F460093

General Info

Members Datasets Scaffolds Average Seq Length
531 251 531 242

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100037792|Ga0068852_1000377922
Length 284
Sequence MPVDRFGVEASLLPETWNGRGLGSGRETGYDVSVILGQEQAGARSMAEQALRNIGPVVLLGPPGAGKGTQSKRITKHYRIPQVSTGDLLREHVKQGTPLGTQVRDVIAQGELVPDHLVCDIVAWRLRETDAQRGFILDGFPRTAKQAVWLDSFLKFEFGDTGKWAAWLPIVICIKVDYNKLLLRITGRRTCPTCGRIYNVHSQPPLVDEICDVDGSKLVTRDDDREEVIRERLDAYERQTKPVAEHYGQMDRVVEVNGDLPVDQVTGALIEAIDRNAQGAAGSS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
115 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
116 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 2.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.27
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5839400 2162886012 Bacteria 1259
2 JGI24752J21851_1000767 3300001976 Bacteria 4313
3 JGI24034J26672_10007876 3300002239 Bacteria 1551
4 JGI24751J29686_10002130 3300002459 Bacteria 4020
5 rootH1_10200532 3300003323 Bacteria 2176
6 Ga0058861_11829235 3300004800 Bacteria 1175
7 Ga0058860_12198664 3300004801 Bacteria 5509
8 Ga0058862_12840234 3300004803 Bacteria 1703
9 Ga0065715_10104408 3300005293 Bacteria 2965
10 Ga0070683_100191401 3300005329 Bacteria 1942
11 Ga0070690_100000550 3300005330 Bacteria 18744
12 Ga0070690_100109009 3300005330 Bacteria 1845
13 Ga0070670_100009055 3300005331 Bacteria 8505
14 Ga0070670_100103499 3300005331 Bacteria 2452
15 Ga0070677_10009847 3300005333 Bacteria 3252
16 Ga0068869_100001846 3300005334 Bacteria 12731
17 Ga0068869_100049372 3300005334 Bacteria 3045
18 Ga0070666_10080569 3300005335 Bacteria 2225
19 Ga0070680_100372566 3300005336 Bacteria 1215
20 Ga0068868_100002791 3300005338 Bacteria 12099
21 Ga0068868_100011852 3300005338 Bacteria 6357
22 Ga0068868_100022874 3300005338 Bacteria 4724
23 Ga0070660_100002901 3300005339 Bacteria 11803
24 Ga0070689_100048981 3300005340 Bacteria 3260
25 Ga0070691_10160723 3300005341 Bacteria 1158
26 Ga0070687_100000493 3300005343 Bacteria 13161
27 Ga0070687_100089776 3300005343 Bacteria 1697
28 Ga0070661_100012073 3300005344 Bacteria 6037
29 Ga0070668_100014649 3300005347 Bacteria 5860
30 Ga0070669_100007500 3300005353 Bacteria 7813
31 Ga0070675_100004817 3300005354 Bacteria 10298
32 Ga0070671_100226224 3300005355 Bacteria 1587
33 Ga0070671_100633402 3300005355 Unclassified 925
34 Ga0070674_100010705 3300005356 Bacteria 5557
35 Ga0070674_100648545 3300005356 Bacteria 897
36 Ga0070673_100042360 3300005364 Bacteria 3510
37 Ga0070688_100049229 3300005365 Bacteria 2621
38 Ga0070659_100023459 3300005366 Bacteria 4721
39 Ga0070667_100167166 3300005367 Bacteria 1940
40 Ga0070709_10036190 3300005434 Bacteria 3005
41 Ga0070709_10062594 3300005434 Bacteria 2372
42 Ga0070714_100000096 3300005435 Bacteria 74616
43 Ga0070714_100014828 3300005435 Bacteria 6265
44 Ga0070714_100133939 3300005435 Bacteria 2217
45 Ga0070714_100188568 3300005435 Bacteria 1880
46 Ga0070714_100531053 3300005435 Bacteria 1125
47 Ga0070713_100002249 3300005436 Bacteria 12530
48 Ga0070713_100092936 3300005436 Bacteria 2598
49 Ga0070713_100098986 3300005436 Bacteria 2522
50 Ga0070713_100333462 3300005436 Bacteria 1404
51 Ga0070713_100410068 3300005436 Bacteria 1267
52 Ga0070713_100452123 3300005436 Bacteria 1206
53 Ga0070713_100517932 3300005436 Bacteria 1127
54 Ga0070710_10023917 3300005437 Bacteria 3217
55 Ga0070710_10336131 3300005437 Bacteria 996
56 Ga0070701_10072732 3300005438 Bacteria 1842
57 Ga0070711_100575747 3300005439 Bacteria 937
58 Ga0070705_100068395 3300005440 Bacteria 2137
59 Ga0070708_100005339 3300005445 Bacteria 10189
60 Ga0070708_100127855 3300005445 Bacteria 2350
61 Ga0070708_100292014 3300005445 Bacteria 1535
62 Ga0070663_100058366 3300005455 Bacteria 2771
63 Ga0070678_100036448 3300005456 Bacteria 3443
64 Ga0070678_100081424 3300005456 Bacteria 2454
65 Ga0070678_100756263 3300005456 Unclassified 879
66 Ga0070662_100020616 3300005457 Bacteria 4493
67 Ga0070681_10068582 3300005458 Bacteria 3513
68 Ga0068867_100009657 3300005459 Bacteria 6801
69 Ga0068867_100302938 3300005459 Bacteria 1318
70 Ga0070685_10001292 3300005466 Bacteria 13193
71 Ga0070706_100000514 3300005467 Bacteria 45375
72 Ga0070706_100033341 3300005467 Bacteria 4753
73 Ga0070706_100094900 3300005467 Bacteria 2768
74 Ga0070707_100000662 3300005468 Bacteria 34318
75 Ga0070707_100044794 3300005468 Bacteria 4236
76 Ga0070707_100066623 3300005468 Bacteria 3461
77 Ga0070707_100199499 3300005468 Bacteria 1950
78 Ga0070698_100002449 3300005471 Bacteria 20472
79 Ga0070698_100004533 3300005471 Bacteria 15264
80 Ga0070699_100000441 3300005518 Bacteria 39851
81 Ga0070699_100003886 3300005518 Bacteria 13210
82 Ga0070684_100001423 3300005535 Bacteria 17232
83 Ga0070684_100030620 3300005535 Bacteria 4573
84 Ga0070684_100052579 3300005535 Bacteria 3543
85 Ga0070697_100001451 3300005536 Bacteria 18044
86 Ga0068853_100008308 3300005539 Bacteria 8336
87 Ga0070672_100128304 3300005543 Bacteria 2082
88 Ga0070686_100005280 3300005544 Bacteria 7141
89 Ga0070693_100024724 3300005547 Bacteria 3225
90 Ga0070693_100061331 3300005547 Bacteria 2185
91 Ga0070693_100165928 3300005547 Bacteria 1410
92 Ga0068855_100025048 3300005563 Bacteria 7141
93 Ga0068855_100131537 3300005563 Bacteria 2857
94 Ga0068855_100453177 3300005563 Bacteria 1400
95 Ga0068855_100699505 3300005563 Bacteria 1085
96 Ga0070664_100017663 3300005564 Bacteria 5858
97 Ga0070664_100107847 3300005564 Bacteria 2428
98 Ga0068857_100001133 3300005577 Bacteria 20806
99 Ga0068857_100011854 3300005577 Bacteria 7583
100 Ga0068857_100015288 3300005577 Bacteria 6699
101 Ga0068854_100159587 3300005578 Bacteria 1745
102 Ga0068856_100005788 3300005614 Bacteria 12182
103 Ga0068856_100020373 3300005614 Bacteria 6441
104 Ga0068856_100033324 3300005614 Bacteria 5043
105 Ga0068856_100367268 3300005614 Bacteria 1458
106 Ga0068856_100823539 3300005614 Bacteria 948
107 Ga0070702_100034390 3300005615 Bacteria 2793
108 Ga0068852_100001223 3300005616 Bacteria 17089
109 Ga0068852_100037792 3300005616 Bacteria 4051
110 Ga0068852_100077400 3300005616 Bacteria 2940
111 Ga0068859_100004997 3300005617 Bacteria 13466
112 Ga0068859_100229921 3300005617 Bacteria 1942
113 Ga0068859_100419829 3300005617 Bacteria 1434
114 Ga0068864_100012547 3300005618 Bacteria 7006
115 Ga0068864_100178050 3300005618 Bacteria 1942
116 Ga0068866_10001380 3300005718 Bacteria 10468
117 Ga0068861_100006422 3300005719 Bacteria 8008
118 Ga0068851_10001352 3300005834 Bacteria 10700
119 Ga0068870_10007394 3300005840 Bacteria 4892
120 Ga0068863_100020550 3300005841 Bacteria 6312
121 Ga0068863_100068631 3300005841 Bacteria 3353
122 Ga0068863_100217732 3300005841 Bacteria 1839
123 Ga0068858_100023794 3300005842 Bacteria 5707
124 Ga0068858_100042739 3300005842 Bacteria 4202
125 Ga0068858_100494810 3300005842 Bacteria 1181
126 Ga0068860_100018016 3300005843 Bacteria 6877
127 Ga0068860_100036537 3300005843 Bacteria 4706
128 Ga0068860_100173182 3300005843 Bacteria 2085
129 Ga0068860_100197274 3300005843 Unclassified 1950
130 Ga0068862_100010568 3300005844 Bacteria 7629
131 Ga0081540_1053742 3300005983 Bacteria 1973
132 Ga0070717_10006374 3300006028 Bacteria 8673
133 Ga0070717_10006770 3300006028 Bacteria 8457
134 Ga0070717_10012892 3300006028 Bacteria 6384
135 Ga0070717_10022846 3300006028 Bacteria 4948
136 Ga0070717_10143825 3300006028 Unclassified 2058
137 Ga0070717_10193547 3300006028 Bacteria 1778
138 Ga0070717_10200924 3300006028 Bacteria 1746
139 Ga0070717_10202099 3300006028 Bacteria 1741
140 Ga0070717_10211653 3300006028 Unclassified 1701
141 Ga0070717_10237961 3300006028 Bacteria 1604
142 Ga0070717_10261373 3300006028 Unclassified 1532
143 Ga0070717_10261729 3300006028 Bacteria 1530
144 Ga0070717_10294952 3300006028 Bacteria 1440
145 Ga0070716_100005841 3300006173 Bacteria 5980
146 Ga0070716_100032051 3300006173 Bacteria 2863
147 Ga0070716_100065879 3300006173 Bacteria 2111
148 Ga0070716_100331796 3300006173 Bacteria 1070
149 Ga0070716_100473747 3300006173 Unclassified 918
150 Ga0070712_100004622 3300006175 Bacteria 8508
151 Ga0070712_100118675 3300006175 Bacteria 1987
152 Ga0070712_100240952 3300006175 Unclassified 1441
153 Ga0070712_100393991 3300006175 Bacteria 1142
154 Ga0097621_100013773 3300006237 Bacteria 6038
155 Ga0097621_100037109 3300006237 Bacteria 3902
156 Ga0097621_100200456 3300006237 Bacteria 1732
157 Ga0097621_100260265 3300006237 Bacteria 1522
158 Ga0068871_100014064 3300006358 Bacteria 5952
159 Ga0068871_100048431 3300006358 Bacteria 3431
160 Ga0068871_100097119 3300006358 Bacteria 2462
161 Ga0068871_100119210 3300006358 Bacteria 2227
162 Ga0068871_100275607 3300006358 Bacteria 1470
163 Ga0075434_100098816 3300006871 Bacteria 2924
164 Ga0075434_100915906 3300006871 Unclassified 891
165 Ga0068865_100016197 3300006881 Bacteria 4765
166 Ga0068865_100044651 3300006881 Bacteria 3034
167 Ga0075436_100000510 3300006914 Bacteria 25141
168 Ga0075436_100068173 3300006914 Bacteria 2458
169 Ga0075436_100339853 3300006914 Bacteria 1080
170 Ga0097620_100004997 3300006931 Bacteria 13466
171 Ga0097620_100229950 3300006931 Bacteria 1942
172 Ga0097620_100419831 3300006931 Bacteria 1434
173 Ga0075435_100045994 3300007076 Bacteria 3500
174 Ga0099795_10053032 3300007788 Bacteria 1483
175 Ga0105250_10021050 3300009092 Bacteria 2633
176 Ga0105250_10126176 3300009092 Unclassified 1054
177 Ga0105240_10426146 3300009093 Bacteria 1489
178 Ga0105245_10005029 3300009098 Bacteria 11625
179 Ga0105245_10005238 3300009098 Bacteria 11396
180 Ga0105245_10052848 3300009098 Bacteria 3645
181 Ga0105245_10121450 3300009098 Bacteria 2441
182 Ga0105241_10014226 3300009174 Bacteria 5829
183 Ga0105241_10060464 3300009174 Bacteria 2915
184 Ga0105241_10293582 3300009174 Bacteria 1393
185 Ga0105242_10035557 3300009176 Bacteria 3994
186 Ga0105242_10762044 3300009176 Unclassified 954
187 Ga0105248_10050861 3300009177 Bacteria 4649
188 Ga0105248_10087800 3300009177 Bacteria 3500
189 Ga0105248_10256397 3300009177 Bacteria 1969
190 Ga0105248_10392646 3300009177 Bacteria 1562
191 Ga0105237_10016610 3300009545 Bacteria 7645
192 Ga0105237_10034935 3300009545 Bacteria 5088
193 Ga0105237_10059544 3300009545 Bacteria 3821
194 Ga0105237_10096007 3300009545 Bacteria 2954
195 Ga0105237_10105001 3300009545 Bacteria 2817
196 Ga0105237_10505355 3300009545 Bacteria 1215
197 Ga0105238_10055203 3300009551 Bacteria 3988
198 Ga0105238_10248814 3300009551 Bacteria 1755
199 Ga0105238_10488924 3300009551 Bacteria 1230
200 Ga0105239_10029298 3300010375 Bacteria 6053
201 Ga0105239_10105513 3300010375 Bacteria 3121
202 Ga0105239_10167863 3300010375 Bacteria 2454
203 Ga0105239_10371932 3300010375 Bacteria 1615
204 Ga0105239_10598539 3300010375 Bacteria 1257
205 Ga0105246_10018819 3300011119 Bacteria 4404
206 Ga0157373_10001758 3300013100 Bacteria 16488
207 Ga0157373_10001852 3300013100 Bacteria 16057
208 Ga0157371_10002134 3300013102 Bacteria 19252
209 Ga0157370_10039544 3300013104 Bacteria 4558
210 Ga0157369_10015406 3300013105 Bacteria 8617
211 Ga0157369_10077005 3300013105 Bacteria 3575
212 Ga0157369_10146989 3300013105 Bacteria 2492
213 Ga0157369_10159363 3300013105 Bacteria 2382
214 Ga0157374_10014284 3300013296 Bacteria 6947
215 Ga0157374_10079239 3300013296 Bacteria 3113
216 Ga0157374_10216283 3300013296 Bacteria 1880
217 Ga0157378_10000411 3300013297 Bacteria 42281
218 Ga0157378_10029365 3300013297 Bacteria 4854
219 Ga0157378_10044668 3300013297 Bacteria 3935
220 Ga0163162_10020357 3300013306 Bacteria 6517
221 Ga0163162_10240409 3300013306 Bacteria 1942
222 Ga0157372_10002154 3300013307 Bacteria 21421
223 Ga0157372_10003780 3300013307 Bacteria 16254
224 Ga0157372_10016043 3300013307 Bacteria 8034
225 Ga0157372_10038610 3300013307 Bacteria 5269
226 Ga0157372_10055014 3300013307 Bacteria 4442
227 Ga0157372_10107547 3300013307 Bacteria 3191
228 Ga0157372_10142588 3300013307 Bacteria 2762
229 Ga0157372_10238753 3300013307 Bacteria 2108
230 Ga0157372_10690339 3300013307 Bacteria 1188
231 Ga0157375_10177291 3300013308 Bacteria 2281
232 Ga0157375_10419711 3300013308 Unclassified 1504
233 Ga0157375_10561639 3300013308 Unclassified 1302
234 Ga0163163_10001073 3300014325 Bacteria 23224
235 Ga0163163_10060784 3300014325 Bacteria 3742
236 Ga0157380_10030441 3300014326 Bacteria 4133
237 Ga0157377_10000768 3300014745 Bacteria 13272
238 Ga0157379_10005366 3300014968 Bacteria 11017
239 Ga0157379_10705638 3300014968 Unclassified 947
240 Ga0157376_10033947 3300014969 Bacteria 4114
241 Ga0157376_10177138 3300014969 Bacteria 1946
242 Ga0157376_10198242 3300014969 Bacteria 1845
243 Ga0157376_10267866 3300014969 Bacteria 1603
244 Ga0157376_10277746 3300014969 Bacteria 1576
245 Ga0157376_10428883 3300014969 Bacteria 1285
246 Ga0163161_10001969 3300017792 Bacteria 14895
247 Ga0184601_134694 3300019183 Bacteria 1325
248 Ga0184603_148979 3300019192 Bacteria 1661
249 Ga0206356_11841538 3300020070 Bacteria 1275
250 Ga0224712_10136544 3300022467 Unclassified 1076
251 Ga0224569_100499 3300022732 Bacteria 3400
252 Ga0224571_101787 3300022734 Bacteria 1353
253 Ga0247552_100137 3300023536 Bacteria 1464
254 Ga0224572_1003240 3300024225 Bacteria 2729
255 Ga0224572_1008026 3300024225 Bacteria 1946
256 Ga0228598_1008762 3300024227 Bacteria 2036
257 Ga0228598_1019251 3300024227 Bacteria 1345
258 Ga0207656_10007564 3300025321 Bacteria 3964
259 Ga0207692_10013131 3300025898 Bacteria 3585
260 Ga0207692_10042020 3300025898 Bacteria 2267
261 Ga0207692_10084890 3300025898 Bacteria 1702
262 Ga0207642_10093368 3300025899 Bacteria 1492
263 Ga0207642_10379241 3300025899 Unclassified 841
264 Ga0207688_10005204 3300025901 Bacteria 7069
265 Ga0207688_10136460 3300025901 Bacteria 1441
266 Ga0207680_10001756 3300025903 Bacteria 10229
267 Ga0207647_10006875 3300025904 Bacteria 8248
268 Ga0207647_10019145 3300025904 Bacteria 4608
269 Ga0207699_10020090 3300025906 Bacteria 3574
270 Ga0207645_10001180 3300025907 Bacteria 21585
271 Ga0207643_10001067 3300025908 Bacteria 16207
272 Ga0207684_10000614 3300025910 Bacteria 42486
273 Ga0207684_10001048 3300025910 Bacteria 30878
274 Ga0207684_10256313 3300025910 Bacteria 1509
275 Ga0207654_10004384 3300025911 Bacteria 7113
276 Ga0207707_10018585 3300025912 Bacteria 6059
277 Ga0207695_10008453 3300025913 Bacteria 12891
278 Ga0207695_10020062 3300025913 Bacteria 7670
279 Ga0207671_10042802 3300025914 Bacteria 3351
280 Ga0207671_10070079 3300025914 Bacteria 2613
281 Ga0207671_10074923 3300025914 Bacteria 2530
282 Ga0207693_10001260 3300025915 Bacteria 22561
283 Ga0207693_10026057 3300025915 Bacteria 4630
284 Ga0207693_10041078 3300025915 Bacteria 3642
285 Ga0207693_10147811 3300025915 Bacteria 1848
286 Ga0207663_10062577 3300025916 Bacteria 2366
287 Ga0207657_10004069 3300025919 Bacteria 15518
288 Ga0207657_10418522 3300025919 Unclassified 1053
289 Ga0207657_10446489 3300025919 Bacteria 1015
290 Ga0207649_10001087 3300025920 Bacteria 16517
291 Ga0207649_10058342 3300025920 Bacteria 2417
292 Ga0207646_10001230 3300025922 Bacteria 32163
293 Ga0207646_10004899 3300025922 Bacteria 14334
294 Ga0207646_10017066 3300025922 Bacteria 6802
295 Ga0207646_10195945 3300025922 Bacteria 1824
296 Ga0207646_10330676 3300025922 Unclassified 1377
297 Ga0207694_10000718 3300025924 Bacteria 29747
298 Ga0207694_10581624 3300025924 Bacteria 941
299 Ga0207650_10000152 3300025925 Bacteria 83134
300 Ga0207659_10003498 3300025926 Bacteria 9434
301 Ga0207687_10127310 3300025927 Bacteria 1914
302 Ga0207687_10171969 3300025927 Bacteria 1671
303 Ga0207687_10326428 3300025927 Bacteria 1244
304 Ga0207700_10025877 3300025928 Bacteria 4083
305 Ga0207700_10087615 3300025928 Bacteria 2449
306 Ga0207700_10222711 3300025928 Bacteria 1600
307 Ga0207664_10000087 3300025929 Bacteria 88607
308 Ga0207664_10046667 3300025929 Bacteria 3401
309 Ga0207664_10102458 3300025929 Bacteria 2367
310 Ga0207644_10003335 3300025931 Bacteria 10358
311 Ga0207644_10030088 3300025931 Bacteria 3772
312 Ga0207644_10207611 3300025931 Bacteria 1547
313 Ga0207706_10000740 3300025933 Bacteria 34067
314 Ga0207686_10193969 3300025934 Bacteria 1450
315 Ga0207670_10180932 3300025936 Bacteria 1588
316 Ga0207670_10555951 3300025936 Unclassified 938
317 Ga0207704_10009815 3300025938 Bacteria 4636
318 Ga0207704_10012199 3300025938 Bacteria 4258
319 Ga0207704_10013374 3300025938 Bacteria 4104
320 Ga0207665_10001798 3300025939 Bacteria 14443
321 Ga0207665_10002747 3300025939 Bacteria 11804
322 Ga0207665_10085230 3300025939 Bacteria 2181
323 Ga0207665_10481806 3300025939 Unclassified 956
324 Ga0207691_10000308 3300025940 Bacteria 48637
325 Ga0207711_10003068 3300025941 Bacteria 14584
326 Ga0207711_10024877 3300025941 Bacteria 5023
327 Ga0207711_10333588 3300025941 Bacteria 1403
328 Ga0207711_10348070 3300025941 Bacteria 1372
329 Ga0207689_10000618 3300025942 Bacteria 33979
330 Ga0207689_10154128 3300025942 Bacteria 1894
331 Ga0207661_10007082 3300025944 Bacteria 7965
332 Ga0207679_10000298 3300025945 Bacteria 37205
333 Ga0207679_10061135 3300025945 Bacteria 2802
334 Ga0207667_10345975 3300025949 Bacteria 1516
335 Ga0207667_10390220 3300025949 Bacteria 1418
336 Ga0207667_10449619 3300025949 Bacteria 1309
337 Ga0207712_10256422 3300025961 Bacteria 1416
338 Ga0207640_10008195 3300025981 Bacteria 5791
339 Ga0207640_10147628 3300025981 Bacteria 1723
340 Ga0207658_10003391 3300025986 Bacteria 11277
341 Ga0207658_10482574 3300025986 Bacteria 1102
342 Ga0207677_10004281 3300026023 Bacteria 7637
343 Ga0207677_10010267 3300026023 Bacteria 5295
344 Ga0207677_10032062 3300026023 Bacteria 3374
345 Ga0207703_10003490 3300026035 Bacteria 13160
346 Ga0207703_10007555 3300026035 Bacteria 8621
347 Ga0207703_10013683 3300026035 Bacteria 6323
348 Ga0207703_10452878 3300026035 Bacteria 1199
349 Ga0207639_10003445 3300026041 Bacteria 10647
350 Ga0207639_10332043 3300026041 Bacteria 1353
351 Ga0207639_10700099 3300026041 Bacteria 940
352 Ga0207678_10003018 3300026067 Bacteria 15226
353 Ga0207702_10013988 3300026078 Bacteria 6666
354 Ga0207702_10047058 3300026078 Bacteria 3633
355 Ga0207702_10369105 3300026078 Bacteria 1377
356 Ga0207702_10427401 3300026078 Bacteria 1282
357 Ga0207641_10000052 3300026088 Bacteria 173672
358 Ga0207641_10015396 3300026088 Bacteria 6266
359 Ga0207641_10020552 3300026088 Bacteria 5424
360 Ga0207641_10045230 3300026088 Bacteria 3706
361 Ga0207648_10003962 3300026089 Bacteria 15393
362 Ga0207648_10023379 3300026089 Bacteria 5537
363 Ga0207648_10103312 3300026089 Bacteria 2499
364 Ga0207676_10000176 3300026095 Bacteria 56110
365 Ga0207676_10046329 3300026095 Bacteria 3364
366 Ga0207676_10051605 3300026095 Bacteria 3211
367 Ga0207674_10000561 3300026116 Bacteria 48618
368 Ga0207674_10041099 3300026116 Bacteria 4784
369 Ga0207675_100005443 3300026118 Bacteria 12201
370 Ga0207683_10001978 3300026121 Bacteria 18120
371 Ga0207683_10051020 3300026121 Bacteria 3624
372 Ga0207683_10737234 3300026121 Unclassified 914
373 Ga0207698_10174501 3300026142 Bacteria 1897
374 Ga0265356_1006042 3300028017 Bacteria 1427
375 Ga0268266_10001266 3300028379 Bacteria 30870
376 Ga0268265_10008088 3300028380 Bacteria 7106
377 Ga0268264_10005269 3300028381 Bacteria 10950
378 Ga0268264_10128289 3300028381 Bacteria 2245
379 Ga0268264_11019967 3300028381 Bacteria 834
380 Ga0265336_10035881 3300028666 Bacteria 1528
381 Ga0265338_10002857 3300028800 Bacteria 25250
382 Ga0265338_10056425 3300028800 Bacteria 3483
383 Ga0265762_1000268 3300030760 Bacteria 8677
384 Ga0265767_101329 3300030836 Unclassified 1197
385 Ga0265766_1003393 3300030863 Bacteria 927
386 Ga0265770_1015544 3300030878 Bacteria 1159
387 Ga0265760_10016393 3300031090 Bacteria 2127
388 Ga0265339_10107307 3300031249 Bacteria 1448
389 Ga0265316_10070945 3300031344 Bacteria 2686
390 Ga0316214_1002742 3300033545 Bacteria 2181
391 Ga0373926_0055952 3300035083 Bacteria 1430
392 Ga0373926_0093666 3300035083 Unclassified 1119
393 Ga0373929_0056505 3300035085 Unclassified 909
394 Ga0373934_0080725 3300035086 Bacteria 1306
395 Ga0373923_0025821 3300035111 Bacteria 2332
396 Ga0373923_0063170 3300035111 Bacteria 1577
397 Ga0373936_0012061 3300035113 Bacteria 3282
398 Ga0373936_0030745 3300035113 Bacteria 2118
399 Ga0373936_0051853 3300035113 Bacteria 1661
400 Ga0373945_0057019 3300035116 Bacteria 1450
401 Ga0373953_0059015 3300035117 Bacteria 1565
402 Ga0373954_0074535 3300035118 Bacteria 1615
403 Ga0373956_0129236 3300035119 Bacteria 1182
404 Ga0373957_0002069 3300035120 Bacteria 5626
405 Ga0373946_0021043 3300035171 Bacteria 2526
406 Ga0373946_0032109 3300035171 Bacteria 2107
407 Ga0373946_0085061 3300035171 Bacteria 1392
408 Ga0373955_0126462 3300035172 Bacteria 1489
409 Ga0373924_0128027 3300035410 Bacteria 1104
410 Ga0373931_0127634 3300035691 Bacteria 1460
411 Ga0373935_0001675 3300035692 Bacteria 12390
412 Ga0373935_0008518 3300035692 Bacteria 6138
413 Ga0373935_0015830 3300035692 Bacteria 4563
414 Ga0373935_0086941 3300035692 Bacteria 2041
415 Ga0373935_0170685 3300035692 Bacteria 1488
416 Ga0373935_0290490 3300035692 Bacteria 1153
417 Ga0373927_0000747 3300035695 Bacteria 24845
418 Ga0373927_0124747 3300035695 Bacteria 1681
419 Ga0373927_0356506 3300035695 Unclassified 964
420 Ga0373933_0074252 3300035724 Bacteria 2073
421 Ga0373933_0138582 3300035724 Bacteria 1534
422 Ga0373947_0000971 3300035725 Bacteria 17501
423 Ga0373947_0001211 3300035725 Bacteria 15877
424 Ga0373937_0040661 3300036401 Bacteria 4239
425 Ga0373937_0042220 3300036401 Bacteria 4161
426 Ga0373937_0179904 3300036401 Bacteria 1985
427 Ga0265778_006954 3300036457 Bacteria 1230
428 Ga0373925_0032616 3300037068 Bacteria 3834
429 Ga0373925_0039256 3300037068 Bacteria 3502
430 Ga0373925_0065985 3300037068 Bacteria 2727
431 Ga0373925_0126277 3300037068 Bacteria 1990
432 Ga0373925_0174457 3300037068 Unclassified 1698
433 Ga0373925_0221979 3300037068 Bacteria 1509
434 Ga0373925_0266516 3300037068 Bacteria 1377
435 Ga0395900_0339978 3300037418 Bacteria 1477
436 Ga0395900_0512312 3300037418 Bacteria 1149
437 Ga0395905_0008469 3300037471 Bacteria 10140
438 Ga0395905_0013425 3300037471 Bacteria 7848
439 Ga0395905_0030235 3300037471 Bacteria 5106
440 Ga0395905_0147383 3300037471 Bacteria 2214
441 Ga0395905_0272535 3300037471 Bacteria 1578
442 Ga0395901_0495608 3300038443 Bacteria 1244
443 Ga0436360_1163436 3300039438 Bacteria 1122
444 Ga0436363_0823540 3300039450 Bacteria 914
445 Ga0436363_1122218 3300039450 Bacteria 4045
446 Ga0466966_0115682 3300044684 Bacteria 1651
447 Ga0466966_0264032 3300044684 Bacteria 1036
448 Ga0466963_0011928 3300044694 Bacteria 5307
449 Ga0466963_0196345 3300044694 Bacteria 1411
450 Ga0466964_0028661 3300044706 Bacteria 2195
451 Ga0451576_0268488 3300045051 Bacteria 1783
452 Ga0466967_0043681 3300045976 Bacteria 3882
453 Ga0466967_0184310 3300045976 Bacteria 1970
454 Ga0466967_0451671 3300045976 Bacteria 1256
455 Ga0466967_0542645 3300045976 Bacteria 1144
456 Ga0466967_0619814 3300045976 Bacteria 1068
457 Ga0495580_0001673 3300046472 Bacteria 19470
458 Ga0495580_0001845 3300046472 Bacteria 18638
459 Ga0495580_0005942 3300046472 Bacteria 10013
460 Ga0495580_0018154 3300046472 Bacteria 5242
461 Ga0495580_0133362 3300046472 Bacteria 1722
462 Ga0495580_0216950 3300046472 Bacteria 1315
463 Ga0495580_0227622 3300046472 Unclassified 1280
464 Ga0495582_0000596 3300046473 Bacteria 19949
465 Ga0495582_0032232 3300046473 Bacteria 2883
466 Ga0495639_0049044 3300046475 Bacteria 1916
467 Ga0495639_0076858 3300046475 Bacteria 1549
468 Ga0495639_0294170 3300046475 Unclassified 809
469 Ga0495594_0127770 3300046499 Bacteria 1439
470 Ga0495630_0117794 3300046517 Bacteria 2014
471 Ga0495630_0139915 3300046517 Unclassified 1840
472 Ga0495630_0265966 3300046517 Unclassified 1310
473 Ga0495666_0021051 3300046526 Bacteria 3229
474 Ga0495666_0225626 3300046526 Bacteria 857
475 Ga0495665_0000974 3300046531 Bacteria 15176
476 Ga0495665_0209265 3300046531 Unclassified 1010
477 Ga0495645_0511877 3300046543 Unclassified 749
478 Ga0495635_0090075 3300046663 Bacteria 2099
479 Ga0495659_0101625 3300046664 Bacteria 1114
480 Ga0495658_0049778 3300046683 Bacteria 2368
481 Ga0495658_0057450 3300046683 Bacteria 2223
482 Ga0495669_0000669 3300046684 Bacteria 14899
483 Ga0495669_0069096 3300046684 Bacteria 1608
484 Ga0495669_0069513 3300046684 Bacteria 1603
485 Ga0495669_0280694 3300046684 Bacteria 801
486 Ga0495624_0192068 3300046690 Bacteria 1242
487 Ga0495581_0009523 3300047315 Bacteria 5623
488 Ga0495581_0357860 3300047315 Unclassified 852
489 Ga0495674_0013768 3300047319 Bacteria 7593
490 Ga0495674_0030468 3300047319 Bacteria 4906
491 Ga0495674_0046446 3300047319 Bacteria 3854
492 Ga0495674_0508694 3300047319 Bacteria 963
493 Ga0495676_0168191 3300047321 Bacteria 1545
494 Ga0495684_0272642 3300047471 Bacteria 1224
495 Ga0495602_0411368 3300048088 Bacteria 962
496 Ga0496101_0034045 3300048904 Bacteria 3597
497 Ga0496102_0021206 3300048905 Bacteria 5746
498 Ga0496102_0238756 3300048905 Bacteria 1714
499 Ga0496103_0250483 3300048906 Unclassified 1140
500 Ga0496104_0112423 3300048907 Bacteria 2612
501 Ga0496104_0188801 3300048907 Bacteria 1972
502 Ga0496104_0288112 3300048907 Bacteria 1555
503 Ga0496104_0291644 3300048907 Bacteria 1544
504 Ga0496104_0464225 3300048907 Bacteria 1178
505 Ga0496107_0240593 3300048910 Bacteria 1347
506 Ga0496108_0000242 3300048911 Bacteria 48793
507 Ga0496108_0022698 3300048911 Bacteria 5162
508 Ga0496109_0000120 3300048912 Bacteria 81828
509 Ga0496109_0038156 3300048912 Bacteria 4342
510 Ga0496110_0000795 3300048913 Bacteria 22036
511 Ga0496111_0047870 3300048914 Bacteria 3080
512 Ga0496111_0057018 3300048914 Bacteria 2828
513 Ga0496112_0000198 3300048915 Bacteria 39413
514 Ga0496112_0003360 3300048915 Bacteria 13207
515 Ga0496112_0027473 3300048915 Bacteria 5486
516 Ga0496112_0047142 3300048915 Bacteria 4227
517 Ga0496112_0169995 3300048915 Bacteria 2145
518 Ga0496112_0172754 3300048915 Bacteria 2126
519 Ga0496113_0000111 3300048916 Bacteria 35094
520 Ga0496113_0027888 3300048916 Bacteria 4054
521 Ga0496115_0004694 3300048918 Bacteria 9905
522 Ga0496115_0018551 3300048918 Bacteria 5344
523 Ga0496115_0145780 3300048918 Bacteria 1954
524 nmdc:mga0n895_97680_c1 3300050512 Bacteria 2943
525 nmdc:mga0rr50_37321_c1 3300050513 Bacteria 3507
526 nmdc:mga08x19_131871_c1 3300050514 Unclassified 1681
527 nmdc:mga08x19_79766_c1 3300050514 Bacteria 2147
528 nmdc:mga08x19_9637_c1 3300050514 Bacteria 5785
529 Ga0495612_0083167 3300053078 Bacteria 1347
530 Ga0495619_0037287 3300053085 Bacteria 3166
531 Ga0587128_003500 3300059630 Bacteria 1747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0294170 Ga0495639_0294170_52_669 204
2 3300033545 Ga0316214_1002742 Ga0316214_10027422 221
3 3300006173 Ga0070716_100331796 Ga0070716_1003317962 224
4 3300035111 Ga0373923_0025821 Ga0373923_0025821_1223_1957 224
5 3300035692 Ga0373935_0086941 Ga0373935_0086941_487_1221 224
6 3300036401 Ga0373937_0042220 Ga0373937_0042220_1613_2347 224
7 3300037068 Ga0373925_0266516 Ga0373925_0266516_296_1030 224
8 3300006173 Ga0070716_100473747 Ga0070716_1004737471 227
9 3300003323 rootH1_10200532 rootH1_102005322 228
10 3300005434 Ga0070709_10062594 Ga0070709_100625942 228
11 3300005437 Ga0070710_10336131 Ga0070710_103361311 228
12 3300006028 Ga0070717_10294952 Ga0070717_102949522 228
13 3300006173 Ga0070716_100065879 Ga0070716_1000658792 228
14 3300006871 Ga0075434_100098816 Ga0075434_1000988164 228
15 3300006914 Ga0075436_100068173 Ga0075436_1000681732 228
16 3300025898 Ga0207692_10042020 Ga0207692_100420202 228
17 3300025939 Ga0207665_10085230 Ga0207665_100852302 228
18 3300050512 nmdc:mga0n895_97680_c1 nmdc:mga0n895_97680_c1_1430_2152 228
19 3300050514 nmdc:mga08x19_79766_c1 nmdc:mga08x19_79766_c1_1074_1796 228
20 3300030863 Ga0265766_1003393 Ga0265766_10033932 230
21 3300037418 Ga0395900_0339978 Ga0395900_0339978_72_770 230
22 3300037418 Ga0395900_0512312 Ga0395900_0512312_100_801 230
23 3300037471 Ga0395905_0008469 Ga0395905_0008469_7084_7785 230
24 3300037471 Ga0395905_0013425 Ga0395905_0013425_4877_5578 230
25 3300037471 Ga0395905_0030235 Ga0395905_0030235_248_946 230
26 3300037471 Ga0395905_0147383 Ga0395905_0147383_282_983 230
27 3300037471 Ga0395905_0272535 Ga0395905_0272535_577_1278 230
28 3300038443 Ga0395901_0495608 Ga0395901_0495608_494_1192 230
29 3300005445 Ga0070708_100005339 Ga0070708_1000053399 231
30 3300005468 Ga0070707_100199499 Ga0070707_1001994992 231
31 3300025922 Ga0207646_10330676 Ga0207646_103306762 231
32 3300006028 Ga0070717_10006770 Ga0070717_1000677012 232
33 3300037068 Ga0373925_0221979 Ga0373925_0221979_798_1496 232
34 3300046472 Ga0495580_0216950 Ga0495580_0216950_66_836 232
35 3300046472 Ga0495580_0227622 Ga0495580_0227622_14_718 232
36 3300046499 Ga0495594_0127770 Ga0495594_0127770_412_1182 232
37 3300046526 Ga0495666_0225626 Ga0495666_0225626_32_730 232
38 3300046664 Ga0495659_0101625 Ga0495659_0101625_288_1058 232
39 3300005434 Ga0070709_10036190 Ga0070709_100361902 233
40 3300005435 Ga0070714_100000096 Ga0070714_10000009661 233
41 3300005436 Ga0070713_100002249 Ga0070713_1000022493 233
42 3300005436 Ga0070713_100333462 Ga0070713_1003334622 233
43 3300005436 Ga0070713_100410068 Ga0070713_1004100682 233
44 3300005436 Ga0070713_100517932 Ga0070713_1005179321 233
45 3300005437 Ga0070710_10023917 Ga0070710_100239174 233
46 3300005439 Ga0070711_100575747 Ga0070711_1005757471 233
47 3300005445 Ga0070708_100292014 Ga0070708_1002920142 233
48 3300005456 Ga0070678_100756263 Ga0070678_1007562631 233
49 3300005467 Ga0070706_100033341 Ga0070706_1000333412 233
50 3300005467 Ga0070706_100094900 Ga0070706_1000949002 233
51 3300005468 Ga0070707_100044794 Ga0070707_1000447942 233
52 3300005471 Ga0070698_100002449 Ga0070698_10000244924 233
53 3300005518 Ga0070699_100000441 Ga0070699_10000044119 233
54 3300005536 Ga0070697_100001451 Ga0070697_10000145110 233
55 3300006028 Ga0070717_10006374 Ga0070717_100063747 233
56 3300006028 Ga0070717_10022846 Ga0070717_100228462 233
57 3300006028 Ga0070717_10143825 Ga0070717_101438252 233
58 3300006028 Ga0070717_10193547 Ga0070717_101935472 233
59 3300006028 Ga0070717_10200924 Ga0070717_102009242 233
60 3300006028 Ga0070717_10202099 Ga0070717_102020993 233
61 3300006028 Ga0070717_10237961 Ga0070717_102379612 233
62 3300006028 Ga0070717_10261729 Ga0070717_102617292 233
63 3300006173 Ga0070716_100005841 Ga0070716_1000058412 233
64 3300006175 Ga0070712_100004622 Ga0070712_1000046229 233
65 3300006175 Ga0070712_100118675 Ga0070712_1001186752 233
66 3300006358 Ga0068871_100097119 Ga0068871_1000971192 233
67 3300006358 Ga0068871_100275607 Ga0068871_1002756072 233
68 3300007788 Ga0099795_10053032 Ga0099795_100530322 233
69 3300013307 Ga0157372_10107547 Ga0157372_101075473 233
70 3300014969 Ga0157376_10198242 Ga0157376_101982423 233
71 3300014969 Ga0157376_10428883 Ga0157376_104288831 233
72 3300019183 Ga0184601_134694 Ga0184601_1346942 233
73 3300019192 Ga0184603_148979 Ga0184603_1489792 233
74 3300020070 Ga0206356_11841538 Ga0206356_118415382 233
75 3300022732 Ga0224569_100499 Ga0224569_1004994 233
76 3300022734 Ga0224571_101787 Ga0224571_1017872 233
77 3300023536 Ga0247552_100137 Ga0247552_1001372 233
78 3300024225 Ga0224572_1003240 Ga0224572_10032402 233
79 3300024225 Ga0224572_1008026 Ga0224572_10080262 233
80 3300024227 Ga0228598_1008762 Ga0228598_10087622 233
81 3300024227 Ga0228598_1019251 Ga0228598_10192512 233
82 3300025898 Ga0207692_10084890 Ga0207692_100848902 233
83 3300025906 Ga0207699_10020090 Ga0207699_100200902 233
84 3300025910 Ga0207684_10001048 Ga0207684_1000104822 233
85 3300025910 Ga0207684_10256313 Ga0207684_102563132 233
86 3300025915 Ga0207693_10001260 Ga0207693_1000126012 233
87 3300025916 Ga0207663_10062577 Ga0207663_100625774 233
88 3300025922 Ga0207646_10001230 Ga0207646_1000123024 233
89 3300025922 Ga0207646_10017066 Ga0207646_100170667 233
90 3300025928 Ga0207700_10222711 Ga0207700_102227112 233
91 3300025929 Ga0207664_10000087 Ga0207664_1000008770 233
92 3300025929 Ga0207664_10102458 Ga0207664_101024581 233
93 3300025939 Ga0207665_10002747 Ga0207665_100027472 233
94 3300026121 Ga0207683_10737234 Ga0207683_107372341 233
95 3300028666 Ga0265336_10035881 Ga0265336_100358812 233
96 3300028800 Ga0265338_10002857 Ga0265338_1000285723 233
97 3300028800 Ga0265338_10056425 Ga0265338_100564252 233
98 3300030760 Ga0265762_1000268 Ga0265762_10002682 233
99 3300030836 Ga0265767_101329 Ga0265767_1013292 233
100 3300030878 Ga0265770_1015544 Ga0265770_10155442 233
101 3300031090 Ga0265760_10016393 Ga0265760_100163934 233
102 3300031249 Ga0265339_10107307 Ga0265339_101073072 233
103 3300031344 Ga0265316_10070945 Ga0265316_100709452 233
104 3300035083 Ga0373926_0055952 Ga0373926_0055952_153_854 233
105 3300035086 Ga0373934_0080725 Ga0373934_0080725_229_930 233
106 3300035111 Ga0373923_0063170 Ga0373923_0063170_596_1300 233
107 3300035113 Ga0373936_0051853 Ga0373936_0051853_46_747 233
108 3300035116 Ga0373945_0057019 Ga0373945_0057019_554_1255 233
109 3300035117 Ga0373953_0059015 Ga0373953_0059015_82_783 233
110 3300035118 Ga0373954_0074535 Ga0373954_0074535_116_817 233
111 3300035119 Ga0373956_0129236 Ga0373956_0129236_172_873 233
112 3300035120 Ga0373957_0002069 Ga0373957_0002069_4857_5561 233
113 3300035171 Ga0373946_0021043 Ga0373946_0021043_717_1418 233
114 3300035171 Ga0373946_0085061 Ga0373946_0085061_37_738 233
115 3300035172 Ga0373955_0126462 Ga0373955_0126462_338_1039 233
116 3300035410 Ga0373924_0128027 Ga0373924_0128027_345_1046 233
117 3300035692 Ga0373935_0001675 Ga0373935_0001675_1350_2051 233
118 3300035692 Ga0373935_0008518 Ga0373935_0008518_1236_1937 233
119 3300035692 Ga0373935_0290490 Ga0373935_0290490_178_879 233
120 3300035695 Ga0373927_0000747 Ga0373927_0000747_18907_19608 233
121 3300035695 Ga0373927_0124747 Ga0373927_0124747_650_1351 233
122 3300035724 Ga0373933_0074252 Ga0373933_0074252_782_1483 233
123 3300035724 Ga0373933_0138582 Ga0373933_0138582_612_1313 233
124 3300035725 Ga0373947_0000971 Ga0373947_0000971_352_1053 233
125 3300036401 Ga0373937_0179904 Ga0373937_0179904_286_987 233
126 3300036457 Ga0265778_006954 Ga0265778_006954_405_1106 233
127 3300037068 Ga0373925_0126277 Ga0373925_0126277_228_929 233
128 3300037068 Ga0373925_0174457 Ga0373925_0174457_980_1681 233
129 3300039438 Ga0436360_1163436 Ga0436360_1163436_274_978 233
130 3300046472 Ga0495580_0001845 Ga0495580_0001845_4976_5677 233
131 3300046472 Ga0495580_0005942 Ga0495580_0005942_8145_8939 233
132 3300046472 Ga0495580_0018154 Ga0495580_0018154_966_1670 233
133 3300046472 Ga0495580_0133362 Ga0495580_0133362_925_1626 233
134 3300046473 Ga0495582_0032232 Ga0495582_0032232_1943_2644 233
135 3300046517 Ga0495630_0117794 Ga0495630_0117794_326_1027 233
136 3300046517 Ga0495630_0139915 Ga0495630_0139915_698_1402 233
137 3300046543 Ga0495645_0511877 Ga0495645_0511877_24_725 233
138 3300046663 Ga0495635_0090075 Ga0495635_0090075_787_1488 233
139 3300046683 Ga0495658_0057450 Ga0495658_0057450_1512_2213 233
140 3300046684 Ga0495669_0280694 Ga0495669_0280694_62_766 233
141 3300046690 Ga0495624_0192068 Ga0495624_0192068_24_725 233
142 3300047315 Ga0495581_0357860 Ga0495581_0357860_118_819 233
143 3300047319 Ga0495674_0013768 Ga0495674_0013768_3919_4620 233
144 3300047319 Ga0495674_0030468 Ga0495674_0030468_281_985 233
145 3300047319 Ga0495674_0046446 Ga0495674_0046446_2417_3118 233
146 3300047319 Ga0495674_0508694 Ga0495674_0508694_88_789 233
147 3300047321 Ga0495676_0168191 Ga0495676_0168191_285_986 233
148 3300047471 Ga0495684_0272642 Ga0495684_0272642_285_986 233
149 3300048088 Ga0495602_0411368 Ga0495602_0411368_195_896 233
150 3300048907 Ga0496104_0464225 Ga0496104_0464225_108_809 233
151 3300048918 Ga0496115_0004694 Ga0496115_0004694_3764_4465 233
152 3300053078 Ga0495612_0083167 Ga0495612_0083167_144_845 233
153 3300059630 Ga0587128_003500 Ga0587128_003500_542_1312 233
154 3300004800 Ga0058861_11829235 Ga0058861_118292352 234
155 3300004803 Ga0058862_12840234 Ga0058862_128402342 234
156 3300005336 Ga0070680_100372566 Ga0070680_1003725662 234
157 3300005356 Ga0070674_100648545 Ga0070674_1006485451 234
158 3300005456 Ga0070678_100036448 Ga0070678_1000364485 234
159 3300005458 Ga0070681_10068582 Ga0070681_100685824 234
160 3300005535 Ga0070684_100030620 Ga0070684_1000306206 234
161 3300005563 Ga0068855_100453177 Ga0068855_1004531772 234
162 3300005563 Ga0068855_100699505 Ga0068855_1006995052 234
163 3300005564 Ga0070664_100107847 Ga0070664_1001078472 234
164 3300005577 Ga0068857_100015288 Ga0068857_1000152888 234
165 3300005614 Ga0068856_100823539 Ga0068856_1008235392 234
166 3300005617 Ga0068859_100419829 Ga0068859_1004198292 234
167 3300005618 Ga0068864_100012547 Ga0068864_1000125476 234
168 3300005841 Ga0068863_100068631 Ga0068863_1000686312 234
169 3300005842 Ga0068858_100494810 Ga0068858_1004948102 234
170 3300006931 Ga0097620_100419831 Ga0097620_1004198312 234
171 3300009174 Ga0105241_10060464 Ga0105241_100604644 234
172 3300009174 Ga0105241_10293582 Ga0105241_102935822 234
173 3300009177 Ga0105248_10392646 Ga0105248_103926462 234
174 3300009551 Ga0105238_10248814 Ga0105238_102488142 234
175 3300010375 Ga0105239_10371932 Ga0105239_103719322 234
176 3300013105 Ga0157369_10159363 Ga0157369_101593633 234
177 3300014325 Ga0163163_10060784 Ga0163163_100607846 234
178 3300025919 Ga0207657_10446489 Ga0207657_104464892 234
179 3300025931 Ga0207644_10030088 Ga0207644_100300882 234
180 3300025941 Ga0207711_10333588 Ga0207711_103335882 234
181 3300025941 Ga0207711_10348070 Ga0207711_103480701 234
182 3300025945 Ga0207679_10061135 Ga0207679_100611352 234
183 3300025949 Ga0207667_10449619 Ga0207667_104496191 234
184 3300025986 Ga0207658_10482574 Ga0207658_104825741 234
185 3300026035 Ga0207703_10452878 Ga0207703_104528782 234
186 3300026041 Ga0207639_10700099 Ga0207639_107000991 234
187 3300026078 Ga0207702_10369105 Ga0207702_103691051 234
188 3300026088 Ga0207641_10045230 Ga0207641_100452302 234
189 3300026095 Ga0207676_10046329 Ga0207676_100463296 234
190 3300026116 Ga0207674_10041099 Ga0207674_100410997 234
191 3300026121 Ga0207683_10051020 Ga0207683_100510206 234
192 3300028381 Ga0268264_11019967 Ga0268264_110199671 234
193 3300044694 Ga0466963_0011928 Ga0466963_0011928_1136_1903 234
194 3300044694 Ga0466963_0196345 Ga0466963_0196345_346_1092 234
195 3300045976 Ga0466967_0184310 Ga0466967_0184310_1152_1877 234
196 3300045976 Ga0466967_0451671 Ga0466967_0451671_308_1033 234
197 3300045976 Ga0466967_0619814 Ga0466967_0619814_198_917 234
198 3300046475 Ga0495639_0049044 Ga0495639_0049044_866_1603 234
199 3300046684 Ga0495669_0000669 Ga0495669_0000669_12138_12878 234
200 3300047315 Ga0495581_0009523 Ga0495581_0009523_667_1404 234
201 3300048907 Ga0496104_0291644 Ga0496104_0291644_254_994 234
202 3300048911 Ga0496108_0022698 Ga0496108_0022698_3072_3812 234
203 3300048912 Ga0496109_0038156 Ga0496109_0038156_2440_3180 234
204 3300048914 Ga0496111_0057018 Ga0496111_0057018_2050_2790 234
205 3300048915 Ga0496112_0047142 Ga0496112_0047142_666_1406 234
206 3300048916 Ga0496113_0027888 Ga0496113_0027888_749_1489 234
207 3300053085 Ga0495619_0037287 Ga0495619_0037287_2079_2816 234
208 3300005983 Ga0081540_1053742 Ga0081540_10537422 235
209 3300006871 Ga0075434_100915906 Ga0075434_1009159062 235
210 3300009177 Ga0105248_10256397 Ga0105248_102563972 235
211 3300009545 Ga0105237_10505355 Ga0105237_105053551 235
212 3300022467 Ga0224712_10136544 Ga0224712_101365441 235
213 3300045051 Ga0451576_0268488 Ga0451576_0268488_754_1461 235
214 3300005445 Ga0070708_100127855 Ga0070708_1001278552 237
215 3300005468 Ga0070707_100066623 Ga0070707_1000666233 237
216 3300025922 Ga0207646_10195945 Ga0207646_101959452 237
217 3300028017 Ga0265356_1006042 Ga0265356_10060422 237
218 3300046531 Ga0495665_0209265 Ga0495665_0209265_217_936 237
219 3300009093 Ga0105240_10426146 Ga0105240_104261462 238
220 3300009545 Ga0105237_10016610 Ga0105237_100166105 238
221 3300009551 Ga0105238_10055203 Ga0105238_100552036 238
222 3300010375 Ga0105239_10598539 Ga0105239_105985392 238
223 3300013307 Ga0157372_10142588 Ga0157372_101425882 238
224 3300013307 Ga0157372_10690339 Ga0157372_106903392 238
225 3300025913 Ga0207695_10008453 Ga0207695_1000845316 238
226 3300026078 Ga0207702_10013988 Ga0207702_100139882 238
227 3300044684 Ga0466966_0115682 Ga0466966_0115682_866_1582 238
228 3300044706 Ga0466964_0028661 Ga0466964_0028661_151_867 238
229 3300050514 nmdc:mga08x19_131871_c1 nmdc:mga08x19_131871_c1_140_856 238
230 3300004801 Ga0058860_12198664 Ga0058860_121986642 239
231 3300005330 Ga0070690_100109009 Ga0070690_1001090092 239
232 3300005331 Ga0070670_100009055 Ga0070670_1000090552 239
233 3300005334 Ga0068869_100001846 Ga0068869_1000018469 239
234 3300005338 Ga0068868_100002791 Ga0068868_1000027912 239
235 3300005338 Ga0068868_100022874 Ga0068868_1000228748 239
236 3300005341 Ga0070691_10160723 Ga0070691_101607232 239
237 3300005343 Ga0070687_100089776 Ga0070687_1000897762 239
238 3300005355 Ga0070671_100633402 Ga0070671_1006334021 239
239 3300005435 Ga0070714_100014828 Ga0070714_10001482811 239
240 3300005435 Ga0070714_100133939 Ga0070714_1001339392 239
241 3300005435 Ga0070714_100188568 Ga0070714_1001885682 239
242 3300005435 Ga0070714_100531053 Ga0070714_1005310532 239
243 3300005436 Ga0070713_100092936 Ga0070713_1000929362 239
244 3300005436 Ga0070713_100098986 Ga0070713_1000989862 239
245 3300005436 Ga0070713_100452123 Ga0070713_1004521231 239
246 3300005440 Ga0070705_100068395 Ga0070705_1000683952 239
247 3300005459 Ga0068867_100302938 Ga0068867_1003029382 239
248 3300005467 Ga0070706_100000514 Ga0070706_10000051423 239
249 3300005468 Ga0070707_100000662 Ga0070707_10000066215 239
250 3300005471 Ga0070698_100004533 Ga0070698_10000453312 239
251 3300005518 Ga0070699_100003886 Ga0070699_10000388613 239
252 3300005535 Ga0070684_100052579 Ga0070684_1000525792 239
253 3300005547 Ga0070693_100024724 Ga0070693_1000247244 239
254 3300005547 Ga0070693_100061331 Ga0070693_1000613312 239
255 3300005563 Ga0068855_100131537 Ga0068855_1001315372 239
256 3300005577 Ga0068857_100011854 Ga0068857_10001185410 239
257 3300005578 Ga0068854_100159587 Ga0068854_1001595872 239
258 3300005614 Ga0068856_100005788 Ga0068856_1000057888 239
259 3300005614 Ga0068856_100020373 Ga0068856_1000203739 239
260 3300005616 Ga0068852_100037792 Ga0068852_1000377922 239
261 3300005616 Ga0068852_100077400 Ga0068852_1000774005 239
262 3300005617 Ga0068859_100004997 Ga0068859_1000049972 239
263 3300005841 Ga0068863_100217732 Ga0068863_1002177322 239
264 3300005842 Ga0068858_100042739 Ga0068858_1000427397 239
265 3300005843 Ga0068860_100018016 Ga0068860_1000180163 239
266 3300005843 Ga0068860_100173182 Ga0068860_1001731823 239
267 3300005843 Ga0068860_100197274 Ga0068860_1001972742 239
268 3300006028 Ga0070717_10012892 Ga0070717_100128922 239
269 3300006028 Ga0070717_10211653 Ga0070717_102116532 239
270 3300006028 Ga0070717_10261373 Ga0070717_102613732 239
271 3300006173 Ga0070716_100032051 Ga0070716_1000320513 239
272 3300006175 Ga0070712_100240952 Ga0070712_1002409522 239
273 3300006175 Ga0070712_100393991 Ga0070712_1003939911 239
274 3300006237 Ga0097621_100013773 Ga0097621_1000137736 239
275 3300006237 Ga0097621_100260265 Ga0097621_1002602652 239
276 3300006358 Ga0068871_100014064 Ga0068871_1000140645 239
277 3300006881 Ga0068865_100044651 Ga0068865_1000446512 239
278 3300006914 Ga0075436_100000510 Ga0075436_10000051015 239
279 3300006914 Ga0075436_100339853 Ga0075436_1003398532 239
280 3300006931 Ga0097620_100004997 Ga0097620_1000049972 239
281 3300007076 Ga0075435_100045994 Ga0075435_1000459942 239
282 3300009098 Ga0105245_10005238 Ga0105245_1000523812 239
283 3300009098 Ga0105245_10121450 Ga0105245_101214503 239
284 3300009176 Ga0105242_10762044 Ga0105242_107620441 239
285 3300009177 Ga0105248_10087800 Ga0105248_100878002 239
286 3300009545 Ga0105237_10034935 Ga0105237_100349358 239
287 3300009545 Ga0105237_10059544 Ga0105237_100595442 239
288 3300009545 Ga0105237_10096007 Ga0105237_100960072 239
289 3300010375 Ga0105239_10105513 Ga0105239_101055132 239
290 3300010375 Ga0105239_10167863 Ga0105239_101678632 239
291 3300011119 Ga0105246_10018819 Ga0105246_100188196 239
292 3300013100 Ga0157373_10001852 Ga0157373_100018527 239
293 3300013104 Ga0157370_10039544 Ga0157370_100395443 239
294 3300013105 Ga0157369_10015406 Ga0157369_1001540610 239
295 3300013105 Ga0157369_10077005 Ga0157369_100770052 239
296 3300013296 Ga0157374_10079239 Ga0157374_100792392 239
297 3300013297 Ga0157378_10000411 Ga0157378_1000041132 239
298 3300013297 Ga0157378_10044668 Ga0157378_100446682 239
299 3300013306 Ga0163162_10020357 Ga0163162_100203577 239
300 3300013307 Ga0157372_10003780 Ga0157372_100037805 239
301 3300013307 Ga0157372_10016043 Ga0157372_100160436 239
302 3300013307 Ga0157372_10038610 Ga0157372_100386108 239
303 3300013307 Ga0157372_10055014 Ga0157372_100550143 239
304 3300013307 Ga0157372_10238753 Ga0157372_102387533 239
305 3300013308 Ga0157375_10419711 Ga0157375_104197111 239
306 3300013308 Ga0157375_10561639 Ga0157375_105616392 239
307 3300014968 Ga0157379_10705638 Ga0157379_107056382 239
308 3300014969 Ga0157376_10033947 Ga0157376_100339475 239
309 3300014969 Ga0157376_10177138 Ga0157376_101771382 239
310 3300014969 Ga0157376_10267866 Ga0157376_102678662 239
311 3300025898 Ga0207692_10013131 Ga0207692_100131315 239
312 3300025899 Ga0207642_10379241 Ga0207642_103792411 239
313 3300025901 Ga0207688_10136460 Ga0207688_101364602 239
314 3300025904 Ga0207647_10006875 Ga0207647_1000687511 239
315 3300025904 Ga0207647_10019145 Ga0207647_100191457 239
316 3300025910 Ga0207684_10000614 Ga0207684_1000061435 239
317 3300025911 Ga0207654_10004384 Ga0207654_100043842 239
318 3300025912 Ga0207707_10018585 Ga0207707_100185854 239
319 3300025913 Ga0207695_10020062 Ga0207695_100200625 239
320 3300025914 Ga0207671_10042802 Ga0207671_100428025 239
321 3300025914 Ga0207671_10074923 Ga0207671_100749232 239
322 3300025915 Ga0207693_10026057 Ga0207693_100260576 239
323 3300025915 Ga0207693_10041078 Ga0207693_100410782 239
324 3300025915 Ga0207693_10147811 Ga0207693_101478112 239
325 3300025919 Ga0207657_10418522 Ga0207657_104185221 239
326 3300025920 Ga0207649_10058342 Ga0207649_100583424 239
327 3300025922 Ga0207646_10004899 Ga0207646_1000489915 239
328 3300025924 Ga0207694_10000718 Ga0207694_1000071820 239
329 3300025924 Ga0207694_10581624 Ga0207694_105816242 239
330 3300025927 Ga0207687_10127310 Ga0207687_101273102 239
331 3300025927 Ga0207687_10171969 Ga0207687_101719692 239
332 3300025928 Ga0207700_10025877 Ga0207700_100258772 239
333 3300025928 Ga0207700_10087615 Ga0207700_100876154 239
334 3300025929 Ga0207664_10046667 Ga0207664_100466672 239
335 3300025931 Ga0207644_10207611 Ga0207644_102076112 239
336 3300025934 Ga0207686_10193969 Ga0207686_101939692 239
337 3300025936 Ga0207670_10180932 Ga0207670_101809322 239
338 3300025938 Ga0207704_10012199 Ga0207704_100121993 239
339 3300025938 Ga0207704_10013374 Ga0207704_100133743 239
340 3300025939 Ga0207665_10001798 Ga0207665_1000179820 239
341 3300025939 Ga0207665_10481806 Ga0207665_104818061 239
342 3300025941 Ga0207711_10024877 Ga0207711_100248774 239
343 3300025942 Ga0207689_10154128 Ga0207689_101541282 239
344 3300025949 Ga0207667_10390220 Ga0207667_103902202 239
345 3300025981 Ga0207640_10008195 Ga0207640_100081953 239
346 3300025981 Ga0207640_10147628 Ga0207640_101476282 239
347 3300026023 Ga0207677_10004281 Ga0207677_100042816 239
348 3300026035 Ga0207703_10003490 Ga0207703_100034903 239
349 3300026035 Ga0207703_10013683 Ga0207703_100136832 239
350 3300026041 Ga0207639_10332043 Ga0207639_103320432 239
351 3300026078 Ga0207702_10047058 Ga0207702_100470582 239
352 3300026088 Ga0207641_10015396 Ga0207641_100153962 239
353 3300026088 Ga0207641_10020552 Ga0207641_100205522 239
354 3300026089 Ga0207648_10023379 Ga0207648_100233793 239
355 3300026089 Ga0207648_10103312 Ga0207648_101033123 239
356 3300026095 Ga0207676_10051605 Ga0207676_100516052 239
357 3300026142 Ga0207698_10174501 Ga0207698_101745012 239
358 3300028381 Ga0268264_10128289 Ga0268264_101282892 239
359 3300035083 Ga0373926_0093666 Ga0373926_0093666_106_825 239
360 3300035085 Ga0373929_0056505 Ga0373929_0056505_53_772 239
361 3300035113 Ga0373936_0012061 Ga0373936_0012061_1221_1940 239
362 3300035113 Ga0373936_0030745 Ga0373936_0030745_181_900 239
363 3300035171 Ga0373946_0032109 Ga0373946_0032109_288_1007 239
364 3300035691 Ga0373931_0127634 Ga0373931_0127634_395_1114 239
365 3300035692 Ga0373935_0015830 Ga0373935_0015830_118_837 239
366 3300035692 Ga0373935_0170685 Ga0373935_0170685_219_938 239
367 3300035695 Ga0373927_0356506 Ga0373927_0356506_27_806 239
368 3300035725 Ga0373947_0001211 Ga0373947_0001211_13232_13951 239
369 3300036401 Ga0373937_0040661 Ga0373937_0040661_2607_3326 239
370 3300037068 Ga0373925_0032616 Ga0373925_0032616_2781_3500 239
371 3300037068 Ga0373925_0039256 Ga0373925_0039256_19_738 239
372 3300037068 Ga0373925_0065985 Ga0373925_0065985_784_1563 239
373 3300039450 Ga0436363_1122218 Ga0436363_1122218_1225_1944 239
374 3300044684 Ga0466966_0264032 Ga0466966_0264032_304_1023 239
375 3300045976 Ga0466967_0043681 Ga0466967_0043681_266_985 239
376 3300046472 Ga0495580_0001673 Ga0495580_0001673_16177_16896 239
377 3300046473 Ga0495582_0000596 Ga0495582_0000596_15330_16049 239
378 3300046475 Ga0495639_0076858 Ga0495639_0076858_132_851 239
379 3300046517 Ga0495630_0265966 Ga0495630_0265966_328_1047 239
380 3300046526 Ga0495666_0021051 Ga0495666_0021051_998_1717 239
381 3300046531 Ga0495665_0000974 Ga0495665_0000974_1800_2519 239
382 3300046683 Ga0495658_0049778 Ga0495658_0049778_640_1359 239
383 3300046684 Ga0495669_0069096 Ga0495669_0069096_184_918 239
384 3300048905 Ga0496102_0238756 Ga0496102_0238756_791_1510 239
385 3300048907 Ga0496104_0112423 Ga0496104_0112423_730_1449 239
386 3300048907 Ga0496104_0188801 Ga0496104_0188801_536_1255 239
387 3300048907 Ga0496104_0288112 Ga0496104_0288112_786_1505 239
388 3300048915 Ga0496112_0003360 Ga0496112_0003360_4984_5703 239
389 3300048915 Ga0496112_0027473 Ga0496112_0027473_3748_4467 239
390 3300048915 Ga0496112_0172754 Ga0496112_0172754_370_1089 239
391 3300048918 Ga0496115_0145780 Ga0496115_0145780_408_1127 239
392 3300050513 nmdc:mga0rr50_37321_c1 nmdc:mga0rr50_37321_c1_1813_2532 239
393 3300050514 nmdc:mga08x19_9637_c1 nmdc:mga08x19_9637_c1_835_1554 239
394 3300005614 Ga0068856_100367268 Ga0068856_1003672681 240
395 3300006237 Ga0097621_100037109 Ga0097621_1000371092 240
396 3300006358 Ga0068871_100048431 Ga0068871_1000484317 240
397 3300039450 Ga0436363_0823540 Ga0436363_0823540_35_757 240
398 3300048915 Ga0496112_0169995 Ga0496112_0169995_1392_2114 240
399 2162886012 MBSR1b_contig_5839400 MBSR1b_0978.00002020 241
400 3300001976 JGI24752J21851_1000767 JGI24752J21851_10007673 241
401 3300002239 JGI24034J26672_10007876 JGI24034J26672_100078761 241
402 3300002459 JGI24751J29686_10002130 JGI24751J29686_100021304 241
403 3300005293 Ga0065715_10104408 Ga0065715_101044081 241
404 3300005329 Ga0070683_100191401 Ga0070683_1001914012 241
405 3300005330 Ga0070690_100000550 Ga0070690_10000055024 241
406 3300005331 Ga0070670_100103499 Ga0070670_1001034993 241
407 3300005333 Ga0070677_10009847 Ga0070677_100098472 241
408 3300005334 Ga0068869_100049372 Ga0068869_1000493722 241
409 3300005335 Ga0070666_10080569 Ga0070666_100805692 241
410 3300005338 Ga0068868_100011852 Ga0068868_1000118527 241
411 3300005339 Ga0070660_100002901 Ga0070660_10000290111 241
412 3300005340 Ga0070689_100048981 Ga0070689_1000489815 241
413 3300005343 Ga0070687_100000493 Ga0070687_1000004939 241
414 3300005344 Ga0070661_100012073 Ga0070661_1000120736 241
415 3300005347 Ga0070668_100014649 Ga0070668_1000146497 241
416 3300005353 Ga0070669_100007500 Ga0070669_1000075003 241
417 3300005354 Ga0070675_100004817 Ga0070675_10000481712 241
418 3300005355 Ga0070671_100226224 Ga0070671_1002262242 241
419 3300005356 Ga0070674_100010705 Ga0070674_1000107054 241
420 3300005364 Ga0070673_100042360 Ga0070673_1000423602 241
421 3300005365 Ga0070688_100049229 Ga0070688_1000492291 241
422 3300005366 Ga0070659_100023459 Ga0070659_1000234596 241
423 3300005367 Ga0070667_100167166 Ga0070667_1001671662 241
424 3300005438 Ga0070701_10072732 Ga0070701_100727322 241
425 3300005455 Ga0070663_100058366 Ga0070663_1000583662 241
426 3300005456 Ga0070678_100081424 Ga0070678_1000814242 241
427 3300005457 Ga0070662_100020616 Ga0070662_1000206163 241
428 3300005459 Ga0068867_100009657 Ga0068867_1000096576 241
429 3300005466 Ga0070685_10001292 Ga0070685_100012927 241
430 3300005535 Ga0070684_100001423 Ga0070684_10000142312 241
431 3300005539 Ga0068853_100008308 Ga0068853_10000830812 241
432 3300005543 Ga0070672_100128304 Ga0070672_1001283042 241
433 3300005544 Ga0070686_100005280 Ga0070686_10000528010 241
434 3300005547 Ga0070693_100165928 Ga0070693_1001659282 241
435 3300005563 Ga0068855_100025048 Ga0068855_10002504810 241
436 3300005564 Ga0070664_100017663 Ga0070664_1000176637 241
437 3300005577 Ga0068857_100001133 Ga0068857_10000113316 241
438 3300005614 Ga0068856_100033324 Ga0068856_1000333241 241
439 3300005615 Ga0070702_100034390 Ga0070702_1000343902 241
440 3300005616 Ga0068852_100001223 Ga0068852_1000012238 241
441 3300005617 Ga0068859_100229921 Ga0068859_1002299212 241
442 3300005618 Ga0068864_100178050 Ga0068864_1001780502 241
443 3300005718 Ga0068866_10001380 Ga0068866_100013807 241
444 3300005719 Ga0068861_100006422 Ga0068861_1000064222 241
445 3300005834 Ga0068851_10001352 Ga0068851_100013527 241
446 3300005840 Ga0068870_10007394 Ga0068870_100073942 241
447 3300005841 Ga0068863_100020550 Ga0068863_1000205502 241
448 3300005842 Ga0068858_100023794 Ga0068858_1000237947 241
449 3300005843 Ga0068860_100036537 Ga0068860_1000365375 241
450 3300005844 Ga0068862_100010568 Ga0068862_1000105686 241
451 3300006237 Ga0097621_100200456 Ga0097621_1002004562 241
452 3300006358 Ga0068871_100119210 Ga0068871_1001192102 241
453 3300006881 Ga0068865_100016197 Ga0068865_1000161972 241
454 3300006931 Ga0097620_100229950 Ga0097620_1002299502 241
455 3300009092 Ga0105250_10021050 Ga0105250_100210503 241
456 3300009092 Ga0105250_10126176 Ga0105250_101261762 241
457 3300009098 Ga0105245_10005029 Ga0105245_100050298 241
458 3300009098 Ga0105245_10052848 Ga0105245_100528486 241
459 3300009174 Ga0105241_10014226 Ga0105241_100142265 241
460 3300009176 Ga0105242_10035557 Ga0105242_100355575 241
461 3300009177 Ga0105248_10050861 Ga0105248_100508615 241
462 3300009545 Ga0105237_10105001 Ga0105237_101050012 241
463 3300009551 Ga0105238_10488924 Ga0105238_104889242 241
464 3300010375 Ga0105239_10029298 Ga0105239_100292985 241
465 3300013100 Ga0157373_10001758 Ga0157373_1000175824 241
466 3300013102 Ga0157371_10002134 Ga0157371_100021349 241
467 3300013105 Ga0157369_10146989 Ga0157369_101469894 241
468 3300013296 Ga0157374_10014284 Ga0157374_100142845 241
469 3300013296 Ga0157374_10216283 Ga0157374_102162832 241
470 3300013297 Ga0157378_10029365 Ga0157378_100293657 241
471 3300013306 Ga0163162_10240409 Ga0163162_102404092 241
472 3300013307 Ga0157372_10002154 Ga0157372_1000215410 241
473 3300013308 Ga0157375_10177291 Ga0157375_101772914 241
474 3300014325 Ga0163163_10001073 Ga0163163_1000107324 241
475 3300014326 Ga0157380_10030441 Ga0157380_100304412 241
476 3300014745 Ga0157377_10000768 Ga0157377_1000076820 241
477 3300014968 Ga0157379_10005366 Ga0157379_1000536615 241
478 3300014969 Ga0157376_10277746 Ga0157376_102777462 241
479 3300017792 Ga0163161_10001969 Ga0163161_1000196923 241
480 3300025321 Ga0207656_10007564 Ga0207656_100075642 241
481 3300025899 Ga0207642_10093368 Ga0207642_100933681 241
482 3300025901 Ga0207688_10005204 Ga0207688_100052045 241
483 3300025903 Ga0207680_10001756 Ga0207680_1000175615 241
484 3300025907 Ga0207645_10001180 Ga0207645_1000118011 241
485 3300025908 Ga0207643_10001067 Ga0207643_100010678 241
486 3300025914 Ga0207671_10070079 Ga0207671_100700795 241
487 3300025919 Ga0207657_10004069 Ga0207657_1000406924 241
488 3300025920 Ga0207649_10001087 Ga0207649_1000108724 241
489 3300025925 Ga0207650_10000152 Ga0207650_1000015257 241
490 3300025926 Ga0207659_10003498 Ga0207659_1000349814 241
491 3300025927 Ga0207687_10326428 Ga0207687_103264282 241
492 3300025931 Ga0207644_10003335 Ga0207644_1000333515 241
493 3300025933 Ga0207706_10000740 Ga0207706_1000074024 241
494 3300025936 Ga0207670_10555951 Ga0207670_105559511 241
495 3300025938 Ga0207704_10009815 Ga0207704_100098157 241
496 3300025940 Ga0207691_10000308 Ga0207691_1000030832 241
497 3300025941 Ga0207711_10003068 Ga0207711_100030688 241
498 3300025942 Ga0207689_10000618 Ga0207689_1000061824 241
499 3300025944 Ga0207661_10007082 Ga0207661_100070828 241
500 3300025945 Ga0207679_10000298 Ga0207679_1000029824 241
501 3300025949 Ga0207667_10345975 Ga0207667_103459751 241
502 3300025961 Ga0207712_10256422 Ga0207712_102564222 241
503 3300025986 Ga0207658_10003391 Ga0207658_100033917 241
504 3300026023 Ga0207677_10010267 Ga0207677_100102679 241
505 3300026023 Ga0207677_10032062 Ga0207677_100320626 241
506 3300026035 Ga0207703_10007555 Ga0207703_100075552 241
507 3300026041 Ga0207639_10003445 Ga0207639_100034456 241
508 3300026067 Ga0207678_10003018 Ga0207678_100030186 241
509 3300026078 Ga0207702_10427401 Ga0207702_104274012 241
510 3300026088 Ga0207641_10000052 Ga0207641_1000005223 241
511 3300026089 Ga0207648_10003962 Ga0207648_1000396224 241
512 3300026095 Ga0207676_10000176 Ga0207676_1000017638 241
513 3300026116 Ga0207674_10000561 Ga0207674_1000056132 241
514 3300026118 Ga0207675_100005443 Ga0207675_1000054438 241
515 3300026121 Ga0207683_10001978 Ga0207683_100019789 241
516 3300028379 Ga0268266_10001266 Ga0268266_1000126623 241
517 3300028380 Ga0268265_10008088 Ga0268265_1000808811 241
518 3300028381 Ga0268264_10005269 Ga0268264_1000526915 241
519 3300045976 Ga0466967_0542645 Ga0466967_0542645_214_948 241
520 3300046684 Ga0495669_0069513 Ga0495669_0069513_796_1587 241
521 3300048904 Ga0496101_0034045 Ga0496101_0034045_1194_1985 241
522 3300048905 Ga0496102_0021206 Ga0496102_0021206_2690_3415 241
523 3300048906 Ga0496103_0250483 Ga0496103_0250483_350_1075 241
524 3300048910 Ga0496107_0240593 Ga0496107_0240593_286_1050 241
525 3300048911 Ga0496108_0000242 Ga0496108_0000242_12135_12899 241
526 3300048912 Ga0496109_0000120 Ga0496109_0000120_10760_11524 241
527 3300048913 Ga0496110_0000795 Ga0496110_0000795_11996_12760 241
528 3300048914 Ga0496111_0047870 Ga0496111_0047870_2151_2915 241
529 3300048915 Ga0496112_0000198 Ga0496112_0000198_25647_26411 241
530 3300048916 Ga0496113_0000111 Ga0496113_0000111_22368_23132 241
531 3300048918 Ga0496115_0018551 Ga0496115_0018551_2339_3103 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05191

ADK_lid

Adenylate kinase, active site lid

188

223

0.98

PF00406

ADK

Adenylate kinase

59

252

0.94

PF13207

AAA_17

AAA domain

60

193

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s36-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119k mutant 0.8832 11 227
6rze-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119a mutant 0.8801 11 227
4np6-assembly1.cif.gz_B crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.8706 10 228
3cm0-assembly1.cif.gz_A crystal structure of adenylate kinase from thermus thermophilus hb8 0.8682 11 229
6s36-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119k mutant 0.8677 11 227
ID Description Score Start End Superfamily
3cm0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8682 11 229 3.40.50.300
3cm0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8461 11 229 3.40.50.300
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8446 12 229 3.40.50.300
af_A5PMF1_372_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8445 10 229 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8401 10 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V8DQM9-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9504 11 135 GO:0004017
GO:0005524
GO:0005737
AF-A0A4Y7WT41-F1-model_v4 deleted 0.9475 11 133
AF-A0A7S4B527-F1-model_v4 Adenylate kinase active site lid domain-containing protein 0.9274 9 136 GO:0005524
GO:0006139
GO:0019205
AF-A0A2V8DQM9-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9273 11 135 GO:0004017
GO:0005524
GO:0005737
AF-A0A7S3TAL3-F1-model_v4 Adenylate kinase 0.9271 10 143 GO:0005524
GO:0006139
GO:0019205

Feature Viewer

pLDDT pTM Quality
86.44 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map