Ga0065707_10001479 3300005295 Bacteria 9195
10 Ga0065707_10307627 3300005295 Bacteria 987
11 Ga0070676_10103756 3300005328 Bacteria 1761
12 Ga0070683_100042467 3300005329 Bacteria 4186
13 Ga0070690_100309756 3300005330 Bacteria 1135
14 Ga0070670_100005693 3300005331 Bacteria 10524
15 Ga0070670_100126508 3300005331 Bacteria 2206
16 Ga0070670_100365220 3300005331 Bacteria 1270
17 Ga0068869_100070110 3300005334 Bacteria 2593
18 Ga0070680_100123763 3300005336 Bacteria 2160
19 Ga0070680_100144026 3300005336 Bacteria 1999
20 Ga0070680_100540020 3300005336 Bacteria 999
21 Ga0070660_100010099 3300005339 Bacteria 6661
22 Ga0070689_100004883 3300005340 Bacteria 9101
23 Ga0070687_100170020 3300005343 Bacteria 1296
24 Ga0070687_100186966 3300005343 Bacteria 1245
25 Ga0070692_10001349 3300005345 Bacteria 8852
26 Ga0070692_10036489 3300005345 Bacteria 2495
27 Ga0070669_100002591 3300005353 Bacteria 13067
28 Ga0070669_100070667 3300005353 Bacteria 2581
29 Ga0070675_100000239 3300005354 Bacteria 35505
30 Ga0070675_100000675 3300005354 Bacteria 23691
31 Ga0070675_100001024 3300005354 Bacteria 20115
32 Ga0070675_100002487 3300005354 Bacteria 13793
33 Ga0070675_100050508 3300005354 Bacteria 3414
34 Ga0070675_100083543 3300005354 Unclassified 2666
35 Ga0070675_100383897 3300005354 Bacteria 1251
36 Ga0070671_100005201 3300005355 Bacteria 10367
37 Ga0070674_100412587 3300005356 Bacteria 1106
38 Ga0070673_100011449 3300005364 Bacteria 6052
39 Ga0070673_100064027 3300005364 Bacteria 2928
40 Ga0070688_100009725 3300005365 Bacteria 5277
41 Ga0070688_100066611 3300005365 Bacteria 2292
42 Ga0070688_100090717 3300005365 Bacteria 1996
43 Ga0070659_100270201 3300005366 Bacteria 1412
44 Ga0070667_100001499 3300005367 Bacteria 20904
45 Ga0070703_10000223 3300005406 Bacteria 27460
46 Ga0070703_10045385 3300005406 Bacteria 1386
47 Ga0070709_10000019 3300005434 Bacteria 142246
48 Ga0070713_100026018 3300005436 Bacteria 4587
49 Ga0070701_10043244 3300005438 Bacteria 2303
50 Ga0070701_10052380 3300005438 Bacteria 2120
51 Ga0070711_100000071 3300005439 Bacteria 58870
52 Ga0070705_100000036 3300005440 Bacteria 67281
53 Ga0070705_100000288 3300005440 Bacteria 30044
54 Ga0070705_100024644 3300005440 Bacteria 3251
55 Ga0070705_100032846 3300005440 Bacteria 2887
56 Ga0070705_100056266 3300005440 Bacteria 2316
57 Ga0070705_100118788 3300005440 Bacteria 1703
58 Ga0070705_100191409 3300005440 Bacteria 1394
59 Ga0070705_100210623 3300005440 Bacteria 1339
60 Ga0070705_100292108 3300005440 Unclassified 1164
61 Ga0070700_100010664 3300005441 Bacteria 5075
62 Ga0070700_100207695 3300005441 Bacteria 1380
63 Ga0070700_100549644 3300005441 Bacteria 897
64 Ga0070694_100003725 3300005444 Bacteria 9092
65 Ga0070694_100014189 3300005444 Bacteria 4985
66 Ga0070694_100021729 3300005444 Bacteria 4105
67 Ga0070694_100032377 3300005444 Bacteria 3434
68 Ga0070694_100056767 3300005444 Bacteria 2660
69 Ga0070694_100069869 3300005444 Bacteria 2416
70 Ga0070694_100153039 3300005444 Bacteria 1686
71 Ga0070678_100317790 3300005456 Bacteria 1329
72 Ga0070662_100047672 3300005457 Bacteria 3083
73 Ga0070662_100055980 3300005457 Bacteria 2863
74 Ga0070681_10005093 3300005458 Bacteria 12679
75 Ga0068867_100378251 3300005459 Bacteria 1189
76 Ga0070685_10144478 3300005466 Bacteria 1501
77 Ga0070685_10269351 3300005466 Bacteria 1136
78 Ga0070685_10301659 3300005466 Bacteria 1080
79 Ga0070685_10385744 3300005466 Bacteria 966
80 Ga0070706_100000042 3300005467 Bacteria 147128
81 Ga0070707_100037700 3300005468 Bacteria 4615
82 Ga0070707_100918298 3300005468 Unclassified 840
83 Ga0070698_100002474 3300005471 Bacteria 20388
84 Ga0070698_100711485 3300005471 Bacteria 947
85 Ga0070699_100000088 3300005518 Bacteria 88268
86 Ga0070699_100000558 3300005518 Bacteria 35133
87 Ga0070699_100234096 3300005518 Bacteria 1638
88 Ga0070699_100281551 3300005518 Bacteria 1489
89 Ga0070697_100001756 3300005536 Bacteria 16543
90 Ga0070697_100075097 3300005536 Bacteria 2778
91 Ga0070697_100219681 3300005536 Bacteria 1619
92 Ga0068853_100637197 3300005539 Bacteria 1014
93 Ga0070672_100014662 3300005543 Bacteria 5560
94 Ga0070672_100112438 3300005543 Bacteria 2221
95 Ga0070672_100135677 3300005543 Bacteria 2026
96 Ga0070686_100025311 3300005544 Bacteria 3570
97 Ga0070686_100118897 3300005544 Bacteria 1812
98 Ga0070695_100005834 3300005545 Bacteria 7262
99 Ga0070695_100033314 3300005545 Bacteria 3223
100 Ga0070695_100041504 3300005545 Bacteria 2917
101 Ga0070695_100176308 3300005545 Bacteria 1511
102 Ga0070696_100000160 3300005546 Bacteria 37837
103 Ga0070696_100001518 3300005546 Bacteria 15229
104 Ga0070696_100001520 3300005546 Bacteria 15227
105 Ga0070696_100020973 3300005546 Bacteria 4429
106 Ga0070696_100029392 3300005546 Bacteria 3756
107 Ga0070696_100072673 3300005546 Bacteria 2423
108 Ga0070696_100555592 3300005546 Bacteria 920
109 Ga0070693_100001018 3300005547 Bacteria 12489
110 Ga0070704_100000802 3300005549 Bacteria 15581
111 Ga0070704_100001323 3300005549 Bacteria 13119
112 Ga0070704_100064726 3300005549 Bacteria 2629
113 Ga0070704_100067263 3300005549 Bacteria 2587
114 Ga0070704_100078752 3300005549 Bacteria 2419
115 Ga0070704_100092536 3300005549 Bacteria 2257
116 Ga0070704_100137481 3300005549 Bacteria 1903
117 Ga0070664_100075546 3300005564 Bacteria 2894
118 Ga0070664_100637990 3300005564 Bacteria 989
119 Ga0070664_100836629 3300005564 Bacteria 861
120 Ga0068857_100096665 3300005577 Bacteria 2647
121 Ga0068857_100233117 3300005577 Bacteria 1684
122 Ga0068857_100312785 3300005577 Bacteria 1449
123 Ga0068857_100479428 3300005577 Bacteria 1165
124 Ga0068854_100061695 3300005578 Bacteria 2716
125 Ga0070702_100022961 3300005615 Bacteria 3308
126 Ga0068859_100001859 3300005617 Bacteria 21461
127 Ga0068859_100004314 3300005617 Bacteria 14503
128 Ga0068859_100020763 3300005617 Bacteria 6592
129 Ga0068859_100072849 3300005617 Bacteria 3472
130 Ga0068859_100451546 3300005617 Bacteria 1382
131 Ga0068859_100481890 3300005617 Bacteria 1336
132 Ga0068859_100703660 3300005617 Bacteria 1101
133 Ga0068864_100097318 3300005618 Bacteria 2605
134 Ga0068864_100284096 3300005618 Bacteria 1545
135 Ga0068864_100415310 3300005618 Bacteria 1281
136 Ga0068861_100001024 3300005719 Bacteria 17105
137 Ga0068870_10002841 3300005840 Bacteria 7291
138 Ga0068863_100003032 3300005841 Bacteria 16605
139 Ga0068863_100016991 3300005841 Bacteria 6978
140 Ga0068863_100473616 3300005841 Bacteria 1231
141 Ga0068858_100114672 3300005842 Bacteria 2518
142 Ga0068858_100226740 3300005842 Bacteria 1771
143 Ga0068858_100379717 3300005842 Bacteria 1356
144 Ga0068858_100793656 3300005842 Bacteria 924
145 Ga0068860_100014506 3300005843 Bacteria 7712
146 Ga0068860_100015659 3300005843 Bacteria 7403
147 Ga0068860_100078115 3300005843 Unclassified 3148
148 Ga0068860_100340937 3300005843 Bacteria 1474
149 Ga0068862_100002475 3300005844 Bacteria 16354
150 Ga0081539_10000790 3300005985 Bacteria 61618
151 Ga0081539_10026575 3300005985 Bacteria 3689
152 Ga0070712_100039347 3300006175 Bacteria 3236
153 Ga0097621_100092378 3300006237 Bacteria 2534
154 Ga0097621_100228491 3300006237 Bacteria 1624
155 Ga0097621_100421593 3300006237 Bacteria 1198
156 Ga0097621_100427729 3300006237 Bacteria 1189
157 Ga0068871_100061983 3300006358 Bacteria 3056
158 Ga0075428_100002473 3300006844 Bacteria 20060
159 Ga0075428_100007293 3300006844 Bacteria 12246
160 Ga0075428_100014799 3300006844 Bacteria 8669
161 Ga0075428_100037261 3300006844 Bacteria 5355
162 Ga0075430_100050504 3300006846 Bacteria 3507
163 Ga0075430_100353618 3300006846 Bacteria 1213
164 Ga0075431_100003641 3300006847 Bacteria 14938
165 Ga0075431_100032234 3300006847 Bacteria 5400
166 Ga0075431_100495299 3300006847 Bacteria 1214
167 Ga0075433_10022639 3300006852 Bacteria 5277
168 Ga0075433_10103328 3300006852 Bacteria 2524
169 Ga0075433_10105300 3300006852 Unclassified 2499
170 Ga0075433_10574059 3300006852 Bacteria 991
171 Ga0075434_100000919 3300006871 Bacteria 23605
172 Ga0075434_100017203 3300006871 Bacteria 6961
173 Ga0075434_100062148 3300006871 Bacteria 3717
174 Ga0075434_100102722 3300006871 Bacteria 2866
175 Ga0075434_100461230 3300006871 Bacteria 1292
176 Ga0075429_100003923 3300006880 Bacteria 12713
177 Ga0075429_100827350 3300006880 Bacteria 811
178 Ga0075436_100000483 3300006914 Bacteria 25759
179 Ga0075436_100025340 3300006914 Bacteria 4081
180 Ga0097620_100001859 3300006931 Bacteria 21461
181 Ga0097620_100004314 3300006931 Bacteria 14503
182 Ga0097620_100020763 3300006931 Bacteria 6592
183 Ga0097620_100072859 3300006931 Bacteria 3472
184 Ga0097620_100451555 3300006931 Bacteria 1382
185 Ga0097620_100481911 3300006931 Bacteria 1336
186 Ga0097620_100703559 3300006931 Bacteria 1101
187 Ga0075435_100065838 3300007076 Bacteria 2946
188 Ga0075435_100122427 3300007076 Bacteria 2171
189 Ga0105251_10127115 3300009011 Bacteria 1157
190 Ga0105240_10005852 3300009093 Bacteria 18231
191 Ga0105240_10099572 3300009093 Bacteria 3538
192 Ga0111539_10002588 3300009094 Bacteria 23957
193 Ga0111539_10024703 3300009094 Bacteria 7370
194 Ga0111539_10032749 3300009094 Bacteria 6312
195 Ga0111539_10047335 3300009094 Bacteria 5139
196 Ga0111539_10095648 3300009094 Bacteria 3489
197 Ga0111539_10174585 3300009094 Bacteria 2510
198 Ga0105247_10114987 3300009101 Bacteria 1736
199 Ga0114129_10001096 3300009147 Bacteria 35569
200 Ga0114129_10001790 3300009147 Bacteria 29271
201 Ga0114129_10003742 3300009147 Bacteria 21453
202 Ga0114129_10012572 3300009147 Bacteria 12055
203 Ga0114129_10103084 3300009147 Bacteria 3945
204 Ga0114129_10130755 3300009147 Bacteria 3448
205 Ga0114129_10210393 3300009147 Bacteria 2629
206 Ga0114129_10245658 3300009147 Bacteria 2404
207 Ga0114129_10329954 3300009147 Bacteria 2026
208 Ga0114129_10439988 3300009147 Bacteria 1712
209 Ga0105243_10027395 3300009148 Bacteria 4366
210 Ga0105243_10031314 3300009148 Bacteria 4101
211 Ga0105243_10250283 3300009148 Bacteria 1581
212 Ga0105243_10306046 3300009148 Bacteria 1442
213 Ga0105242_10287045 3300009176 Bacteria 1497
214 Ga0105248_10000355 3300009177 Bacteria 53533
215 Ga0105248_10011176 3300009177 Bacteria 9902
216 Ga0105248_10016732 3300009177 Bacteria 8075
217 Ga0105248_10080722 3300009177 Bacteria 3656
218 Ga0105237_10085586 3300009545 Bacteria 3142
219 Ga0105237_10186996 3300009545 Bacteria 2071
220 Ga0105238_10146768 3300009551 Bacteria 2335
221 Ga0105249_10016780 3300009553 Bacteria 6498
222 Ga0105249_10095660 3300009553 Bacteria 2785
223 Ga0105249_10123254 3300009553 Bacteria 2465
224 Ga0105249_10488688 3300009553 Bacteria 1275
225 Ga0105239_10173167 3300010375 Bacteria 2414
226 Ga0105246_10585913 3300011119 Bacteria 961
227 Ga0157378_10067437 3300013297 Bacteria 3207
228 Ga0163162_10283910 3300013306 Bacteria 1787
229 Ga0163162_10990363 3300013306 Bacteria 950
230 Ga0157375_10005573 3300013308 Bacteria 10954
231 Ga0157375_11394055 3300013308 Bacteria 825
232 Ga0163163_10000023 3300014325 Bacteria 185843
233 Ga0163163_10043557 3300014325 Bacteria 4400
234 Ga0157380_10014504 3300014326 Bacteria 5766
235 Ga0157380_10100559 3300014326 Unclassified 2407
236 Ga0157380_10731013 3300014326 Bacteria 999
237 Ga0157377_10034627 3300014745 Bacteria 2763
238 Ga0157377_10158651 3300014745 Bacteria 1405
239 Ga0157379_10000517 3300014968 Bacteria 31255
240 Ga0157376_10151751 3300014969 Bacteria 2090
241 Ga0157376_10156607 3300014969 Unclassified 2061
242 Ga0157376_10374250 3300014969 Bacteria 1370
243 Ga0157376_10409052 3300014969 Bacteria 1314
244 Ga0163161_10035588 3300017792 Bacteria 3564
245 Ga0163161_10182247 3300017792 Bacteria 1611
246 Ga0206356_10282298 3300020070 Bacteria 881
247 Ga0207666_1003846 3300025271 Bacteria 1859
248 Ga0207697_10053047 3300025315 Bacteria 1679
249 Ga0207653_10000235 3300025885 Bacteria 36762
250 Ga0207653_10059414 3300025885 Bacteria 1287
251 Ga0207710_10120736 3300025900 Bacteria 1251
252 Ga0207688_10206141 3300025901 Bacteria 1180
253 Ga0207680_10265629 3300025903 Bacteria 1189
254 Ga0207699_10000005 3300025906 Bacteria 534560
255 Ga0207643_10035802 3300025908 Bacteria 2784
256 Ga0207684_10000061 3300025910 Bacteria 203286
257 Ga0207684_10109979 3300025910 Bacteria 2359
258 Ga0207684_10118177 3300025910 Bacteria 2272
259 Ga0207684_10482389 3300025910 Bacteria 1063
260 Ga0207707_10022422 3300025912 Bacteria 5520
261 Ga0207695_10032437 3300025913 Bacteria 5715
262 Ga0207695_10035428 3300025913 Bacteria 5411
263 Ga0207693_10109696 3300025915 Bacteria 2164
264 Ga0207663_10000051 3300025916 Bacteria 63011
265 Ga0207660_10302818 3300025917 Bacteria 1273
266 Ga0207662_10056781 3300025918 Unclassified 2339
267 Ga0207662_10273837 3300025918 Bacteria 1115
268 Ga0207662_10336210 3300025918 Bacteria 1011
269 Ga0207662_10504131 3300025918 Bacteria 834
270 Ga0207646_10101750 3300025922 Bacteria 2576
271 Ga0207646_10173306 3300025922 Bacteria 1948
272 Ga0207681_10000705 3300025923 Bacteria 21963
273 Ga0207681_10044057 3300025923 Bacteria 2989
274 Ga0207681_10150739 3300025923 Bacteria 1742
275 Ga0207681_10239972 3300025923 Bacteria 1410
276 Ga0207681_10256772 3300025923 Unclassified 1367
277 Ga0207650_10017612 3300025925 Bacteria 5003
278 Ga0207650_10248869 3300025925 Bacteria 1438
279 Ga0207650_10433596 3300025925 Bacteria 1092
280 Ga0207650_10577510 3300025925 Bacteria 944
281 Ga0207659_10001290 3300025926 Bacteria 14972
282 Ga0207659_10001420 3300025926 Bacteria 14274
283 Ga0207659_10001687 3300025926 Bacteria 13104
284 Ga0207659_10057832 3300025926 Unclassified 2782
285 Ga0207659_10169798 3300025926 Bacteria 1720
286 Ga0207659_10496652 3300025926 Bacteria 1032
287 Ga0207644_10397545 3300025931 Bacteria 1126
288 Ga0207690_10062065 3300025932 Bacteria 2543
289 Ga0207706_10039316 3300025933 Bacteria 4193
290 Ga0207670_10018458 3300025936 Bacteria 4240
291 Ga0207691_10007064 3300025940 Bacteria 10834
292 Ga0207691_10058264 3300025940 Bacteria 3513
293 Ga0207691_10072170 3300025940 Bacteria 3114
294 Ga0207691_10478990 3300025940 Bacteria 1058
295 Ga0207711_10006411 3300025941 Bacteria 9915
296 Ga0207711_10096517 3300025941 Bacteria 2609
297 Ga0207689_10092280 3300025942 Bacteria 2487
298 Ga0207689_10175941 3300025942 Bacteria 1765
299 Ga0207661_10361402 3300025944 Bacteria 1311
300 Ga0207679_10033416 3300025945 Bacteria 3619
301 Ga0207679_10104857 3300025945 Bacteria 2219
302 Ga0207679_10107508 3300025945 Bacteria 2195
303 Ga0207679_10760151 3300025945 Bacteria 882
304 Ga0207651_10022771 3300025960 Bacteria 3839
305 Ga0207651_10216523 3300025960 Bacteria 1545
306 Ga0207651_10381816 3300025960 Bacteria 1194
307 Ga0207712_10066974 3300025961 Bacteria 2569
308 Ga0207712_10236608 3300025961 Bacteria 1469
309 Ga0207640_10014196 3300025981 Bacteria 4579
310 Ga0207640_10326307 3300025981 Bacteria 1224
311 Ga0207658_10034675 3300025986 Bacteria 3608
312 Ga0207703_10043145 3300026035 Bacteria 3618
313 Ga0207703_10165231 3300026035 Bacteria 1941
314 Ga0207708_10112634 3300026075 Bacteria 2113
315 Ga0207708_10514461 3300026075 Bacteria 1005
316 Ga0207641_10003549 3300026088 Bacteria 13792
317 Ga0207641_10132801 3300026088 Bacteria 2237
318 Ga0207641_10573872 3300026088 Bacteria 1102
319 Ga0207648_10003537 3300026089 Bacteria 16338
320 Ga0207676_10072022 3300026095 Bacteria 2776
321 Ga0207676_10074116 3300026095 Bacteria 2741
322 Ga0207676_10124903 3300026095 Bacteria 2177
323 Ga0207674_10028476 3300026116 Bacteria 5897
324 Ga0207674_10103950 3300026116 Bacteria 2819
325 Ga0207674_10790231 3300026116 Bacteria 916
326 Ga0207675_100002780 3300026118 Bacteria 17190
327 Ga0207675_100016366 3300026118 Bacteria 6923
328 Ga0207675_100200104 3300026118 Bacteria 1918
329 Ga0207683_10170588 3300026121 Bacteria 1970
330 Ga0207428_10005347 3300027907 Bacteria 11972
331 Ga0207428_10020023 3300027907 Bacteria 5697
332 Ga0207428_10076799 3300027907 Bacteria 2615
333 Ga0207428_10093232 3300027907 Bacteria 2336
334 Ga0207428_10102620 3300027907 Unclassified 2209
335 Ga0207428_10549252 3300027907 Bacteria 836
336 Ga0268265_10000714 3300028380 Bacteria 32686
337 Ga0268264_10001966 3300028381 Bacteria 18469
338 Ga0268264_10009945 3300028381 Bacteria 7875
339 Ga0268264_10077760 3300028381 Unclassified 2827
340 Ga0268264_10102874 3300028381 Bacteria 2486
341 Ga0265331_10039781 3300031250 Bacteria 2291
342 Ga0265327_10209083 3300031251 Bacteria 881
343 Ga0265313_10019358 3300031595 Bacteria 3790
344 Ga0265314_10067460 3300031711 Bacteria 2410
345 Ga0316578_10098934 3300031728 Bacteria 1748
346 Ga0316578_10175392 3300031728 Unclassified 1292
347 Ga0307405_10007210 3300031731 Bacteria 5538
348 Ga0307405_10046672 3300031731 Bacteria 2663
349 Ga0307405_10069489 3300031731 Unclassified 2258
350 Ga0307405_10071706 3300031731 Bacteria 2230
351 Ga0316577_10116362 3300031733 Bacteria 1501
352 Ga0316577_10162157 3300031733 Bacteria 1261
353 Ga0316577_10262783 3300031733 Bacteria 976
354 Ga0307413_10002032 3300031824 Bacteria 8053
355 Ga0307413_10059094 3300031824 Bacteria 2354
356 Ga0307410_10004776 3300031852 Bacteria 7070
357 Ga0307410_10178860 3300031852 Bacteria 1604
358 Ga0307406_10008064 3300031901 Bacteria 5866
359 Ga0307406_10008262 3300031901 Bacteria 5802
360 Ga0307406_10012021 3300031901 Bacteria 4924
361 Ga0307406_10083915 3300031901 Bacteria 2126
362 Ga0307407_10005775 3300031903 Bacteria 5412
363 Ga0307407_10010616 3300031903 Bacteria 4352
364 Ga0307407_10059019 3300031903 Bacteria 2232
365 Ga0307412_10018616 3300031911 Bacteria 4184
366 Ga0307412_10028414 3300031911 Bacteria 3498
367 Ga0307412_10176888 3300031911 Bacteria 1601
368 Ga0307409_100016000 3300031995 Unclassified 4947
369 Ga0307409_100033255 3300031995 Bacteria 3750
370 Ga0307409_100033673 3300031995 Bacteria 3731
371 Ga0307409_100344736 3300031995 Bacteria 1403
372 Ga0307416_100033527 3300032002 Bacteria 3894
373 Ga0307416_100076722 3300032002 Bacteria 2802
374 Ga0307416_100310236 3300032002 Bacteria 1574
375 Ga0307416_100583767 3300032002 Bacteria 1195
376 Ga0307414_10047854 3300032004 Bacteria 2946
377 Ga0307411_10034010 3300032005 Bacteria 3167
378 Ga0307411_10041999 3300032005 Bacteria 2914
379 Ga0307411_10202339 3300032005 Bacteria 1526
380 Ga0307415_100012541 3300032126 Bacteria 4905
381 Ga0307415_100247326 3300032126 Bacteria 1447
382 Ga0316583_10040018 3300032133 Bacteria 1660
383 Ga0316583_10047810 3300032133 Bacteria 1508
384 Ga0316583_10049658 3300032133 Bacteria 1477
385 Ga0373940_0020405 3300035088 Bacteria 1684
386 Ga0373952_0038376 3300035092 Bacteria 1097
387 Ga0373936_0107600 3300035113 Bacteria 1181
388 Ga0373939_0181600 3300035114 Bacteria 785
389 Ga0373945_0044179 3300035116 Bacteria 1619
390 Ga0373945_0061022 3300035116 Bacteria 1408
391 Ga0373943_0016323 3300035170 Bacteria 3385
392 Ga0373947_0018355 3300035725 Bacteria 4026
393 Ga0373947_0171153 3300035725 Bacteria 1409
394 Ga0373937_0019700 3300036401 Bacteria 6042
395 Ga0373937_0291140 3300036401 Bacteria 1543
396 Ga0316582_0080180 3300036647 Bacteria 2130
397 Ga0316582_0266535 3300036647 Bacteria 1175
398 Ga0316584_0006871 3300036712 Bacteria 7733
399 Ga0316584_0024723 3300036712 Bacteria 4399
400 Ga0373925_0013930 3300037068 Bacteria 5821
401 Ga0373925_0136676 3300037068 Bacteria 1916
402 Ga0395905_0145155 3300037471 Bacteria 2233
403 Ga0395905_0188973 3300037471 Bacteria 1933
404 Ga0400483_286307 3300039062 Bacteria 4703
405 Ga0400489_90685 3300039093 Bacteria 1584
406 Ga0451807_0137355 3300041486 Bacteria 1225
407 Ga0439446_0051611 3300042156 Bacteria 1229
408 Ga0439458_0028596 3300042157 Bacteria 1320
409 Ga0450918_000954 3300042531 Bacteria 6042
410 Ga0451577_0004406 3300042876 Bacteria 14882
411 Ga0451577_0005948 3300042876 Bacteria 12302
412 Ga0451577_0092441 3300042876 Bacteria 2701
413 Ga0453684_0000354 3300044712 Bacteria 190599
414 Ga0453684_0000441 3300044712 Bacteria 169068
415 Ga0453684_0363228 3300044712 Bacteria 1629
416 Ga0451576_0007133 3300045051 Bacteria 13485
417 Ga0451576_0013998 3300045051 Bacteria 8945
418 Ga0451576_0017863 3300045051 Bacteria 7792
419 Ga0451576_0023122 3300045051 Bacteria 6734
420 Ga0451576_0055845 3300045051 Bacteria 4130
421 Ga0451576_0268525 3300045051 Bacteria 1783
422 Ga0451576_0360059 3300045051 Bacteria 1523
423 Ga0451576_0773076 3300045051 Bacteria 1009
424 Ga0495603_0010906 3300046455 Bacteria 5513
425 Ga0495629_0000002 3300046459 Bacteria 686975
426 Ga0495629_0009367 3300046459 Bacteria 7162
427 Ga0495580_0039588 3300046472 Bacteria 3373
428 Ga0495580_0242721 3300046472 Bacteria 1235
429 Ga0495639_0001606 3300046475 Bacteria 10062
430 Ga0495584_0031423 3300046491 Bacteria 2687
431 Ga0495594_0027482 3300046499 Bacteria 3066
432 Ga0495618_0007761 3300046514 Bacteria 6492
433 Ga0495644_0047878 3300046523 Bacteria 1605
434 Ga0495663_0005606 3300046525 Bacteria 3477
435 Ga0495666_0000363 3300046526 Bacteria 19992
436 Ga0495642_0013615 3300046528 Bacteria 3150
437 Ga0495640_0129133 3300046533 Bacteria 1637
438 Ga0495640_0416753 3300046533 Bacteria 823
439 Ga0495586_0000300 3300046535 Bacteria 31407
440 Ga0495586_0214681 3300046535 Bacteria 1092
441 Ga0495598_0020498 3300046537 Bacteria 1746
442 Ga0495609_0029630 3300046538 Bacteria 2492
443 Ga0495621_0033932 3300046539 Bacteria 1761
444 Ga0495621_0089364 3300046539 Bacteria 1160
445 Ga0495645_0087860 3300046543 Bacteria 2224
446 Ga0495622_0023042 3300046557 Bacteria 2902
447 Ga0495656_0164170 3300046615 Bacteria 1081
448 Ga0495635_0000960 3300046663 Bacteria 19029
449 Ga0495659_0007090 3300046664 Bacteria 3546
450 Ga0495659_0007662 3300046664 Bacteria 3422
451 Ga0495659_0041931 3300046664 Bacteria 1636
452 Ga0495599_0177300 3300046678 Bacteria 1314
453 Ga0495658_0049335 3300046683 Bacteria 2377
454 Ga0495658_0049656 3300046683 Bacteria 2370
455 Ga0495669_0025398 3300046684 Bacteria 2584
456 Ga0495669_0040750 3300046684 Bacteria 2061
457 Ga0495613_0110874 3300046689 Bacteria 1977
458 Ga0495600_0014772 3300046809 Bacteria 4924
459 Ga0495581_0031930 3300047315 Bacteria 3051
460 Ga0495581_0032038 3300047315 Bacteria 3044
461 Ga0495636_0005248 3300047318 Bacteria 5086
462 Ga0495636_0070696 3300047318 Bacteria 1489
463 Ga0495676_0002152 3300047321 Bacteria 17431
464 Ga0495676_0005978 3300047321 Bacteria 11182
465 Ga0495680_0017238 3300047322 Bacteria 6175
466 Ga0495677_0045300 3300047445 Bacteria 1613
467 Ga0495685_051367 3300047447 Bacteria 1398
468 Ga0495684_0043036 3300047471 Bacteria 3457
469 Ga0495686_0080704 3300047472 Bacteria 1988
470 Ga0496112_0105430 3300048915 Bacteria 2789
471 Ga0501031_0196139 3300049568 Bacteria 1318
472 Ga0501036_0250919 3300049572 Unclassified 1483
473 Ga0501038_0122109 3300049574 Unclassified 2147
474 Ga0501042_0014760 3300049578 Bacteria 5334
475 Ga0501046_0066040 3300049580 Unclassified 2821
476 Ga0501048_0085307 3300049582 Unclassified 2227
477 Ga0501067_0041572 3300049583 Bacteria 2553
478 Ga0501068_0078182 3300049584 Bacteria 2027
479 Ga0501072_0018264 3300049588 Bacteria 5396
480 Ga0501072_0262103 3300049588 Bacteria 1376
481 Ga0501072_0651514 3300049588 Bacteria 829
482 Ga0501075_0112173 3300049591 Unclassified 2073
483 Ga0501076_0033001 3300049592 Bacteria 4042
484 Ga0501239_015023 3300049672 Bacteria 901
485 Ga0501081_0450688 3300049743 Bacteria 956
486 Ga0501045_0128103 3300049824 Unclassified 1886
487 Ga0501045_0359951 3300049824 Bacteria 1083
488 nmdc:mga05p37_1018144_c1 3300050507 Bacteria 878
489 nmdc:mga05p37_135829_c1 3300050507 Bacteria 3016
490 nmdc:mga05p37_1433_c1 3300050507 Bacteria 27689
491 nmdc:mga05p37_181281_c1 3300050507 Bacteria 2562
492 nmdc:mga05p37_287040_c1 3300050507 Bacteria 1960
493 nmdc:mga05p37_2888_c1 3300050507 Bacteria 19926
494 nmdc:mga05p37_3825_c1 3300050507 Bacteria 17603
495 nmdc:mga05p37_39052_c1 3300050507 Bacteria 5824
496 nmdc:mga05p37_40576_c1 3300050507 Bacteria 5716
497 nmdc:mga05p37_76956_c1 3300050507 Bacteria 4107
498 nmdc:mga05p37_90897_c1 3300050507 Bacteria 3762
499 nmdc:mga05p37_92481_c1 3300050507 Bacteria 3727
500 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
501 nmdc:mga09592_203864_c1 3300050508 Bacteria 1713
502 nmdc:mga0qj67_20350_c1 3300050509 Bacteria 5078
503 nmdc:mga0qj67_36800_c1 3300050509 Bacteria 3831
504 nmdc:mga06r32_15525_c1 3300050510 Bacteria 6916
505 nmdc:mga06r32_222695_c1 3300050510 Bacteria 1875
506 nmdc:mga06r32_569652_c1 3300050510 Bacteria 1105
507 nmdc:mga08y16_24168_c1 3300050511 Bacteria 6415
508 nmdc:mga08y16_29258_c1 3300050511 Bacteria 5805
509 nmdc:mga08y16_31876_c1 3300050511 Bacteria 5542
510 nmdc:mga08y16_35593_c1 3300050511 Bacteria 5228
511 nmdc:mga08y16_86973_c1 3300050511 Bacteria 3257
512 nmdc:mga08y16_978150_c1 3300050511 Bacteria 828
513 nmdc:mga0n895_107801_c1 3300050512 Bacteria 2799
514 nmdc:mga0n895_108871_c1 3300050512 Bacteria 2786
515 nmdc:mga0n895_1110_c1 3300050512 Bacteria 19640
516 nmdc:mga0n895_123651_c1 3300050512 Bacteria 2610
517 nmdc:mga0n895_15420_c1 3300050512 Bacteria 6967
518 nmdc:mga0n895_175954_c1 3300050512 Bacteria 2171
519 nmdc:mga0n895_32770_c1 3300050512 Bacteria 4988
520 nmdc:mga0n895_420889_c1 3300050512 Bacteria 1350
521 nmdc:mga0n895_570576_c1 3300050512 Bacteria 1136
522 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
523 nmdc:mga08x19_69507_c1 3300050514 Unclassified 2294
524 nmdc:mga0a205_201817_c1 3300050515 Bacteria 1879
525 nmdc:mga0a205_2103_c1 3300050515 Bacteria 17454
526 nmdc:mga0a205_279592_c1 3300050515 Bacteria 1545
527 nmdc:mga0a205_331434_c1 3300050515 Bacteria 1392
528 nmdc:mga0a205_409923_c1 3300050515 Bacteria 1218
529 nmdc:mga0a205_59430_c1 3300050515 Bacteria 3692
530 nmdc:mga0a205_94195_c1 3300050515 Unclassified 2523
531 Ga0495595_0155103 3300053084 Bacteria 1128
532 Ga0495619_0051228 3300053085 Bacteria 2728
533 Ga0500595_005343 3300053119 Bacteria 5618
534 Ga0501084_0048971 3300054114 Bacteria 3537
535 Ga0590071_000184 3300059421 Bacteria 18178
536 Ga0590074_000189 3300059423 Bacteria 7784
537 Ga0590075_001239 3300059424 Bacteria 6430
538 Ga0590077_000704 3300059426 Bacteria 8838
539 Ga0501082_0191557 3300060353 Unclassified 1779
540 Ga0530510_0120545 3300061734 Bacteria 1925
541 Ga0530510_0126632 3300061734 Bacteria 1878

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100247326 Ga0307415_1002473263 206
2 3300032002 Ga0307416_100310236 Ga0307416_1003102361 216
3 3300047472 Ga0495686_0080704 Ga0495686_0080704_415_1221 216
4 3300041486 Ga0451807_0137355 Ga0451807_0137355_323_1156 217
5 3300009553 Ga0105249_10488688 Ga0105249_104886882 219
6 3300037471 Ga0395905_0145155 Ga0395905_0145155_1202_1948 219
7 3300037471 Ga0395905_0188973 Ga0395905_0188973_986_1732 219
8 3300009177 Ga0105248_10011176 Ga0105248_100111762 220
9 3300025941 Ga0207711_10006411 Ga0207711_100064119 220
10 3300013297 Ga0157378_10067437 Ga0157378_100674372 222
11 3300032133 Ga0316583_10040018 Ga0316583_100400182 222
12 3300032133 Ga0316583_10049658 Ga0316583_100496581 222
13 3300005289 Ga0065704_10137363 Ga0065704_101373631 225
14 3300031251 Ga0265327_10209083 Ga0265327_102090831 225
15 3300046678 Ga0495599_0177300 Ga0495599_0177300_313_1062 227
16 3300042876 Ga0451577_0005948 Ga0451577_0005948_7917_8657 230
17 3300044712 Ga0453684_0000441 Ga0453684_0000441_49514_50254 230
18 iso_pu_bacteria 2713897090 2715498888 230
19 iso_pu_bacteria 2899259804 2899261212 230
20 3300005539 Ga0068853_100637197 Ga0068853_1006371971 233
21 3300009093 Ga0105240_10099572 Ga0105240_100995721 233
22 3300009545 Ga0105237_10186996 Ga0105237_101869962 233
23 3300009551 Ga0105238_10146768 Ga0105238_101467683 233
24 3300010375 Ga0105239_10173167 Ga0105239_101731673 233
25 3300025913 Ga0207695_10032437 Ga0207695_100324377 233
26 3300025913 Ga0207695_10035428 Ga0207695_100354284 233
27 iso_pu_bacteria 2929297113 2929298636 233
28 3300005289 Ga0065704_10119522 Ga0065704_101195222 234
29 3300005295 Ga0065707_10307627 Ga0065707_103076272 234
30 3300005336 Ga0070680_100540020 Ga0070680_1005400201 234
31 3300005339 Ga0070660_100010099 Ga0070660_1000100996 234
32 3300005406 Ga0070703_10000223 Ga0070703_1000022324 234
33 3300005434 Ga0070709_10000019 Ga0070709_1000001985 234
34 3300005439 Ga0070711_100000071 Ga0070711_10000007150 234
35 3300005440 Ga0070705_100000036 Ga0070705_10000003642 234
36 3300005440 Ga0070705_100024644 Ga0070705_1000246443 234
37 3300005440 Ga0070705_100210623 Ga0070705_1002106231 234
38 3300005440 Ga0070705_100292108 Ga0070705_1002921082 234
39 3300005467 Ga0070706_100000042 Ga0070706_10000004295 234
40 3300005468 Ga0070707_100918298 Ga0070707_1009182981 234
41 3300005471 Ga0070698_100711485 Ga0070698_1007114851 234
42 3300005518 Ga0070699_100000088 Ga0070699_10000008836 234
43 3300005546 Ga0070696_100000160 Ga0070696_10000016029 234
44 3300005546 Ga0070696_100020973 Ga0070696_1000209732 234
45 3300005546 Ga0070696_100555592 Ga0070696_1005555921 234
46 3300005547 Ga0070693_100001018 Ga0070693_1000010186 234
47 3300005549 Ga0070704_100078752 Ga0070704_1000787521 234
48 3300005549 Ga0070704_100137481 Ga0070704_1001374813 234
49 3300005577 Ga0068857_100312785 Ga0068857_1003127853 234
50 3300005617 Ga0068859_100703660 Ga0068859_1007036602 234
51 3300005985 Ga0081539_10026575 Ga0081539_100265751 234
52 3300006175 Ga0070712_100039347 Ga0070712_1000393475 234
53 3300006844 Ga0075428_100007293 Ga0075428_1000072933 234
54 3300006852 Ga0075433_10103328 Ga0075433_101033284 234
55 3300006852 Ga0075433_10105300 Ga0075433_101053003 234
56 3300006871 Ga0075434_100461230 Ga0075434_1004612301 234
57 3300006914 Ga0075436_100000483 Ga0075436_1000004837 234
58 3300006914 Ga0075436_100025340 Ga0075436_1000253405 234
59 3300006931 Ga0097620_100703559 Ga0097620_1007035592 234
60 3300009093 Ga0105240_10005852 Ga0105240_1000585219 234
61 3300009094 Ga0111539_10024703 Ga0111539_100247036 234
62 3300009147 Ga0114129_10003742 Ga0114129_1000374213 234
63 3300009147 Ga0114129_10130755 Ga0114129_101307553 234
64 3300014969 Ga0157376_10151751 Ga0157376_101517512 234
65 3300025885 Ga0207653_10000235 Ga0207653_1000023516 234
66 3300025906 Ga0207699_10000005 Ga0207699_10000005223 234
67 3300025910 Ga0207684_10000061 Ga0207684_10000061113 234
68 3300025915 Ga0207693_10109696 Ga0207693_101096961 234
69 3300025916 Ga0207663_10000051 Ga0207663_1000005113 234
70 3300025917 Ga0207660_10302818 Ga0207660_103028182 234
71 3300026116 Ga0207674_10790231 Ga0207674_107902312 234
72 3300027907 Ga0207428_10076799 Ga0207428_100767994 234
73 3300050507 nmdc:mga05p37_3825_c1 nmdc:mga05p37_3825_c1_9728_10471 234
74 3300050507 nmdc:mga05p37_76956_c1 nmdc:mga05p37_76956_c1_2803_3546 234
75 3300050511 nmdc:mga08y16_31876_c1 nmdc:mga08y16_31876_c1_3615_4358 234
76 3300050512 nmdc:mga0n895_420889_c1 nmdc:mga0n895_420889_c1_408_1151 234
77 3300050512 nmdc:mga0n895_570576_c1 nmdc:mga0n895_570576_c1_344_1087 234
78 3300050514 nmdc:mga08x19_2_c1 nmdc:mga08x19_2_c1_600120_600863 234
79 3300050514 nmdc:mga08x19_69507_c1 nmdc:mga08x19_69507_c1_1513_2256 234
80 3300050515 nmdc:mga0a205_409923_c1 nmdc:mga0a205_409923_c1_231_974 234
81 3300050515 nmdc:mga0a205_59430_c1 nmdc:mga0a205_59430_c1_431_1174 234
82 3300050515 nmdc:mga0a205_94195_c1 nmdc:mga0a205_94195_c1_463_1206 234
83 3300005288 Ga0065714_10208562 Ga0065714_102085621 235
84 3300005289 Ga0065704_10112734 Ga0065704_101127342 235
85 3300005290 Ga0065712_10162156 Ga0065712_101621562 235
86 3300005293 Ga0065715_10151376 Ga0065715_101513762 235
87 3300005293 Ga0065715_10190051 Ga0065715_101900512 235
88 3300005295 Ga0065707_10001479 Ga0065707_100014795 235
89 3300005328 Ga0070676_10103756 Ga0070676_101037563 235
90 3300005329 Ga0070683_100042467 Ga0070683_1000424675 235
91 3300005330 Ga0070690_100309756 Ga0070690_1003097561 235
92 3300005331 Ga0070670_100005693 Ga0070670_1000056937 235
93 3300005331 Ga0070670_100126508 Ga0070670_1001265084 235
94 3300005331 Ga0070670_100365220 Ga0070670_1003652201 235
95 3300005334 Ga0068869_100070110 Ga0068869_1000701102 235
96 3300005336 Ga0070680_100123763 Ga0070680_1001237631 235
97 3300005336 Ga0070680_100144026 Ga0070680_1001440262 235
98 3300005340 Ga0070689_100004883 Ga0070689_1000048832 235
99 3300005343 Ga0070687_100170020 Ga0070687_1001700202 235
100 3300005343 Ga0070687_100186966 Ga0070687_1001869662 235
101 3300005345 Ga0070692_10001349 Ga0070692_100013495 235
102 3300005345 Ga0070692_10036489 Ga0070692_100364893 235
103 3300005353 Ga0070669_100002591 Ga0070669_10000259110 235
104 3300005353 Ga0070669_100070667 Ga0070669_1000706672 235
105 3300005354 Ga0070675_100000239 Ga0070675_1000002397 235
106 3300005354 Ga0070675_100000675 Ga0070675_10000067512 235
107 3300005354 Ga0070675_100001024 Ga0070675_10000102413 235
108 3300005354 Ga0070675_100002487 Ga0070675_1000024875 235
109 3300005354 Ga0070675_100050508 Ga0070675_1000505081 235
110 3300005354 Ga0070675_100083543 Ga0070675_1000835433 235
111 3300005354 Ga0070675_100383897 Ga0070675_1003838972 235
112 3300005355 Ga0070671_100005201 Ga0070671_10000520112 235
113 3300005356 Ga0070674_100412587 Ga0070674_1004125871 235
114 3300005364 Ga0070673_100011449 Ga0070673_1000114496 235
115 3300005364 Ga0070673_100064027 Ga0070673_1000640272 235
116 3300005365 Ga0070688_100009725 Ga0070688_1000097257 235
117 3300005365 Ga0070688_100066611 Ga0070688_1000666112 235
118 3300005365 Ga0070688_100090717 Ga0070688_1000907172 235
119 3300005366 Ga0070659_100270201 Ga0070659_1002702012 235
120 3300005367 Ga0070667_100001499 Ga0070667_1000014996 235
121 3300005406 Ga0070703_10045385 Ga0070703_100453852 235
122 3300005436 Ga0070713_100026018 Ga0070713_1000260184 235
123 3300005438 Ga0070701_10043244 Ga0070701_100432443 235
124 3300005438 Ga0070701_10052380 Ga0070701_100523801 235
125 3300005440 Ga0070705_100000288 Ga0070705_10000028813 235
126 3300005440 Ga0070705_100032846 Ga0070705_1000328463 235
127 3300005440 Ga0070705_100056266 Ga0070705_1000562661 235
128 3300005440 Ga0070705_100118788 Ga0070705_1001187883 235
129 3300005440 Ga0070705_100191409 Ga0070705_1001914092 235
130 3300005441 Ga0070700_100010664 Ga0070700_1000106647 235
131 3300005441 Ga0070700_100207695 Ga0070700_1002076951 235
132 3300005441 Ga0070700_100549644 Ga0070700_1005496441 235
133 3300005444 Ga0070694_100003725 Ga0070694_1000037252 235
134 3300005444 Ga0070694_100014189 Ga0070694_1000141891 235
135 3300005444 Ga0070694_100021729 Ga0070694_1000217294 235
136 3300005444 Ga0070694_100032377 Ga0070694_1000323771 235
137 3300005444 Ga0070694_100056767 Ga0070694_1000567672 235
138 3300005444 Ga0070694_100069869 Ga0070694_1000698693 235
139 3300005444 Ga0070694_100153039 Ga0070694_1001530392 235
140 3300005456 Ga0070678_100317790 Ga0070678_1003177902 235
141 3300005457 Ga0070662_100047672 Ga0070662_1000476723 235
142 3300005457 Ga0070662_100055980 Ga0070662_1000559802 235
143 3300005458 Ga0070681_10005093 Ga0070681_100050935 235
144 3300005459 Ga0068867_100378251 Ga0068867_1003782511 235
145 3300005466 Ga0070685_10144478 Ga0070685_101444782 235
146 3300005466 Ga0070685_10269351 Ga0070685_102693512 235
147 3300005466 Ga0070685_10301659 Ga0070685_103016591 235
148 3300005466 Ga0070685_10385744 Ga0070685_103857441 235
149 3300005468 Ga0070707_100037700 Ga0070707_1000377005 235
150 3300005471 Ga0070698_100002474 Ga0070698_1000024746 235
151 3300005518 Ga0070699_100000558 Ga0070699_10000055832 235
152 3300005518 Ga0070699_100234096 Ga0070699_1002340963 235
153 3300005518 Ga0070699_100281551 Ga0070699_1002815512 235
154 3300005536 Ga0070697_100001756 Ga0070697_1000017567 235
155 3300005536 Ga0070697_100075097 Ga0070697_1000750972 235
156 3300005536 Ga0070697_100219681 Ga0070697_1002196811 235
157 3300005543 Ga0070672_100014662 Ga0070672_1000146625 235
158 3300005543 Ga0070672_100112438 Ga0070672_1001124384 235
159 3300005543 Ga0070672_100135677 Ga0070672_1001356772 235
160 3300005544 Ga0070686_100025311 Ga0070686_1000253114 235
161 3300005544 Ga0070686_100118897 Ga0070686_1001188972 235
162 3300005545 Ga0070695_100005834 Ga0070695_1000058343 235
163 3300005545 Ga0070695_100033314 Ga0070695_1000333143 235
164 3300005545 Ga0070695_100041504 Ga0070695_1000415043 235
165 3300005545 Ga0070695_100176308 Ga0070695_1001763082 235
166 3300005546 Ga0070696_100001518 Ga0070696_10000151815 235
167 3300005546 Ga0070696_100001520 Ga0070696_10000152011 235
168 3300005546 Ga0070696_100029392 Ga0070696_1000293923 235
169 3300005546 Ga0070696_100072673 Ga0070696_1000726731 235
170 3300005549 Ga0070704_100000802 Ga0070704_1000008024 235
171 3300005549 Ga0070704_100001323 Ga0070704_1000013234 235
172 3300005549 Ga0070704_100064726 Ga0070704_1000647262 235
173 3300005549 Ga0070704_100067263 Ga0070704_1000672633 235
174 3300005549 Ga0070704_100092536 Ga0070704_1000925362 235
175 3300005564 Ga0070664_100075546 Ga0070664_1000755463 235
176 3300005564 Ga0070664_100637990 Ga0070664_1006379901 235
177 3300005564 Ga0070664_100836629 Ga0070664_1008366291 235
178 3300005577 Ga0068857_100096665 Ga0068857_1000966653 235
179 3300005577 Ga0068857_100233117 Ga0068857_1002331172 235
180 3300005577 Ga0068857_100479428 Ga0068857_1004794281 235
181 3300005578 Ga0068854_100061695 Ga0068854_1000616953 235
182 3300005615 Ga0070702_100022961 Ga0070702_1000229614 235
183 3300005617 Ga0068859_100001859 Ga0068859_10000185920 235
184 3300005617 Ga0068859_100004314 Ga0068859_1000043141 235
185 3300005617 Ga0068859_100020763 Ga0068859_1000207636 235
186 3300005617 Ga0068859_100072849 Ga0068859_1000728491 235
187 3300005617 Ga0068859_100451546 Ga0068859_1004515461 235
188 3300005617 Ga0068859_100481890 Ga0068859_1004818902 235
189 3300005618 Ga0068864_100097318 Ga0068864_1000973184 235
190 3300005618 Ga0068864_100284096 Ga0068864_1002840961 235
191 3300005618 Ga0068864_100415310 Ga0068864_1004153102 235
192 3300005719 Ga0068861_100001024 Ga0068861_10000102415 235
193 3300005840 Ga0068870_10002841 Ga0068870_100028412 235
194 3300005841 Ga0068863_100003032 Ga0068863_10000303218 235
195 3300005841 Ga0068863_100016991 Ga0068863_1000169914 235
196 3300005841 Ga0068863_100473616 Ga0068863_1004736162 235
197 3300005842 Ga0068858_100114672 Ga0068858_1001146722 235
198 3300005842 Ga0068858_100226740 Ga0068858_1002267403 235
199 3300005842 Ga0068858_100379717 Ga0068858_1003797172 235
200 3300005842 Ga0068858_100793656 Ga0068858_1007936562 235
201 3300005843 Ga0068860_100014506 Ga0068860_1000145065 235
202 3300005843 Ga0068860_100015659 Ga0068860_1000156597 235
203 3300005843 Ga0068860_100078115 Ga0068860_1000781154 235
204 3300005843 Ga0068860_100340937 Ga0068860_1003409372 235
205 3300005844 Ga0068862_100002475 Ga0068862_1000024757 235
206 3300005985 Ga0081539_10000790 Ga0081539_100007902 235
207 3300006237 Ga0097621_100092378 Ga0097621_1000923784 235
208 3300006237 Ga0097621_100228491 Ga0097621_1002284912 235
209 3300006237 Ga0097621_100421593 Ga0097621_1004215932 235
210 3300006237 Ga0097621_100427729 Ga0097621_1004277291 235
211 3300006358 Ga0068871_100061983 Ga0068871_1000619834 235
212 3300006844 Ga0075428_100002473 Ga0075428_1000024739 235
213 3300006844 Ga0075428_100014799 Ga0075428_1000147994 235
214 3300006844 Ga0075428_100037261 Ga0075428_1000372611 235
215 3300006846 Ga0075430_100050504 Ga0075430_1000505042 235
216 3300006846 Ga0075430_100353618 Ga0075430_1003536181 235
217 3300006847 Ga0075431_100003641 Ga0075431_1000036414 235
218 3300006847 Ga0075431_100032234 Ga0075431_1000322345 235
219 3300006847 Ga0075431_100495299 Ga0075431_1004952991 235
220 3300006852 Ga0075433_10022639 Ga0075433_100226396 235
221 3300006852 Ga0075433_10574059 Ga0075433_105740592 235
222 3300006871 Ga0075434_100000919 Ga0075434_1000009195 235
223 3300006871 Ga0075434_100017203 Ga0075434_1000172036 235
224 3300006871 Ga0075434_100062148 Ga0075434_1000621482 235
225 3300006871 Ga0075434_100102722 Ga0075434_1001027224 235
226 3300006880 Ga0075429_100003923 Ga0075429_10000392313 235
227 3300006880 Ga0075429_100827350 Ga0075429_1008273501 235
228 3300006931 Ga0097620_100001859 Ga0097620_10000185920 235
229 3300006931 Ga0097620_100004314 Ga0097620_10000431415 235
230 3300006931 Ga0097620_100020763 Ga0097620_1000207633 235
231 3300006931 Ga0097620_100072859 Ga0097620_1000728591 235
232 3300006931 Ga0097620_100451555 Ga0097620_1004515551 235
233 3300006931 Ga0097620_100481911 Ga0097620_1004819112 235
234 3300007076 Ga0075435_100065838 Ga0075435_1000658381 235
235 3300007076 Ga0075435_100122427 Ga0075435_1001224273 235
236 3300009011 Ga0105251_10127115 Ga0105251_101271152 235
237 3300009094 Ga0111539_10002588 Ga0111539_1000258818 235
238 3300009094 Ga0111539_10032749 Ga0111539_100327494 235
239 3300009094 Ga0111539_10047335 Ga0111539_100473354 235
240 3300009094 Ga0111539_10095648 Ga0111539_100956482 235
241 3300009094 Ga0111539_10174585 Ga0111539_101745854 235
242 3300009101 Ga0105247_10114987 Ga0105247_101149872 235
243 3300009147 Ga0114129_10001096 Ga0114129_100010969 235
244 3300009147 Ga0114129_10001790 Ga0114129_1000179023 235
245 3300009147 Ga0114129_10012572 Ga0114129_100125724 235
246 3300009147 Ga0114129_10103084 Ga0114129_101030845 235
247 3300009147 Ga0114129_10210393 Ga0114129_102103934 235
248 3300009147 Ga0114129_10245658 Ga0114129_102456582 235
249 3300009147 Ga0114129_10329954 Ga0114129_103299541 235
250 3300009147 Ga0114129_10439988 Ga0114129_104399882 235
251 3300009148 Ga0105243_10027395 Ga0105243_100273955 235
252 3300009148 Ga0105243_10031314 Ga0105243_100313146 235
253 3300009148 Ga0105243_10250283 Ga0105243_102502832 235
254 3300009148 Ga0105243_10306046 Ga0105243_103060462 235
255 3300009176 Ga0105242_10287045 Ga0105242_102870452 235
256 3300009177 Ga0105248_10000355 Ga0105248_1000035532 235
257 3300009177 Ga0105248_10016732 Ga0105248_100167326 235
258 3300009177 Ga0105248_10080722 Ga0105248_100807224 235
259 3300009545 Ga0105237_10085586 Ga0105237_100855863 235
260 3300009553 Ga0105249_10016780 Ga0105249_100167802 235
261 3300009553 Ga0105249_10095660 Ga0105249_100956603 235
262 3300009553 Ga0105249_10123254 Ga0105249_101232542 235
263 3300011119 Ga0105246_10585913 Ga0105246_105859131 235
264 3300013306 Ga0163162_10283910 Ga0163162_102839102 235
265 3300013306 Ga0163162_10990363 Ga0163162_109903632 235
266 3300013308 Ga0157375_10005573 Ga0157375_1000557311 235
267 3300013308 Ga0157375_11394055 Ga0157375_113940551 235
268 3300014325 Ga0163163_10000023 Ga0163163_1000002384 235
269 3300014325 Ga0163163_10043557 Ga0163163_100435573 235
270 3300014326 Ga0157380_10014504 Ga0157380_100145044 235
271 3300014326 Ga0157380_10100559 Ga0157380_101005593 235
272 3300014326 Ga0157380_10731013 Ga0157380_107310132 235
273 3300014745 Ga0157377_10034627 Ga0157377_100346275 235
274 3300014745 Ga0157377_10158651 Ga0157377_101586512 235
275 3300014968 Ga0157379_10000517 Ga0157379_1000051724 235
276 3300014969 Ga0157376_10156607 Ga0157376_101566073 235
277 3300014969 Ga0157376_10374250 Ga0157376_103742502 235
278 3300014969 Ga0157376_10409052 Ga0157376_104090522 235
279 3300017792 Ga0163161_10035588 Ga0163161_100355885 235
280 3300017792 Ga0163161_10182247 Ga0163161_101822472 235
281 3300020070 Ga0206356_10282298 Ga0206356_102822981 235
282 3300025271 Ga0207666_1003846 Ga0207666_10038462 235
283 3300025315 Ga0207697_10053047 Ga0207697_100530472 235
284 3300025885 Ga0207653_10059414 Ga0207653_100594142 235
285 3300025900 Ga0207710_10120736 Ga0207710_101207362 235
286 3300025901 Ga0207688_10206141 Ga0207688_102061412 235
287 3300025903 Ga0207680_10265629 Ga0207680_102656292 235
288 3300025908 Ga0207643_10035802 Ga0207643_100358022 235
289 3300025910 Ga0207684_10109979 Ga0207684_101099792 235
290 3300025910 Ga0207684_10118177 Ga0207684_101181771 235
291 3300025910 Ga0207684_10482389 Ga0207684_104823892 235
292 3300025912 Ga0207707_10022422 Ga0207707_100224223 235
293 3300025918 Ga0207662_10056781 Ga0207662_100567812 235
294 3300025918 Ga0207662_10273837 Ga0207662_102738371 235
295 3300025918 Ga0207662_10336210 Ga0207662_103362101 235
296 3300025918 Ga0207662_10504131 Ga0207662_105041312 235
297 3300025922 Ga0207646_10101750 Ga0207646_101017503 235
298 3300025922 Ga0207646_10173306 Ga0207646_101733062 235
299 3300025923 Ga0207681_10000705 Ga0207681_1000070519 235
300 3300025923 Ga0207681_10044057 Ga0207681_100440572 235
301 3300025923 Ga0207681_10150739 Ga0207681_101507391 235
302 3300025923 Ga0207681_10239972 Ga0207681_102399722 235
303 3300025923 Ga0207681_10256772 Ga0207681_102567721 235
304 3300025925 Ga0207650_10017612 Ga0207650_100176125 235
305 3300025925 Ga0207650_10248869 Ga0207650_102488692 235
306 3300025925 Ga0207650_10433596 Ga0207650_104335962 235
307 3300025925 Ga0207650_10577510 Ga0207650_105775102 235
308 3300025926 Ga0207659_10001290 Ga0207659_1000129014 235
309 3300025926 Ga0207659_10001420 Ga0207659_1000142014 235
310 3300025926 Ga0207659_10001687 Ga0207659_100016874 235
311 3300025926 Ga0207659_10057832 Ga0207659_100578323 235
312 3300025926 Ga0207659_10169798 Ga0207659_101697982 235
313 3300025926 Ga0207659_10496652 Ga0207659_104966521 235
314 3300025931 Ga0207644_10397545 Ga0207644_103975452 235
315 3300025932 Ga0207690_10062065 Ga0207690_100620653 235
316 3300025933 Ga0207706_10039316 Ga0207706_100393162 235
317 3300025936 Ga0207670_10018458 Ga0207670_100184581 235
318 3300025940 Ga0207691_10007064 Ga0207691_100070646 235
319 3300025940 Ga0207691_10058264 Ga0207691_100582644 235
320 3300025940 Ga0207691_10072170 Ga0207691_100721701 235
321 3300025940 Ga0207691_10478990 Ga0207691_104789902 235
322 3300025941 Ga0207711_10096517 Ga0207711_100965173 235
323 3300025942 Ga0207689_10092280 Ga0207689_100922803 235
324 3300025942 Ga0207689_10175941 Ga0207689_101759412 235
325 3300025944 Ga0207661_10361402 Ga0207661_103614022 235
326 3300025945 Ga0207679_10033416 Ga0207679_100334164 235
327 3300025945 Ga0207679_10104857 Ga0207679_101048573 235
328 3300025945 Ga0207679_10107508 Ga0207679_101075083 235
329 3300025945 Ga0207679_10760151 Ga0207679_107601511 235
330 3300025960 Ga0207651_10022771 Ga0207651_100227714 235
331 3300025960 Ga0207651_10216523 Ga0207651_102165232 235
332 3300025960 Ga0207651_10381816 Ga0207651_103818161 235
333 3300025961 Ga0207712_10066974 Ga0207712_100669742 235
334 3300025961 Ga0207712_10236608 Ga0207712_102366082 235
335 3300025981 Ga0207640_10014196 Ga0207640_100141963 235
336 3300025981 Ga0207640_10326307 Ga0207640_103263072 235
337 3300025986 Ga0207658_10034675 Ga0207658_100346754 235
338 3300026035 Ga0207703_10043145 Ga0207703_100431453 235
339 3300026035 Ga0207703_10165231 Ga0207703_101652312 235
340 3300026075 Ga0207708_10112634 Ga0207708_101126342 235
341 3300026075 Ga0207708_10514461 Ga0207708_105144611 235
342 3300026088 Ga0207641_10003549 Ga0207641_100035492 235
343 3300026088 Ga0207641_10132801 Ga0207641_101328012 235
344 3300026088 Ga0207641_10573872 Ga0207641_105738722 235
345 3300026089 Ga0207648_10003537 Ga0207648_100035377 235
346 3300026095 Ga0207676_10072022 Ga0207676_100720221 235
347 3300026095 Ga0207676_10074116 Ga0207676_100741162 235
348 3300026095 Ga0207676_10124903 Ga0207676_101249033 235
349 3300026116 Ga0207674_10028476 Ga0207674_100284767 235
350 3300026116 Ga0207674_10103950 Ga0207674_101039502 235
351 3300026118 Ga0207675_100002780 Ga0207675_1000027809 235
352 3300026118 Ga0207675_100016366 Ga0207675_1000163666 235
353 3300026118 Ga0207675_100200104 Ga0207675_1002001042 235
354 3300026121 Ga0207683_10170588 Ga0207683_101705882 235
355 3300027907 Ga0207428_10005347 Ga0207428_100053472 235
356 3300027907 Ga0207428_10020023 Ga0207428_100200232 235
357 3300027907 Ga0207428_10093232 Ga0207428_100932322 235
358 3300027907 Ga0207428_10102620 Ga0207428_101026203 235
359 3300027907 Ga0207428_10549252 Ga0207428_105492521 235
360 3300028380 Ga0268265_10000714 Ga0268265_1000071417 235
361 3300028381 Ga0268264_10001966 Ga0268264_100019667 235
362 3300028381 Ga0268264_10009945 Ga0268264_100099455 235
363 3300028381 Ga0268264_10077760 Ga0268264_100777603 235
364 3300028381 Ga0268264_10102874 Ga0268264_101028744 235
365 3300031250 Ga0265331_10039781 Ga0265331_100397811 235
366 3300031595 Ga0265313_10019358 Ga0265313_100193582 235
367 3300031711 Ga0265314_10067460 Ga0265314_100674602 235
368 3300031728 Ga0316578_10098934 Ga0316578_100989341 235
369 3300031728 Ga0316578_10175392 Ga0316578_101753921 235
370 3300031731 Ga0307405_10007210 Ga0307405_100072101 235
371 3300031731 Ga0307405_10046672 Ga0307405_100466724 235
372 3300031731 Ga0307405_10069489 Ga0307405_100694894 235
373 3300031731 Ga0307405_10071706 Ga0307405_100717063 235
374 3300031733 Ga0316577_10116362 Ga0316577_101163622 235
375 3300031733 Ga0316577_10162157 Ga0316577_101621572 235
376 3300031733 Ga0316577_10262783 Ga0316577_102627832 235
377 3300031824 Ga0307413_10002032 Ga0307413_100020326 235
378 3300031824 Ga0307413_10059094 Ga0307413_100590942 235
379 3300031852 Ga0307410_10004776 Ga0307410_100047766 235
380 3300031852 Ga0307410_10178860 Ga0307410_101788601 235
381 3300031901 Ga0307406_10008064 Ga0307406_100080647 235
382 3300031901 Ga0307406_10008262 Ga0307406_100082623 235
383 3300031901 Ga0307406_10012021 Ga0307406_100120214 235
384 3300031901 Ga0307406_10083915 Ga0307406_100839152 235
385 3300031903 Ga0307407_10005775 Ga0307407_100057754 235
386 3300031903 Ga0307407_10010616 Ga0307407_100106165 235
387 3300031903 Ga0307407_10059019 Ga0307407_100590191 235
388 3300031911 Ga0307412_10018616 Ga0307412_100186164 235
389 3300031911 Ga0307412_10028414 Ga0307412_100284146 235
390 3300031911 Ga0307412_10176888 Ga0307412_101768882 235
391 3300031995 Ga0307409_100016000 Ga0307409_1000160003 235
392 3300031995 Ga0307409_100033255 Ga0307409_1000332552 235
393 3300031995 Ga0307409_100033673 Ga0307409_1000336733 235
394 3300031995 Ga0307409_100344736 Ga0307409_1003447362 235
395 3300032002 Ga0307416_100033527 Ga0307416_1000335275 235
396 3300032002 Ga0307416_100076722 Ga0307416_1000767222 235
397 3300032002 Ga0307416_100583767 Ga0307416_1005837671 235
398 3300032004 Ga0307414_10047854 Ga0307414_100478541 235
399 3300032005 Ga0307411_10034010 Ga0307411_100340104 235
400 3300032005 Ga0307411_10041999 Ga0307411_100419994 235
401 3300032005 Ga0307411_10202339 Ga0307411_102023392 235
402 3300032126 Ga0307415_100012541 Ga0307415_1000125417 235
403 3300032133 Ga0316583_10047810 Ga0316583_100478101 235
404 3300035088 Ga0373940_0020405 Ga0373940_0020405_480_1229 235
405 3300035092 Ga0373952_0038376 Ga0373952_0038376_169_918 235
406 3300035113 Ga0373936_0107600 Ga0373936_0107600_21_776 235
407 3300035114 Ga0373939_0181600 Ga0373939_0181600_24_767 235
408 3300035116 Ga0373945_0044179 Ga0373945_0044179_518_1273 235
409 3300035116 Ga0373945_0061022 Ga0373945_0061022_137_886 235
410 3300035170 Ga0373943_0016323 Ga0373943_0016323_2030_2785 235
411 3300035725 Ga0373947_0018355 Ga0373947_0018355_1529_2278 235
412 3300035725 Ga0373947_0171153 Ga0373947_0171153_499_1254 235
413 3300036401 Ga0373937_0019700 Ga0373937_0019700_4806_5555 235
414 3300036401 Ga0373937_0291140 Ga0373937_0291140_528_1277 235
415 3300036647 Ga0316582_0080180 Ga0316582_0080180_1012_1758 235
416 3300036647 Ga0316582_0266535 Ga0316582_0266535_290_1039 235
417 3300036712 Ga0316584_0006871 Ga0316584_0006871_5022_5771 235
418 3300036712 Ga0316584_0024723 Ga0316584_0024723_412_1164 235
419 3300037068 Ga0373925_0013930 Ga0373925_0013930_3288_4043 235
420 3300037068 Ga0373925_0136676 Ga0373925_0136676_991_1740 235
421 3300039062 Ga0400483_286307 Ga0400483_286307_3725_4459 235
422 3300039093 Ga0400489_90685 Ga0400489_90685_733_1482 235
423 3300042876 Ga0451577_0004406 Ga0451577_0004406_12602_13351 235
424 3300042876 Ga0451577_0092441 Ga0451577_0092441_1023_1772 235
425 3300044712 Ga0453684_0000354 Ga0453684_0000354_43271_44020 235
426 3300044712 Ga0453684_0363228 Ga0453684_0363228_617_1372 235
427 3300045051 Ga0451576_0007133 Ga0451576_0007133_9078_9827 235
428 3300045051 Ga0451576_0013998 Ga0451576_0013998_4089_4838 235
429 3300045051 Ga0451576_0017863 Ga0451576_0017863_3786_4535 235
430 3300045051 Ga0451576_0023122 Ga0451576_0023122_5216_5965 235
431 3300045051 Ga0451576_0055845 Ga0451576_0055845_1251_2000 235
432 3300045051 Ga0451576_0268525 Ga0451576_0268525_786_1535 235
433 3300045051 Ga0451576_0360059 Ga0451576_0360059_383_1132 235
434 3300045051 Ga0451576_0773076 Ga0451576_0773076_76_825 235
435 3300046455 Ga0495603_0010906 Ga0495603_0010906_3868_4617 235
436 3300046459 Ga0495629_0000002 Ga0495629_0000002_317626_318381 235
437 3300046459 Ga0495629_0009367 Ga0495629_0009367_2903_3652 235
438 3300046472 Ga0495580_0039588 Ga0495580_0039588_533_1282 235
439 3300046472 Ga0495580_0242721 Ga0495580_0242721_263_1018 235
440 3300046475 Ga0495639_0001606 Ga0495639_0001606_3978_4733 235
441 3300046491 Ga0495584_0031423 Ga0495584_0031423_1636_2385 235
442 3300046499 Ga0495594_0027482 Ga0495594_0027482_620_1369 235
443 3300046514 Ga0495618_0007761 Ga0495618_0007761_4854_5603 235
444 3300046523 Ga0495644_0047878 Ga0495644_0047878_198_947 235
445 3300046525 Ga0495663_0005606 Ga0495663_0005606_1297_2046 235
446 3300046526 Ga0495666_0000363 Ga0495666_0000363_2291_3046 235
447 3300046528 Ga0495642_0013615 Ga0495642_0013615_647_1396 235
448 3300046533 Ga0495640_0129133 Ga0495640_0129133_340_1095 235
449 3300046533 Ga0495640_0416753 Ga0495640_0416753_36_785 235
450 3300046535 Ga0495586_0000300 Ga0495586_0000300_27494_28249 235
451 3300046535 Ga0495586_0214681 Ga0495586_0214681_98_847 235
452 3300046537 Ga0495598_0020498 Ga0495598_0020498_544_1293 235
453 3300046538 Ga0495609_0029630 Ga0495609_0029630_510_1259 235
454 3300046539 Ga0495621_0033932 Ga0495621_0033932_571_1320 235
455 3300046539 Ga0495621_0089364 Ga0495621_0089364_284_1033 235
456 3300046543 Ga0495645_0087860 Ga0495645_0087860_402_1151 235
457 3300046557 Ga0495622_0023042 Ga0495622_0023042_2080_2835 235
458 3300046615 Ga0495656_0164170 Ga0495656_0164170_308_1057 235
459 3300046663 Ga0495635_0000960 Ga0495635_0000960_11701_12456 235
460 3300046664 Ga0495659_0007090 Ga0495659_0007090_2166_2915 235
461 3300046664 Ga0495659_0007662 Ga0495659_0007662_1077_1826 235
462 3300046664 Ga0495659_0041931 Ga0495659_0041931_198_947 235
463 3300046683 Ga0495658_0049335 Ga0495658_0049335_836_1591 235
464 3300046683 Ga0495658_0049656 Ga0495658_0049656_697_1446 235
465 3300046684 Ga0495669_0025398 Ga0495669_0025398_150_899 235
466 3300046684 Ga0495669_0040750 Ga0495669_0040750_233_982 235
467 3300046689 Ga0495613_0110874 Ga0495613_0110874_597_1352 235
468 3300046809 Ga0495600_0014772 Ga0495600_0014772_3571_4326 235
469 3300047315 Ga0495581_0031930 Ga0495581_0031930_989_1738 235
470 3300047315 Ga0495581_0032038 Ga0495581_0032038_1751_2506 235
471 3300047318 Ga0495636_0005248 Ga0495636_0005248_2131_2880 235
472 3300047318 Ga0495636_0070696 Ga0495636_0070696_350_1099 235
473 3300047321 Ga0495676_0002152 Ga0495676_0002152_534_1289 235
474 3300047321 Ga0495676_0005978 Ga0495676_0005978_5386_6135 235
475 3300047322 Ga0495680_0017238 Ga0495680_0017238_1963_2718 235
476 3300047445 Ga0495677_0045300 Ga0495677_0045300_205_954 235
477 3300047447 Ga0495685_051367 Ga0495685_051367_145_894 235
478 3300047471 Ga0495684_0043036 Ga0495684_0043036_732_1487 235
479 3300048915 Ga0496112_0105430 Ga0496112_0105430_1929_2672 235
480 3300049568 Ga0501031_0196139 Ga0501031_0196139_359_1108 235
481 3300049572 Ga0501036_0250919 Ga0501036_0250919_637_1386 235
482 3300049574 Ga0501038_0122109 Ga0501038_0122109_1235_1984 235
483 3300049578 Ga0501042_0014760 Ga0501042_0014760_1305_2054 235
484 3300049580 Ga0501046_0066040 Ga0501046_0066040_840_1589 235
485 3300049582 Ga0501048_0085307 Ga0501048_0085307_1365_2114 235
486 3300049583 Ga0501067_0041572 Ga0501067_0041572_1205_1954 235
487 3300049584 Ga0501068_0078182 Ga0501068_0078182_425_1174 235
488 3300049588 Ga0501072_0018264 Ga0501072_0018264_374_1123 235
489 3300049588 Ga0501072_0262103 Ga0501072_0262103_13_759 235
490 3300049588 Ga0501072_0651514 Ga0501072_0651514_26_778 235
491 3300049591 Ga0501075_0112173 Ga0501075_0112173_354_1103 235
492 3300049592 Ga0501076_0033001 Ga0501076_0033001_2675_3424 235
493 3300049672 Ga0501239_015023 Ga0501239_015023_112_861 235
494 3300049743 Ga0501081_0450688 Ga0501081_0450688_151_900 235
495 3300049824 Ga0501045_0128103 Ga0501045_0128103_341_1090 235
496 3300049824 Ga0501045_0359951 Ga0501045_0359951_113_970 235
497 3300050507 nmdc:mga05p37_1018144_c1 nmdc:mga05p37_1018144_c1_80_829 235
498 3300050507 nmdc:mga05p37_135829_c1 nmdc:mga05p37_135829_c1_803_1552 235
499 3300050507 nmdc:mga05p37_1433_c1 nmdc:mga05p37_1433_c1_25265_26014 235
500 3300050507 nmdc:mga05p37_181281_c1 nmdc:mga05p37_181281_c1_1453_2202 235
501 3300050507 nmdc:mga05p37_287040_c1 nmdc:mga05p37_287040_c1_293_1042 235
502 3300050507 nmdc:mga05p37_2888_c1 nmdc:mga05p37_2888_c1_6369_7118 235
503 3300050507 nmdc:mga05p37_39052_c1 nmdc:mga05p37_39052_c1_3072_3821 235
504 3300050507 nmdc:mga05p37_40576_c1 nmdc:mga05p37_40576_c1_4210_4965 235
505 3300050507 nmdc:mga05p37_90897_c1 nmdc:mga05p37_90897_c1_248_997 235
506 3300050507 nmdc:mga05p37_92481_c1 nmdc:mga05p37_92481_c1_1551_2300 235
507 3300050508 nmdc:mga09592_1848_c1 nmdc:mga09592_1848_c1_2221_2970 235
508 3300050508 nmdc:mga09592_203864_c1 nmdc:mga09592_203864_c1_949_1698 235
509 3300050509 nmdc:mga0qj67_20350_c1 nmdc:mga0qj67_20350_c1_1195_1986 235
510 3300050509 nmdc:mga0qj67_36800_c1 nmdc:mga0qj67_36800_c1_523_1278 235
511 3300050510 nmdc:mga06r32_15525_c1 nmdc:mga06r32_15525_c1_5788_6537 235
512 3300050510 nmdc:mga06r32_222695_c1 nmdc:mga06r32_222695_c1_423_1178 235
513 3300050510 nmdc:mga06r32_569652_c1 nmdc:mga06r32_569652_c1_28_777 235
514 3300050511 nmdc:mga08y16_24168_c1 nmdc:mga08y16_24168_c1_903_1652 235
515 3300050511 nmdc:mga08y16_29258_c1 nmdc:mga08y16_29258_c1_2662_3411 235
516 3300050511 nmdc:mga08y16_35593_c1 nmdc:mga08y16_35593_c1_1914_2669 235
517 3300050511 nmdc:mga08y16_86973_c1 nmdc:mga08y16_86973_c1_1698_2447 235
518 3300050511 nmdc:mga08y16_978150_c1 nmdc:mga08y16_978150_c1_69_818 235
519 3300050512 nmdc:mga0n895_107801_c1 nmdc:mga0n895_107801_c1_44_793 235
520 3300050512 nmdc:mga0n895_108871_c1 nmdc:mga0n895_108871_c1_1409_2158 235
521 3300050512 nmdc:mga0n895_1110_c1 nmdc:mga0n895_1110_c1_16108_16857 235
522 3300050512 nmdc:mga0n895_123651_c1 nmdc:mga0n895_123651_c1_541_1290 235
523 3300050512 nmdc:mga0n895_15420_c1 nmdc:mga0n895_15420_c1_814_1563 235
524 3300050512 nmdc:mga0n895_175954_c1 nmdc:mga0n895_175954_c1_1393_2142 235
525 3300050512 nmdc:mga0n895_32770_c1 nmdc:mga0n895_32770_c1_10_759 235
526 3300050515 nmdc:mga0a205_201817_c1 nmdc:mga0a205_201817_c1_710_1459 235
527 3300050515 nmdc:mga0a205_2103_c1 nmdc:mga0a205_2103_c1_8592_9341 235
528 3300050515 nmdc:mga0a205_279592_c1 nmdc:mga0a205_279592_c1_361_1110 235
529 3300050515 nmdc:mga0a205_331434_c1 nmdc:mga0a205_331434_c1_103_852 235
530 3300053084 Ga0495595_0155103 Ga0495595_0155103_211_960 235
531 3300053085 Ga0495619_0051228 Ga0495619_0051228_1548_2303 235
532 3300053119 Ga0500595_005343 Ga0500595_005343_767_1516 235
533 3300054114 Ga0501084_0048971 Ga0501084_0048971_1318_2067 235
534 3300059421 Ga0590071_000184 Ga0590071_000184_14128_14877 235
535 3300059423 Ga0590074_000189 Ga0590074_000189_3050_3799 235
536 3300059424 Ga0590075_001239 Ga0590075_001239_4364_5113 235
537 3300059426 Ga0590077_000704 Ga0590077_000704_3034_3783 235
538 3300060353 Ga0501082_0191557 Ga0501082_0191557_660_1409 235
539 3300061734 Ga0530510_0120545 Ga0530510_0120545_338_1087 235
540 3300061734 Ga0530510_0126632 Ga0530510_0126632_961_1710 235
541 iso_pu_bacteria 2643221644 2644243614 236
542 3300003775 Ga0055524_1000302 Ga0055524_100030234 240
543 3300042156 Ga0439446_0051611 Ga0439446_0051611_319_1041 240
544 3300042157 Ga0439458_0028596 Ga0439458_0028596_41_814 240
545 3300042531 Ga0450918_000954 Ga0450918_000954_1844_2566 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

41

112

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

118

273

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8693 18 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8615 6 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8557 3 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8448 6 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.828 3 240
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9695 28 75 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9623 83 240 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9391 130 205 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9273 130 205 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9197 19 79 1.10.10.200
ID Description Score Start End GO Terms
AF-Q8P6E3-F1-model_v4 Probable transcriptional regulatory protein XCC3027 0.9918 18 237 GO:0003677
GO:0005829
GO:0006355
AF-A0A2D6IY08-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9907 125 240 GO:0003677
GO:0005829
AF-A0A377V8M7-F1-model_v4 Probable transcriptional regulatory protein YebC 0.9823 83 190 GO:0005829
AF-A0A3B9L7U6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9811 62 240 GO:0003677
GO:0005829
AF-A0A536RP66-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9802 1 135 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
92.17 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map