metagRoot

F459579

General Info

Members	Datasets	Scaffolds	Average Seq Length
527	264	521	271

Family's Representative Sequence

Representative Sequence	3300045976\|Ga0466967_0097827\|Ga0466967_0097827_1501_2355
Length	284
Sequence	MAGRGTGADFVEALARGLDVLAAFDRDRPRMSLTEIATATSLARPTARRLLLTLQELGFVRAEDGVFTLTPQVLRLGVAYVGSLGLWDVARPHMEDLVRQTGESSSMSQLDGSDIVYVARVAVPKIITLRVDIGTRFPALFTSQGKVLLAALPPDRVDEVLAEPSRSGLPQALPRSRAQVEEELRGVRARGWALADEELAPGVRSVAAPVRDGAGVVRAAMNVTVHAAETSVDTLVEKYLPLLLRTTGEVSADWALWQARPHLEIDAATGADRGPAQDAGSAAG

Samples

	Sample ID	Description	Type	Environment
1	2622736605	Geodermatophilus ruber DSM 45317	Isolate	Rhizosphere
2	2643221641	Nocardioides sp. Root122	Isolate	Unclassified
3	2816332119	Kribbella amoyensis DSM 24683	Isolate	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
6	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
7	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
8	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
13	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
16	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
26	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
27	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
28	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
29	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
30	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
42	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
43	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
44	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
45	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
46	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
47	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
48	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
49	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
50	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
51	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
52	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
53	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
54	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
55	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
58	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
59	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
60	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
61	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
62	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
63	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
64	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
65	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
76	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
77	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
80	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
91	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
92	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
93	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
94	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
95	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
96	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
97	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
98	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
99	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
100	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
103	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
104	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
105	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
106	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
107	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
154	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
157	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
158	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
159	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
160	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
161	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
162	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
163	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
164	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
165	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
166	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
167	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
168	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
169	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
170	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
171	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
172	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
173	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
174	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
175	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
176	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
177	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
178	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
179	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
180	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
181	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
182	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
183	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
184	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
185	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
186	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
187	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
188	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
189	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
190	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
191	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
192	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
193	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
194	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
195	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
196	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
197	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
198	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
199	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
200	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
201	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
202	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
203	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
204	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
205	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
206	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
207	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
208	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
209	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
210	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
211	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
212	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
213	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
214	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
215	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
216	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
217	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
218	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
219	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
220	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
221	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
222	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
223	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
224	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
225	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
226	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
227	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
228	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
229	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
230	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
231	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
232	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
233	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
244	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
253	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
254	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
255	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
256	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
257	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
258	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
259	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
260	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
261	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
262	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
263	8016254467	Microbacterium sp. SLBN-111 (version 3)	Isolate	Rhizosphere
264	8047710418	Umezawaea endophytica DSM 103496	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	98.48
Metatranscriptomes	0.38
Isolates	1.14

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.66
Nodule	0
Rhizoplane	17.27
Rhizosphere	77.99
Stem	0
Stem Tuber	0
Unclassified	2.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10006123	3300001990	Bacteria	4121
2	JGI24744J21845_10001848	3300002077	Bacteria	4253
3	JGI24751J29686_10003502	3300002459	Bacteria	3162
4	Ga0070658_10052506	3300005327	Bacteria	3306
5	Ga0070683_100004405	3300005329	Bacteria	11596
6	Ga0070683_100015382	3300005329	Bacteria	6719
7	Ga0070683_100148306	3300005329	Bacteria	2224
8	Ga0070683_100340465	3300005329	Bacteria	1428
9	Ga0068869_100003051	3300005334	Bacteria	10187
10	Ga0068869_100133783	3300005334	Bacteria	1908
11	Ga0070682_100003421	3300005337	Bacteria	8800
12	Ga0070682_100007731	3300005337	Bacteria	6056
13	Ga0070682_100012327	3300005337	Bacteria	4900
14	Ga0070682_100052519	3300005337	Bacteria	2551
15	Ga0068868_100124167	3300005338	Bacteria	2107
16	Ga0070660_100019835	3300005339	Bacteria	4933
17	Ga0070660_100193258	3300005339	Bacteria	1649
18	Ga0070689_100010182	3300005340	Bacteria	6697
19	Ga0070691_10019515	3300005341	Bacteria	3129
20	Ga0070691_10114157	3300005341	Bacteria	1354
21	Ga0070661_100025318	3300005344	Bacteria	4263
22	Ga0070692_10095479	3300005345	Bacteria	1622
23	Ga0070692_10172251	3300005345	Bacteria	1248
24	Ga0070692_10194137	3300005345	Bacteria	1185
25	Ga0070668_100396209	3300005347	Bacteria	1178
26	Ga0070675_100030718	3300005354	Bacteria	4338
27	Ga0070675_100118197	3300005354	Bacteria	2251
28	Ga0070671_100000500	3300005355	Bacteria	27402
29	Ga0070674_100033255	3300005356	Bacteria	3431
30	Ga0070673_100034058	3300005364	Bacteria	3850
31	Ga0070673_100055377	3300005364	Bacteria	3125
32	Ga0070688_100118932	3300005365	Bacteria	1767
33	Ga0070659_100033750	3300005366	Bacteria	3977
34	Ga0070659_100153436	3300005366	Bacteria	1880
35	Ga0070659_100167751	3300005366	Bacteria	1797
36	Ga0070667_100117012	3300005367	Bacteria	2315
37	Ga0070667_100210080	3300005367	Bacteria	1730
38	Ga0070709_10032058	3300005434	Bacteria	3166
39	Ga0070714_100322000	3300005435	Bacteria	1446
40	Ga0070714_100458525	3300005435	Bacteria	1211
41	Ga0070713_100122489	3300005436	Bacteria	2283
42	Ga0070701_10001503	3300005438	Bacteria	8636
43	Ga0070711_100041920	3300005439	Bacteria	3092
44	Ga0070700_100002449	3300005441	Bacteria	9444
45	Ga0070700_100109683	3300005441	Bacteria	1832
46	Ga0070663_100000959	3300005455	Bacteria	15673
47	Ga0070663_100010358	3300005455	Bacteria	5812
48	Ga0070663_100066178	3300005455	Bacteria	2618
49	Ga0070678_100003702	3300005456	Bacteria	8553
50	Ga0070678_100484697	3300005456	Bacteria	1089
51	Ga0070662_100231528	3300005457	Bacteria	1478
52	Ga0068867_100005539	3300005459	Bacteria	8941
53	Ga0070698_100495708	3300005471	Bacteria	1159
54	Ga0070679_100356949	3300005530	Bacteria	1409
55	Ga0070684_100005458	3300005535	Bacteria	9741
56	Ga0070684_100050238	3300005535	Bacteria	3621
57	Ga0070684_100077063	3300005535	Bacteria	2944
58	Ga0070684_100619659	3300005535	Bacteria	1007
59	Ga0070684_100680160	3300005535	Bacteria	959
60	Ga0068853_100002683	3300005539	Bacteria	13413
61	Ga0068853_100408684	3300005539	Bacteria	1271
62	Ga0070672_100025298	3300005543	Bacteria	4400
63	Ga0070686_100077742	3300005544	Bacteria	2189
64	Ga0070696_100149518	3300005546	Bacteria	1713
65	Ga0070693_100000559	3300005547	Bacteria	16472
66	Ga0070693_100090032	3300005547	Bacteria	1848
67	Ga0070665_100057310	3300005548	Bacteria	3906
68	Ga0070665_100317722	3300005548	Bacteria	1561
69	Ga0070665_100695240	3300005548	Bacteria	1030
70	Ga0068855_100021296	3300005563	Bacteria	7773
71	Ga0070664_100712768	3300005564	Unclassified	935
72	Ga0068857_100026735	3300005577	Bacteria	5087
73	Ga0068857_100271006	3300005577	Bacteria	1560
74	Ga0068854_100220062	3300005578	Bacteria	1502
75	Ga0068856_100016943	3300005614	Bacteria	7061
76	Ga0068856_100078646	3300005614	Bacteria	3270
77	Ga0068856_100084600	3300005614	Bacteria	3151
78	Ga0068856_100271123	3300005614	Bacteria	1713
79	Ga0070702_100027279	3300005615	Bacteria	3079
80	Ga0068852_100083660	3300005616	Bacteria	2838
81	Ga0068852_100338176	3300005616	Bacteria	1466
82	Ga0068859_100006559	3300005617	Bacteria	11812
83	Ga0068864_100005607	3300005618	Bacteria	10293
84	Ga0068864_100099020	3300005618	Bacteria	2583
85	Ga0068866_10069456	3300005718	Bacteria	1856
86	Ga0068861_100045617	3300005719	Bacteria	3302
87	Ga0068861_100084795	3300005719	Bacteria	2488
88	Ga0068870_10000046	3300005840	Bacteria	37945
89	Ga0068870_10006890	3300005840	Bacteria	5041
90	Ga0068863_100001184	3300005841	Bacteria	26079
91	Ga0068863_100004060	3300005841	Bacteria	14453
92	Ga0068863_100309570	3300005841	Bacteria	1533
93	Ga0068862_100564219	3300005844	Bacteria	1089
94	Ga0081455_10004519	3300005937	Bacteria	15540
95	Ga0081455_10009149	3300005937	Bacteria	10215
96	Ga0081455_10127091	3300005937	Bacteria	1999
97	Ga0081539_10003079	3300005985	Bacteria	21456
98	Ga0081539_10010950	3300005985	Bacteria	7273
99	Ga0075365_10010786	3300006038	Bacteria	5342
100	Ga0075365_10170940	3300006038	Bacteria	1517
101	Ga0075368_10027040	3300006042	Bacteria	2210
102	Ga0075363_100114926	3300006048	Bacteria	1498
103	Ga0075364_10154724	3300006051	Bacteria	1546
104	Ga0075432_10022999	3300006058	Bacteria	2134
105	Ga0075367_10177059	3300006178	Bacteria	1329
106	Ga0075367_10206316	3300006178	Bacteria	1228
107	Ga0097621_100108606	3300006237	Bacteria	2342
108	Ga0068871_100027250	3300006358	Bacteria	4467
109	Ga0075428_100217305	3300006844	Bacteria	2064
110	Ga0075431_100129402	3300006847	Bacteria	2605
111	Ga0075433_10004150	3300006852	Bacteria	11245
112	Ga0075434_100009359	3300006871	Bacteria	9132
113	Ga0068865_100159231	3300006881	Bacteria	1720
114	Ga0068865_100369249	3300006881	Bacteria	1167
115	Ga0075436_100001360	3300006914	Bacteria	16635
116	Ga0097620_100006559	3300006931	Bacteria	11812
117	Ga0075435_100000781	3300007076	Bacteria	19788
118	Ga0105244_10011342	3300009036	Bacteria	5355
119	Ga0111539_10019753	3300009094	Bacteria	8309
120	Ga0111539_10088275	3300009094	Bacteria	3643
121	Ga0111539_10831519	3300009094	Bacteria	1074
122	Ga0105245_10002794	3300009098	Bacteria	15708
123	Ga0105245_10016355	3300009098	Bacteria	6469
124	Ga0105245_10018530	3300009098	Bacteria	6088
125	Ga0105245_10285555	3300009098	Bacteria	1614
126	Ga0105245_10300332	3300009098	Bacteria	1575
127	Ga0105245_10326109	3300009098	Bacteria	1514
128	Ga0105245_10999363	3300009098	Bacteria	881
129	Ga0105247_10006988	3300009101	Bacteria	6946
130	Ga0114129_10456072	3300009147	Bacteria	1676
131	Ga0114129_11160907	3300009147	Bacteria	964
132	Ga0105243_10026729	3300009148	Bacteria	4419
133	Ga0105243_10031577	3300009148	Bacteria	4084
134	Ga0105243_10065650	3300009148	Bacteria	2916
135	Ga0105243_10121317	3300009148	Bacteria	2204
136	Ga0105243_10356903	3300009148	Bacteria	1344
137	Ga0105241_10001138	3300009174	Bacteria	20247
138	Ga0105242_10443140	3300009176	Bacteria	1222
139	Ga0105248_10190266	3300009177	Bacteria	2312
140	Ga0105248_10239005	3300009177	Bacteria	2045
141	Ga0105237_10077080	3300009545	Bacteria	3324
142	Ga0105237_10108950	3300009545	Bacteria	2761
143	Ga0105238_10088789	3300009551	Bacteria	3077
144	Ga0105238_10342768	3300009551	Bacteria	1483
145	Ga0105238_10374096	3300009551	Bacteria	1415
146	Ga0105249_10038197	3300009553	Bacteria	4356
147	Ga0105249_10078558	3300009553	Bacteria	3062
148	Ga0105239_10003258	3300010375	Bacteria	20035
149	Ga0105239_10004863	3300010375	Bacteria	15896
150	Ga0105239_10021506	3300010375	Bacteria	7112
151	Ga0105239_10533560	3300010375	Bacteria	1336
152	Ga0105246_10000960	3300011119	Bacteria	16495
153	Ga0105246_10001859	3300011119	Bacteria	12702
154	Ga0105246_10011037	3300011119	Bacteria	5599
155	Ga0105246_10290340	3300011119	Bacteria	1315
156	Ga0157371_10006528	3300013102	Bacteria	9599
157	Ga0157369_10037024	3300013105	Bacteria	5344
158	Ga0157374_10030847	3300013296	Bacteria	4869
159	Ga0157378_10230928	3300013297	Bacteria	1763
160	Ga0163162_11530511	3300013306	Bacteria	760
161	Ga0157372_10047643	3300013307	Bacteria	4763
162	Ga0157372_10128522	3300013307	Bacteria	2914
163	Ga0157372_10174539	3300013307	Bacteria	2487
164	Ga0157372_10429118	3300013307	Bacteria	1540
165	Ga0157372_10491015	3300013307	Bacteria	1432
166	Ga0157375_10045447	3300013308	Bacteria	4274
167	Ga0157375_10247219	3300013308	Bacteria	1944
168	Ga0157375_10374074	3300013308	Bacteria	1591
169	Ga0157375_10768617	3300013308	Bacteria	1114
170	Ga0163163_10062641	3300014325	Bacteria	3686
171	Ga0163163_10064568	3300014325	Bacteria	3632
172	Ga0163163_10222447	3300014325	Bacteria	1936
173	Ga0163163_10242226	3300014325	Bacteria	1853
174	Ga0163163_10402555	3300014325	Bacteria	1427
175	Ga0163163_10417084	3300014325	Bacteria	1401
176	Ga0163163_10772093	3300014325	Bacteria	1024
177	Ga0157380_10006487	3300014326	Bacteria	8246
178	Ga0157380_10044591	3300014326	Bacteria	3476
179	Ga0157380_10146778	3300014326	Bacteria	2034
180	Ga0182008_10016607	3300014497	Bacteria	3824
181	Ga0182008_10042895	3300014497	Bacteria	2253
182	Ga0182008_10091580	3300014497	Bacteria	1499
183	Ga0182008_10182336	3300014497	Bacteria	1063
184	Ga0182008_10208128	3300014497	Bacteria	997
185	Ga0157377_10026773	3300014745	Bacteria	3090
186	Ga0157377_10136614	3300014745	Bacteria	1503
187	Ga0157379_10027601	3300014968	Bacteria	5055
188	Ga0157379_10147801	3300014968	Bacteria	2119
189	Ga0157376_10065343	3300014969	Bacteria	3071
190	Ga0157376_10232429	3300014969	Bacteria	1713
191	Ga0163161_10009067	3300017792	Bacteria	6882
192	Ga0163161_10224483	3300017792	Bacteria	1456
193	Ga0206356_10765520	3300020070	Bacteria	4364
194	Ga0206354_10821825	3300020081	Bacteria	1926
195	Ga0213875_10000802	3300021388	Bacteria	23498
196	Ga0207710_10005475	3300025900	Bacteria	5462
197	Ga0207688_10000497	3300025901	Bacteria	18879
198	Ga0207688_10004516	3300025901	Bacteria	7575
199	Ga0207647_10013462	3300025904	Bacteria	5668
200	Ga0207647_10058391	3300025904	Bacteria	2363
201	Ga0207699_10030070	3300025906	Bacteria	3036
202	Ga0207645_10019803	3300025907	Bacteria	4407
203	Ga0207643_10000125	3300025908	Bacteria	53016
204	Ga0207643_10003939	3300025908	Bacteria	7988
205	Ga0207643_10282135	3300025908	Bacteria	1030
206	Ga0207654_10019938	3300025911	Bacteria	3546
207	Ga0207693_10091319	3300025915	Bacteria	2387
208	Ga0207663_10318973	3300025916	Bacteria	1167
209	Ga0207657_10007162	3300025919	Bacteria	11456
210	Ga0207657_10033475	3300025919	Bacteria	4632
211	Ga0207657_10132605	3300025919	Bacteria	2041
212	Ga0207649_10361633	3300025920	Bacteria	1077
213	Ga0207652_10005377	3300025921	Bacteria	10388
214	Ga0207652_10129941	3300025921	Bacteria	2246
215	Ga0207694_10077538	3300025924	Bacteria	2604
216	Ga0207694_10428466	3300025924	Bacteria	1103
217	Ga0207650_10009379	3300025925	Bacteria	6687
218	Ga0207659_10083048	3300025926	Bacteria	2374
219	Ga0207659_10141669	3300025926	Bacteria	1867
220	Ga0207687_10007445	3300025927	Bacteria	7207
221	Ga0207687_10024556	3300025927	Bacteria	4028
222	Ga0207687_10174721	3300025927	Bacteria	1660
223	Ga0207687_10312215	3300025927	Bacteria	1270
224	Ga0207687_10664700	3300025927	Bacteria	882
225	Ga0207700_10098061	3300025928	Bacteria	2330
226	Ga0207644_10004830	3300025931	Bacteria	8773
227	Ga0207690_10086564	3300025932	Bacteria	2202
228	Ga0207690_10421274	3300025932	Bacteria	1068
229	Ga0207706_10001073	3300025933	Bacteria	27771
230	Ga0207706_10058448	3300025933	Bacteria	3396
231	Ga0207670_10026390	3300025936	Bacteria	3659
232	Ga0207669_10068201	3300025937	Bacteria	2220
233	Ga0207669_10101052	3300025937	Bacteria	1907
234	Ga0207704_10034818	3300025938	Bacteria	2878
235	Ga0207704_10326354	3300025938	Bacteria	1186
236	Ga0207691_10012232	3300025940	Bacteria	8226
237	Ga0207691_10036424	3300025940	Bacteria	4558
238	Ga0207689_10000198	3300025942	Bacteria	53018
239	Ga0207661_10008340	3300025944	Bacteria	7398
240	Ga0207661_10018692	3300025944	Bacteria	5153
241	Ga0207661_10031925	3300025944	Bacteria	4074
242	Ga0207661_10253916	3300025944	Bacteria	1564
243	Ga0207661_10372861	3300025944	Bacteria	1291
244	Ga0207679_10003694	3300025945	Bacteria	9486
245	Ga0207679_10237985	3300025945	Bacteria	1541
246	Ga0207679_10527416	3300025945	Bacteria	1057
247	Ga0207651_10138664	3300025960	Bacteria	1875
248	Ga0207651_10263736	3300025960	Bacteria	1416
249	Ga0207712_10571484	3300025961	Bacteria	975
250	Ga0207668_10354682	3300025972	Bacteria	1227
251	Ga0207640_10134653	3300025981	Bacteria	1792
252	Ga0207658_10061441	3300025986	Bacteria	2808
253	Ga0207658_10306056	3300025986	Bacteria	1371
254	Ga0207658_10388310	3300025986	Bacteria	1224
255	Ga0207677_10002285	3300026023	Bacteria	10066
256	Ga0207677_10103893	3300026023	Bacteria	2099
257	Ga0207703_10020158	3300026035	Bacteria	5212
258	Ga0207703_10165911	3300026035	Bacteria	1938
259	Ga0207639_10080434	3300026041	Bacteria	2577
260	Ga0207678_10000446	3300026067	Bacteria	37601
261	Ga0207678_10001386	3300026067	Bacteria	22310
262	Ga0207678_10086486	3300026067	Bacteria	2679
263	Ga0207708_10003120	3300026075	Bacteria	12196
264	Ga0207708_10013615	3300026075	Bacteria	6078
265	Ga0207702_10000481	3300026078	Bacteria	44873
266	Ga0207702_10052967	3300026078	Bacteria	3435
267	Ga0207702_10109253	3300026078	Bacteria	2455
268	Ga0207641_10015824	3300026088	Bacteria	6178
269	Ga0207641_10508731	3300026088	Bacteria	1170
270	Ga0207648_10005677	3300026089	Bacteria	12520
271	Ga0207676_10000324	3300026095	Bacteria	41140
272	Ga0207676_10294868	3300026095	Bacteria	1478
273	Ga0207674_10040630	3300026116	Bacteria	4817
274	Ga0207674_10375828	3300026116	Bacteria	1373
275	Ga0207675_100029712	3300026118	Bacteria	5090
276	Ga0207675_100460159	3300026118	Bacteria	1262
277	Ga0207683_10000172	3300026121	Bacteria	55979
278	Ga0207683_10066105	3300026121	Bacteria	3188
279	Ga0207683_10177131	3300026121	Bacteria	1933
280	Ga0207698_10002027	3300026142	Bacteria	11943
281	Ga0207698_10422258	3300026142	Bacteria	1280
282	Ga0207698_10755396	3300026142	Bacteria	972
283	Ga0209813_10033158	3300027866	Bacteria	1534
284	Ga0207428_10007700	3300027907	Bacteria	9800
285	Ga0268266_10054204	3300028379	Bacteria	3446
286	Ga0268266_10541207	3300028379	Bacteria	1115
287	Ga0268265_10398642	3300028380	Bacteria	1271
288	Ga0307517_10161484	3300028786	Bacteria	1502
289	Ga0307408_100527850	3300031548	Bacteria	1038
290	Ga0316575_10000679	3300031665	Bacteria	10118
291	Ga0316579_10018528	3300031691	Bacteria	3065
292	Ga0316576_10069819	3300031727	Bacteria	2590
293	Ga0316576_10105488	3300031727	Bacteria	2109
294	Ga0316578_10000081	3300031728	Bacteria	21609
295	Ga0316578_10077513	3300031728	Bacteria	1973
296	Ga0307405_10072349	3300031731	Bacteria	2222
297	Ga0316577_10012665	3300031733	Bacteria	4599
298	Ga0307413_10091201	3300031824	Bacteria	1985
299	Ga0307410_10021543	3300031852	Bacteria	3967
300	Ga0307410_10131837	3300031852	Bacteria	1837
301	Ga0307410_10244730	3300031852	Bacteria	1392
302	Ga0307410_10665780	3300031852	Bacteria	874
303	Ga0307406_10116480	3300031901	Bacteria	1849
304	Ga0307406_10154264	3300031901	Bacteria	1642
305	Ga0307406_10171698	3300031901	Bacteria	1570
306	Ga0307407_10009036	3300031903	Bacteria	4617
307	Ga0307407_10196953	3300031903	Bacteria	1347
308	Ga0307412_10240151	3300031911	Bacteria	1401
309	Ga0307409_100021474	3300031995	Bacteria	4427
310	Ga0307409_100044491	3300031995	Bacteria	3344
311	Ga0307409_100106534	3300031995	Bacteria	2340
312	Ga0307409_100168032	3300031995	Bacteria	1927
313	Ga0307409_100339164	3300031995	Bacteria	1413
314	Ga0307409_100346806	3300031995	Bacteria	1399
315	Ga0307409_100902885	3300031995	Bacteria	897
316	Ga0307416_100002229	3300032002	Bacteria	11029
317	Ga0307416_100023569	3300032002	Bacteria	4469
318	Ga0307416_100181412	3300032002	Bacteria	1974
319	Ga0307416_100225049	3300032002	Bacteria	1803
320	Ga0307416_100536983	3300032002	Bacteria	1240
321	Ga0307414_10132763	3300032004	Bacteria	1936
322	Ga0307414_10423698	3300032004	Bacteria	1161
323	Ga0307411_10368690	3300032005	Bacteria	1177
324	Ga0307415_100000404	3300032126	Bacteria	18403
325	Ga0307415_100046119	3300032126	Bacteria	2926
326	Ga0307415_100054223	3300032126	Bacteria	2735
327	Ga0307415_100077654	3300032126	Bacteria	2358
328	Ga0307415_100500369	3300032126	Bacteria	1062
329	Ga0307415_100726423	3300032126	Bacteria	899
330	Ga0316585_10013308	3300032137	Bacteria	2447
331	Ga0316580_10003246	3300032139	Bacteria	4597
332	Ga0316574_0003038	3300035398	Bacteria	8555
333	Ga0316574_0012225	3300035398	Bacteria	4906
334	Ga0316582_0000615	3300036647	Bacteria	13869
335	Ga0316582_0002495	3300036647	Bacteria	8668
336	Ga0316582_0394178	3300036647	Bacteria	954
337	Ga0316584_0001718	3300036712	Bacteria	13426
338	Ga0316584_0032546	3300036712	Bacteria	3859
339	Ga0395898_0140583	3300037466	Bacteria	2311
340	Ga0436364_0141456	3300037853	Bacteria	107449
341	Ga0395901_0002530	3300038443	Bacteria	18531
342	Ga0395901_0438893	3300038443	Bacteria	1337
343	Ga0451789_0128986	3300041443	Bacteria	1716
344	Ga0451789_0398056	3300041443	Bacteria	2884
345	Ga0451791_0141654	3300041451	Bacteria	6475
346	Ga0451791_0374616	3300041451	Bacteria	2010
347	Ga0451793_0934301	3300041452	Bacteria	39444
348	Ga0451793_1160377	3300041452	Bacteria	1189
349	Ga0451797_0038411	3300041453	Bacteria	1856
350	Ga0451797_0654696	3300041453	Bacteria	1053
351	Ga0451802_1693759	3300041460	Bacteria	2905
352	Ga0451807_0462477	3300041486	Bacteria	801
353	Ga0451833_0532434	3300041491	Bacteria	1560
354	Ga0451839_0968946	3300041496	Bacteria	1671
355	Ga0451839_1640158	3300041496	Bacteria	2432
356	Ga0451841_0563244	3300041498	Bacteria	1513
357	Ga0451843_0583516	3300041509	Bacteria	2994
358	Ga0451853_0112927	3300041512	Bacteria	4994
359	Ga0439448_0001333	3300042005	Bacteria	6316
360	Ga0439464_0004084	3300042439	Bacteria	3713
361	Ga0466969_0194574	3300044656	Bacteria	926
362	Ga0466965_0076622	3300044683	Bacteria	1688
363	Ga0466965_0148877	3300044683	Bacteria	1223
364	Ga0466963_0048657	3300044694	Bacteria	2802
365	Ga0466963_0107227	3300044694	Bacteria	1916
366	Ga0466963_0431843	3300044694	Bacteria	929
367	Ga0466964_0032253	3300044706	Bacteria	2081
368	Ga0466970_0058791	3300044765	Bacteria	2058
369	Ga0466957_0020076	3300044842	Bacteria	3933
370	Ga0466957_0248865	3300044842	Bacteria	1181
371	Ga0451576_0153933	3300045051	Bacteria	2398
372	Ga0466967_0005341	3300045976	Bacteria	8878
373	Ga0466967_0015666	3300045976	Bacteria	5952
374	Ga0466967_0041266	3300045976	Bacteria	3977
375	Ga0466967_0065642	3300045976	Bacteria	3231
376	Ga0466967_0097827	3300045976	Bacteria	2679
377	Ga0466967_0154405	3300045976	Bacteria	2149
378	Ga0466967_0295408	3300045976	Bacteria	1557
379	Ga0466967_0837751	3300045976	Bacteria	914
380	Ga0495629_0184530	3300046459	Bacteria	1445
381	Ga0495629_0234043	3300046459	Bacteria	1266
382	Ga0495629_0402019	3300046459	Bacteria	931
383	Ga0495651_0007647	3300046462	Bacteria	8261
384	Ga0495653_0184248	3300046463	Bacteria	1430
385	Ga0495662_0029140	3300046476	Bacteria	2666
386	Ga0495664_0100818	3300046477	Bacteria	1740
387	Ga0495664_0364401	3300046477	Bacteria	870
388	Ga0495594_0295261	3300046499	Bacteria	923
389	Ga0495628_0275600	3300046516	Bacteria	1250
390	Ga0495587_0059077	3300046536	Bacteria	2252
391	Ga0495667_0151504	3300046559	Bacteria	1493
392	Ga0495656_0134399	3300046615	Bacteria	1180
393	Ga0495656_0158962	3300046615	Bacteria	1097
394	Ga0495625_0243797	3300046660	Bacteria	1169
395	Ga0495658_0068598	3300046683	Bacteria	2054
396	Ga0495658_0276493	3300046683	Bacteria	1059
397	Ga0495581_0218313	3300047315	Bacteria	1115
398	Ga0495604_0280085	3300047317	Bacteria	1127
399	Ga0496100_0066097	3300048903	Bacteria	2398
400	Ga0496100_0445794	3300048903	Bacteria	992
401	Ga0496101_0042364	3300048904	Bacteria	3249
402	Ga0496101_0072866	3300048904	Bacteria	2522
403	Ga0496101_0090885	3300048904	Bacteria	2271
404	Ga0496101_0225058	3300048904	Bacteria	1457
405	Ga0496102_0008906	3300048905	Bacteria	8613
406	Ga0496102_0038378	3300048905	Bacteria	4322
407	Ga0496102_0153076	3300048905	Bacteria	2168
408	Ga0496102_0164619	3300048905	Bacteria	2087
409	Ga0496102_0191237	3300048905	Bacteria	1928
410	Ga0496102_0330438	3300048905	Bacteria	1436
411	Ga0496103_0021785	3300048906	Bacteria	3857
412	Ga0496103_0206120	3300048906	Bacteria	1264
413	Ga0496104_0002088	3300048907	Bacteria	17340
414	Ga0496104_0009170	3300048907	Bacteria	8800
415	Ga0496104_0068027	3300048907	Bacteria	3384
416	Ga0496104_0081044	3300048907	Bacteria	3094
417	Ga0496104_0128568	3300048907	Bacteria	2433
418	Ga0496104_0136550	3300048907	Bacteria	2356
419	Ga0496104_0343400	3300048907	Bacteria	1406
420	Ga0496105_0001206	3300048908	Bacteria	18015
421	Ga0496105_0022189	3300048908	Bacteria	5141
422	Ga0496105_0059339	3300048908	Bacteria	3157
423	Ga0496105_0295373	3300048908	Bacteria	1304
424	Ga0496106_0001804	3300048909	Bacteria	16003
425	Ga0496106_0056437	3300048909	Bacteria	2968
426	Ga0496107_0015056	3300048910	Bacteria	5418
427	Ga0496107_0027342	3300048910	Bacteria	4050
428	Ga0496107_0118964	3300048910	Bacteria	1945
429	Ga0496108_0002714	3300048911	Bacteria	14144
430	Ga0496108_0008208	3300048911	Bacteria	8474
431	Ga0496108_0039932	3300048911	Bacteria	3911
432	Ga0496108_0145834	3300048911	Bacteria	2041
433	Ga0496108_0172543	3300048911	Bacteria	1871
434	Ga0496108_0186485	3300048911	Bacteria	1797
435	Ga0496108_0203571	3300048911	Bacteria	1718
436	Ga0496108_0268492	3300048911	Bacteria	1485
437	Ga0496109_0005206	3300048912	Bacteria	10864
438	Ga0496109_0011319	3300048912	Bacteria	7662
439	Ga0496109_0014971	3300048912	Bacteria	6751
440	Ga0496109_0039000	3300048912	Bacteria	4298
441	Ga0496109_0042145	3300048912	Bacteria	4134
442	Ga0496109_0060458	3300048912	Bacteria	3462
443	Ga0496109_0071137	3300048912	Bacteria	3193
444	Ga0496109_0174183	3300048912	Bacteria	2019
445	Ga0496109_0177054	3300048912	Bacteria	2002
446	Ga0496109_0248990	3300048912	Bacteria	1673
447	Ga0496109_0260885	3300048912	Bacteria	1632
448	Ga0496109_0288952	3300048912	Bacteria	1546
449	Ga0496109_0390227	3300048912	Bacteria	1315
450	Ga0496109_0572650	3300048912	Bacteria	1065
451	Ga0496110_0000572	3300048913	Bacteria	25251
452	Ga0496110_0002864	3300048913	Bacteria	13026
453	Ga0496110_0017340	3300048913	Bacteria	6024
454	Ga0496110_0070957	3300048913	Bacteria	3087
455	Ga0496110_0248113	3300048913	Bacteria	1620
456	Ga0496110_0522644	3300048913	Bacteria	1080
457	Ga0496111_0002783	3300048914	Bacteria	10648
458	Ga0496111_0019094	3300048914	Bacteria	4756
459	Ga0496112_0027626	3300048915	Bacteria	5471
460	Ga0496112_0080155	3300048915	Bacteria	3228
461	Ga0496112_0089822	3300048915	Bacteria	3040
462	Ga0496112_0201994	3300048915	Bacteria	1947
463	Ga0496113_0009713	3300048916	Bacteria	6321
464	Ga0496113_0028285	3300048916	Bacteria	4030
465	Ga0496113_0175964	3300048916	Bacteria	1696
466	Ga0496113_0176631	3300048916	Bacteria	1692
467	Ga0496113_0319609	3300048916	Bacteria	1244
468	Ga0496114_0009544	3300048917	Bacteria	7700
469	Ga0496114_0017960	3300048917	Bacteria	5716
470	Ga0496114_0028074	3300048917	Bacteria	4615
471	Ga0496114_0029467	3300048917	Bacteria	4512
472	Ga0496114_0051449	3300048917	Bacteria	3429
473	Ga0496114_0177145	3300048917	Bacteria	1861
474	Ga0496114_0180498	3300048917	Bacteria	1843
475	Ga0496114_0293805	3300048917	Bacteria	1434
476	Ga0496114_0398582	3300048917	Bacteria	1218
477	Ga0496115_0011008	3300048918	Bacteria	6774
478	Ga0496115_0032386	3300048918	Bacteria	4124
479	Ga0496115_0047580	3300048918	Bacteria	3430
480	Ga0501034_0018894	3300049571	Bacteria	7060
481	Ga0501034_0140363	3300049571	Bacteria	2396
482	Ga0501036_0026524	3300049572	Bacteria	4891
483	Ga0501036_0524541	3300049572	Bacteria	985
484	Ga0501037_0017463	3300049573	Bacteria	5281
485	Ga0501038_0006196	3300049574	Bacteria	11063
486	Ga0501039_0013063	3300049575	Bacteria	6349
487	Ga0501040_0405933	3300049576	Bacteria	979
488	Ga0501043_0011728	3300049579	Bacteria	6862
489	Ga0501047_0010445	3300049581	Bacteria	8787
490	Ga0501047_0104857	3300049581	Bacteria	2707
491	Ga0501048_0011498	3300049582	Bacteria	6601
492	Ga0501048_0455080	3300049582	Bacteria	917
493	Ga0501067_0003844	3300049583	Bacteria	8293
494	Ga0501067_0082162	3300049583	Bacteria	1786
495	Ga0501069_0028183	3300049585	Bacteria	3079
496	Ga0501069_0033391	3300049585	Bacteria	2835
497	Ga0501070_0032251	3300049586	Bacteria	4384
498	Ga0501071_0041523	3300049587	Bacteria	3294
499	Ga0501073_0005785	3300049589	Bacteria	9241
500	Ga0501073_0134108	3300049589	Bacteria	1716
501	Ga0501074_0001898	3300049590	Bacteria	14352
502	Ga0501074_0006226	3300049590	Bacteria	8612
503	Ga0501080_0006178	3300049742	Bacteria	10749
504	Ga0501080_0203030	3300049742	Bacteria	1819
505	Ga0501081_0190650	3300049743	Bacteria	1484
506	Ga0501083_0145211	3300049744	Bacteria	1553
507	Ga0501044_0049838	3300049823	Bacteria	4322
508	Ga0501044_0313465	3300049823	Bacteria	1495
509	nmdc:mga03n38_152501_c1	3300050490	Bacteria	1164
510	nmdc:mga03n38_2746_c1	3300050490	Bacteria	5516
511	nmdc:mga0yw44_10204_c1	3300050492	Bacteria	4788
512	nmdc:mga04h51_10821_c1	3300050495	Bacteria	2517
513	nmdc:mga08y16_3829_c1	3300050511	Bacteria	15653
514	nmdc:mga0n895_4325_c1	3300050512	Bacteria	11644
515	nmdc:mga0a205_6794_c1	3300050515	Bacteria	10353
516	Ga0495595_0117839	3300053084	Bacteria	1292
517	Ga0495619_0128038	3300053085	Bacteria	1744
518	Ga0495619_0264322	3300053085	Bacteria	1192
519	Ga0500646_0000148	3300053090	Bacteria	20583
520	Ga0500588_0000940	3300053146	Bacteria	5166
521	Ga0466962_0122586	3300061719	Bacteria	1254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013306	Ga0163162_11530511	Ga0163162_115305111	236
2	3300005577	Ga0068857_100026735	Ga0068857_1000267352	237
3	3300005614	Ga0068856_100084600	Ga0068856_1000846003	237
4	3300005618	Ga0068864_100099020	Ga0068864_1000990202	237
5	3300005844	Ga0068862_100564219	Ga0068862_1005642192	237
6	3300025904	Ga0207647_10058391	Ga0207647_100583912	237
7	3300025919	Ga0207657_10132605	Ga0207657_101326052	237
8	3300025927	Ga0207687_10007445	Ga0207687_100074457	237
9	3300025933	Ga0207706_10058448	Ga0207706_100584484	237
10	3300025938	Ga0207704_10034818	Ga0207704_100348182	237
11	3300025944	Ga0207661_10031925	Ga0207661_100319253	237
12	3300025945	Ga0207679_10237985	Ga0207679_102379852	237
13	3300025961	Ga0207712_10571484	Ga0207712_105714842	237
14	3300025986	Ga0207658_10306056	Ga0207658_103060561	237
15	3300026078	Ga0207702_10052967	Ga0207702_100529672	237
16	3300026095	Ga0207676_10294868	Ga0207676_102948682	237
17	3300026116	Ga0207674_10040630	Ga0207674_100406303	237
18	3300026121	Ga0207683_10177131	Ga0207683_101771312	237
19	3300028380	Ga0268265_10398642	Ga0268265_103986422	237
20	3300005435	Ga0070714_100458525	Ga0070714_1004585251	238
21	3300048916	Ga0496113_0175964	Ga0496113_0175964_942_1664	238
22	3300014497	Ga0182008_10016607	Ga0182008_100166074	240
23	3300041486	Ga0451807_0462477	Ga0451807_0462477_13_750	241
24	3300046459	Ga0495629_0402019	Ga0495629_0402019_17_760	241
25	3300047315	Ga0495581_0218313	Ga0495581_0218313_37_765	241
26	3300036647	Ga0316582_0394178	Ga0316582_0394178_31_765	242
27	3300046477	Ga0495664_0364401	Ga0495664_0364401_81_824	242
28	3300049582	Ga0501048_0455080	Ga0501048_0455080_126_872	242
29	3300041498	Ga0451841_0563244	Ga0451841_0563244_10_750	243
30	3300045976	Ga0466967_0041266	Ga0466967_0041266_684_1421	243
31	3300049743	Ga0501081_0190650	Ga0501081_0190650_18_770	243
32	3300009545	Ga0105237_10108950	Ga0105237_101089502	247
33	3300005329	Ga0070683_100148306	Ga0070683_1001483061	248
34	3300005345	Ga0070692_10194137	Ga0070692_101941371	248
35	3300005456	Ga0070678_100484697	Ga0070678_1004846972	248
36	3300009148	Ga0105243_10065650	Ga0105243_100656503	248
37	3300009176	Ga0105242_10443140	Ga0105242_104431402	248
38	3300009551	Ga0105238_10374096	Ga0105238_103740962	248
39	3300014326	Ga0157380_10044591	Ga0157380_100445913	248
40	3300014745	Ga0157377_10136614	Ga0157377_101366142	248
41	3300025908	Ga0207643_10282135	Ga0207643_102821351	248
42	3300025960	Ga0207651_10263736	Ga0207651_102637362	248
43	3300026121	Ga0207683_10066105	Ga0207683_100661053	248
44	3300048903	Ga0496100_0445794	Ga0496100_0445794_78_887	248
45	3300048905	Ga0496102_0153076	Ga0496102_0153076_484_1293	248
46	3300048907	Ga0496104_0136550	Ga0496104_0136550_494_1330	257
47	3300048908	Ga0496105_0059339	Ga0496105_0059339_1585_2421	257
48	3300048912	Ga0496109_0071137	Ga0496109_0071137_1775_2611	257
49	3300048913	Ga0496110_0070957	Ga0496110_0070957_1685_2521	257
50	3300048916	Ga0496113_0319609	Ga0496113_0319609_325_1161	257
51	3300048917	Ga0496114_0028074	Ga0496114_0028074_1349_2185	257
52	3300049571	Ga0501034_0140363	Ga0501034_0140363_25_855	257
53	3300049583	Ga0501067_0003844	Ga0501067_0003844_2422_3252	257
54	3300049587	Ga0501071_0041523	Ga0501071_0041523_1671_2501	257
55	3300049589	Ga0501073_0005785	Ga0501073_0005785_5962_6792	257
56	3300049590	Ga0501074_0001898	Ga0501074_0001898_7339_8169	257
57	3300049742	Ga0501080_0006178	Ga0501080_0006178_5773_6603	257
58	3300009098	Ga0105245_10300332	Ga0105245_103003321	259
59	3300009148	Ga0105243_10031577	Ga0105243_100315772	259
60	3300048905	Ga0496102_0164619	Ga0496102_0164619_1095_1880	259
61	3300050492	nmdc:mga0yw44_10204_c1	nmdc:mga0yw44_10204_c1_770_1555	259
62	iso_pu_bacteria	8016254467	8016256971	259
63	iso_pu_bacteria	8047710418	8047711944	259
64	3300005535	Ga0070684_100619659	Ga0070684_1006196591	261
65	3300046683	Ga0495658_0276493	Ga0495658_0276493_248_1036	261
66	3300009036	Ga0105244_10011342	Ga0105244_100113423	263
67	3300014497	Ga0182008_10042895	Ga0182008_100428952	263
68	3300046459	Ga0495629_0234043	Ga0495629_0234043_345_1187	263
69	3300046499	Ga0495594_0295261	Ga0495594_0295261_70_912	263
70	3300048904	Ga0496101_0042364	Ga0496101_0042364_714_1514	263
71	3300049583	Ga0501067_0082162	Ga0501067_0082162_197_994	263
72	3300049585	Ga0501069_0033391	Ga0501069_0033391_420_1217	263
73	3300006042	Ga0075368_10027040	Ga0075368_100270402	264
74	3300006048	Ga0075363_100114926	Ga0075363_1001149262	264
75	3300006051	Ga0075364_10154724	Ga0075364_101547242	264
76	3300006178	Ga0075367_10177059	Ga0075367_101770592	264
77	3300006178	Ga0075367_10206316	Ga0075367_102063162	264
78	3300027866	Ga0209813_10033158	Ga0209813_100331582	264
79	3300050490	nmdc:mga03n38_152501_c1	nmdc:mga03n38_152501_c1_117_911	264
80	3300050490	nmdc:mga03n38_2746_c1	nmdc:mga03n38_2746_c1_1161_1955	264
81	3300050495	nmdc:mga04h51_10821_c1	nmdc:mga04h51_10821_c1_1198_1992	264
82	iso_pu_bacteria	2643221641	2644229512	264
83	3300005985	Ga0081539_10003079	Ga0081539_1000307915	265
84	3300046462	Ga0495651_0007647	Ga0495651_0007647_5411_6211	265
85	3300005344	Ga0070661_100025318	Ga0070661_1000253182	266
86	3300005366	Ga0070659_100033750	Ga0070659_1000337502	266
87	3300005455	Ga0070663_100000959	Ga0070663_10000095913	266
88	3300005471	Ga0070698_100495708	Ga0070698_1004957082	266
89	3300005564	Ga0070664_100712768	Ga0070664_1007127681	266
90	3300010375	Ga0105239_10004863	Ga0105239_100048634	266
91	3300011119	Ga0105246_10011037	Ga0105246_100110372	266
92	3300025904	Ga0207647_10013462	Ga0207647_100134624	266
93	3300025919	Ga0207657_10033475	Ga0207657_100334754	266
94	3300025920	Ga0207649_10361633	Ga0207649_103616331	266
95	3300025933	Ga0207706_10001073	Ga0207706_1000107321	266
96	3300025945	Ga0207679_10527416	Ga0207679_105274162	266
97	3300026067	Ga0207678_10001386	Ga0207678_100013861	266
98	3300028786	Ga0307517_10161484	Ga0307517_101614842	266
99	3300041443	Ga0451789_0128986	Ga0451789_0128986_469_1272	266
100	3300041451	Ga0451791_0141654	Ga0451791_0141654_155_958	266
101	3300041452	Ga0451793_1160377	Ga0451793_1160377_225_1028	266
102	3300041491	Ga0451833_0532434	Ga0451833_0532434_514_1317	266
103	3300041496	Ga0451839_0968946	Ga0451839_0968946_576_1379	266
104	3300041496	Ga0451839_1640158	Ga0451839_1640158_168_971	266
105	3300042439	Ga0439464_0004084	Ga0439464_0004084_1255_2067	266
106	3300048917	Ga0496114_0177145	Ga0496114_0177145_845_1648	266
107	3300049585	Ga0501069_0028183	Ga0501069_0028183_933_1736	266
108	3300049586	Ga0501070_0032251	Ga0501070_0032251_621_1424	266
109	3300049742	Ga0501080_0203030	Ga0501080_0203030_61_864	266
110	3300049744	Ga0501083_0145211	Ga0501083_0145211_167_970	266
111	3300005327	Ga0070658_10052506	Ga0070658_100525063	267
112	3300005329	Ga0070683_100004405	Ga0070683_10000440510	267
113	3300005334	Ga0068869_100133783	Ga0068869_1001337832	267
114	3300005337	Ga0070682_100007731	Ga0070682_1000077314	267
115	3300005339	Ga0070660_100019835	Ga0070660_1000198354	267
116	3300005345	Ga0070692_10095479	Ga0070692_100954792	267
117	3300005457	Ga0070662_100231528	Ga0070662_1002315282	267
118	3300005535	Ga0070684_100005458	Ga0070684_1000054587	267
119	3300005546	Ga0070696_100149518	Ga0070696_1001495181	267
120	3300009098	Ga0105245_10002794	Ga0105245_100027946	267
121	3300009551	Ga0105238_10342768	Ga0105238_103427682	267
122	3300009553	Ga0105249_10038197	Ga0105249_100381972	267
123	3300010375	Ga0105239_10003258	Ga0105239_100032586	267
124	3300011119	Ga0105246_10000960	Ga0105246_1000096014	267
125	3300013105	Ga0157369_10037024	Ga0157369_100370245	267
126	3300014325	Ga0163163_10222447	Ga0163163_102224472	267
127	3300014968	Ga0157379_10147801	Ga0157379_101478012	267
128	3300045051	Ga0451576_0153933	Ga0451576_0153933_924_1730	267
129	3300048906	Ga0496103_0021785	Ga0496103_0021785_1512_2318	267
130	3300048912	Ga0496109_0039000	Ga0496109_0039000_2486_3292	267
131	3300048913	Ga0496110_0017340	Ga0496110_0017340_4622_5428	267
132	3300048914	Ga0496111_0019094	Ga0496111_0019094_2955_3761	267
133	3300005548	Ga0070665_100057310	Ga0070665_1000573104	268
134	3300005841	Ga0068863_100004060	Ga0068863_1000040605	268
135	3300009098	Ga0105245_10018530	Ga0105245_100185303	268
136	3300014325	Ga0163163_10064568	Ga0163163_100645683	268
137	3300014325	Ga0163163_10402555	Ga0163163_104025552	268
138	3300014325	Ga0163163_10417084	Ga0163163_104170842	268
139	3300014325	Ga0163163_10772093	Ga0163163_107720932	268
140	3300014326	Ga0157380_10146778	Ga0157380_101467784	268
141	3300017792	Ga0163161_10224483	Ga0163161_102244832	268
142	3300025907	Ga0207645_10019803	Ga0207645_100198034	268
143	3300025927	Ga0207687_10024556	Ga0207687_100245563	268
144	3300026088	Ga0207641_10015824	Ga0207641_100158246	268
145	3300028379	Ga0268266_10054204	Ga0268266_100542042	268
146	3300031995	Ga0307409_100902885	Ga0307409_1009028851	268
147	3300044683	Ga0466965_0076622	Ga0466965_0076622_70_888	268
148	3300044842	Ga0466957_0020076	Ga0466957_0020076_889_1707	268
149	3300046459	Ga0495629_0184530	Ga0495629_0184530_345_1154	268
150	3300046463	Ga0495653_0184248	Ga0495653_0184248_285_1094	268
151	3300046683	Ga0495658_0068598	Ga0495658_0068598_371_1180	268
152	3300048907	Ga0496104_0128568	Ga0496104_0128568_1064_1876	268
153	3300048907	Ga0496104_0343400	Ga0496104_0343400_503_1315	268
154	3300048908	Ga0496105_0295373	Ga0496105_0295373_469_1281	268
155	3300048911	Ga0496108_0002714	Ga0496108_0002714_4120_4932	268
156	3300048912	Ga0496109_0060458	Ga0496109_0060458_831_1643	268
157	3300048915	Ga0496112_0080155	Ga0496112_0080155_2228_3040	268
158	3300048915	Ga0496112_0089822	Ga0496112_0089822_56_868	268
159	3300049571	Ga0501034_0018894	Ga0501034_0018894_5010_5828	268
160	3300049572	Ga0501036_0026524	Ga0501036_0026524_3154_3972	268
161	3300049572	Ga0501036_0524541	Ga0501036_0524541_20_832	268
162	3300049573	Ga0501037_0017463	Ga0501037_0017463_1211_2029	268
163	3300049574	Ga0501038_0006196	Ga0501038_0006196_1233_2051	268
164	3300049575	Ga0501039_0013063	Ga0501039_0013063_4176_4994	268
165	3300049576	Ga0501040_0405933	Ga0501040_0405933_57_869	268
166	3300049579	Ga0501043_0011728	Ga0501043_0011728_4795_5613	268
167	3300049581	Ga0501047_0104857	Ga0501047_0104857_1261_2079	268
168	3300049582	Ga0501048_0011498	Ga0501048_0011498_36_854	268
169	3300049589	Ga0501073_0134108	Ga0501073_0134108_242_1060	268
170	3300049590	Ga0501074_0006226	Ga0501074_0006226_1266_2084	268
171	3300049823	Ga0501044_0049838	Ga0501044_0049838_2669_3487	268
172	3300053085	Ga0495619_0128038	Ga0495619_0128038_579_1388	268
173	3300005329	Ga0070683_100340465	Ga0070683_1003404652	269
174	3300005548	Ga0070665_100317722	Ga0070665_1003177222	269
175	3300005616	Ga0068852_100338176	Ga0068852_1003381762	269
176	3300005985	Ga0081539_10010950	Ga0081539_100109507	269
177	3300009098	Ga0105245_10285555	Ga0105245_102855552	269
178	3300009098	Ga0105245_10999363	Ga0105245_109993631	269
179	3300009147	Ga0114129_10456072	Ga0114129_104560721	269
180	3300009148	Ga0105243_10356903	Ga0105243_103569031	269
181	3300013307	Ga0157372_10491015	Ga0157372_104910151	269
182	3300013308	Ga0157375_10247219	Ga0157375_102472191	269
183	3300017792	Ga0163161_10009067	Ga0163161_100090676	269
184	3300025927	Ga0207687_10664700	Ga0207687_106647001	269
185	3300025937	Ga0207669_10101052	Ga0207669_101010522	269
186	3300025940	Ga0207691_10036424	Ga0207691_100364242	269
187	3300025944	Ga0207661_10253916	Ga0207661_102539162	269
188	3300026118	Ga0207675_100460159	Ga0207675_1004601592	269
189	3300026142	Ga0207698_10422258	Ga0207698_104222582	269
190	3300031665	Ga0316575_10000679	Ga0316575_100006798	269
191	3300031691	Ga0316579_10018528	Ga0316579_100185283	269
192	3300031727	Ga0316576_10069819	Ga0316576_100698193	269
193	3300031727	Ga0316576_10105488	Ga0316576_101054882	269
194	3300031728	Ga0316578_10000081	Ga0316578_100000817	269
195	3300031728	Ga0316578_10077513	Ga0316578_100775132	269
196	3300031733	Ga0316577_10012665	Ga0316577_100126651	269
197	3300032137	Ga0316585_10013308	Ga0316585_100133082	269
198	3300032139	Ga0316580_10003246	Ga0316580_100032462	269
199	3300035398	Ga0316574_0003038	Ga0316574_0003038_2455_3273	269
200	3300035398	Ga0316574_0012225	Ga0316574_0012225_1591_2409	269
201	3300036647	Ga0316582_0000615	Ga0316582_0000615_10745_11563	269
202	3300036647	Ga0316582_0002495	Ga0316582_0002495_3718_4536	269
203	3300036712	Ga0316584_0001718	Ga0316584_0001718_9228_10046	269
204	3300036712	Ga0316584_0032546	Ga0316584_0032546_2292_3110	269
205	3300044656	Ga0466969_0194574	Ga0466969_0194574_72_884	269
206	3300044683	Ga0466965_0148877	Ga0466965_0148877_270_1082	269
207	3300044765	Ga0466970_0058791	Ga0466970_0058791_88_900	269
208	3300048912	Ga0496109_0390227	Ga0496109_0390227_128_976	269
209	3300048917	Ga0496114_0293805	Ga0496114_0293805_320_1138	269
210	iso_pu_bacteria	2622736605	2623501006	269
211	iso_pu_bacteria	2622736605	2623501026	269
212	iso_pu_bacteria	2816332119	2816421868	269
213	3300002459	JGI24751J29686_10003502	JGI24751J29686_100035022	270
214	3300005334	Ga0068869_100003051	Ga0068869_1000030513	270
215	3300005337	Ga0070682_100012327	Ga0070682_1000123273	270
216	3300005340	Ga0070689_100010182	Ga0070689_1000101821	270
217	3300005341	Ga0070691_10019515	Ga0070691_100195152	270
218	3300005354	Ga0070675_100030718	Ga0070675_1000307184	270
219	3300005355	Ga0070671_100000500	Ga0070671_1000005008	270
220	3300005364	Ga0070673_100034058	Ga0070673_1000340582	270
221	3300005365	Ga0070688_100118932	Ga0070688_1001189322	270
222	3300005434	Ga0070709_10032058	Ga0070709_100320582	270
223	3300005435	Ga0070714_100322000	Ga0070714_1003220002	270
224	3300005436	Ga0070713_100122489	Ga0070713_1001224892	270
225	3300005439	Ga0070711_100041920	Ga0070711_1000419205	270
226	3300005441	Ga0070700_100109683	Ga0070700_1001096832	270
227	3300005455	Ga0070663_100010358	Ga0070663_1000103584	270
228	3300005456	Ga0070678_100003702	Ga0070678_1000037027	270
229	3300005530	Ga0070679_100356949	Ga0070679_1003569493	270
230	3300005539	Ga0068853_100002683	Ga0068853_1000026834	270
231	3300005544	Ga0070686_100077742	Ga0070686_1000777422	270
232	3300005547	Ga0070693_100000559	Ga0070693_1000005592	270
233	3300005563	Ga0068855_100021296	Ga0068855_1000212963	270
234	3300005614	Ga0068856_100016943	Ga0068856_10001694310	270
235	3300005614	Ga0068856_100078646	Ga0068856_1000786462	270
236	3300005617	Ga0068859_100006559	Ga0068859_1000065597	270
237	3300005618	Ga0068864_100005607	Ga0068864_1000056073	270
238	3300005840	Ga0068870_10000046	Ga0068870_1000004625	270
239	3300005841	Ga0068863_100001184	Ga0068863_10000118419	270
240	3300005841	Ga0068863_100309570	Ga0068863_1003095701	270
241	3300006058	Ga0075432_10022999	Ga0075432_100229992	270
242	3300006237	Ga0097621_100108606	Ga0097621_1001086062	270
243	3300006358	Ga0068871_100027250	Ga0068871_1000272504	270
244	3300006844	Ga0075428_100217305	Ga0075428_1002173052	270
245	3300006847	Ga0075431_100129402	Ga0075431_1001294021	270
246	3300006852	Ga0075433_10004150	Ga0075433_100041507	270
247	3300006871	Ga0075434_100009359	Ga0075434_1000093595	270
248	3300006914	Ga0075436_100001360	Ga0075436_10000136012	270
249	3300006931	Ga0097620_100006559	Ga0097620_1000065597	270
250	3300007076	Ga0075435_100000781	Ga0075435_1000007818	270
251	3300009094	Ga0111539_10019753	Ga0111539_100197535	270
252	3300009101	Ga0105247_10006988	Ga0105247_100069882	270
253	3300009148	Ga0105243_10121317	Ga0105243_101213172	270
254	3300009174	Ga0105241_10001138	Ga0105241_1000113818	270
255	3300009177	Ga0105248_10239005	Ga0105248_102390052	270
256	3300009545	Ga0105237_10077080	Ga0105237_100770802	270
257	3300010375	Ga0105239_10021506	Ga0105239_100215062	270
258	3300011119	Ga0105246_10001859	Ga0105246_100018594	270
259	3300013102	Ga0157371_10006528	Ga0157371_100065287	270
260	3300013296	Ga0157374_10030847	Ga0157374_100308473	270
261	3300013297	Ga0157378_10230928	Ga0157378_102309282	270
262	3300013307	Ga0157372_10128522	Ga0157372_101285222	270
263	3300013308	Ga0157375_10045447	Ga0157375_100454473	270
264	3300014968	Ga0157379_10027601	Ga0157379_100276013	270
265	3300014969	Ga0157376_10065343	Ga0157376_100653432	270
266	3300020070	Ga0206356_10765520	Ga0206356_107655201	270
267	3300020081	Ga0206354_10821825	Ga0206354_108218252	270
268	3300025900	Ga0207710_10005475	Ga0207710_100054752	270
269	3300025901	Ga0207688_10000497	Ga0207688_1000049714	270
270	3300025906	Ga0207699_10030070	Ga0207699_100300701	270
271	3300025908	Ga0207643_10000125	Ga0207643_1000012521	270
272	3300025911	Ga0207654_10019938	Ga0207654_100199382	270
273	3300025915	Ga0207693_10091319	Ga0207693_100913192	270
274	3300025916	Ga0207663_10318973	Ga0207663_103189731	270
275	3300025919	Ga0207657_10007162	Ga0207657_100071627	270
276	3300025921	Ga0207652_10005377	Ga0207652_100053772	270
277	3300025921	Ga0207652_10129941	Ga0207652_101299412	270
278	3300025924	Ga0207694_10077538	Ga0207694_100775382	270
279	3300025925	Ga0207650_10009379	Ga0207650_100093794	270
280	3300025926	Ga0207659_10141669	Ga0207659_101416692	270
281	3300025928	Ga0207700_10098061	Ga0207700_100980611	270
282	3300025931	Ga0207644_10004830	Ga0207644_100048304	270
283	3300025936	Ga0207670_10026390	Ga0207670_100263902	270
284	3300025942	Ga0207689_10000198	Ga0207689_1000019812	270
285	3300025944	Ga0207661_10008340	Ga0207661_100083403	270
286	3300025945	Ga0207679_10003694	Ga0207679_100036948	270
287	3300026023	Ga0207677_10002285	Ga0207677_100022852	270
288	3300026035	Ga0207703_10020158	Ga0207703_100201584	270
289	3300026041	Ga0207639_10080434	Ga0207639_100804342	270
290	3300026067	Ga0207678_10000446	Ga0207678_1000044628	270
291	3300026075	Ga0207708_10013615	Ga0207708_100136153	270
292	3300026078	Ga0207702_10000481	Ga0207702_1000048115	270
293	3300026078	Ga0207702_10109253	Ga0207702_101092532	270
294	3300026088	Ga0207641_10508731	Ga0207641_105087311	270
295	3300026095	Ga0207676_10000324	Ga0207676_1000032417	270
296	3300026121	Ga0207683_10000172	Ga0207683_1000017215	270
297	3300026142	Ga0207698_10002027	Ga0207698_100020278	270
298	3300027907	Ga0207428_10007700	Ga0207428_100077005	270
299	3300038443	Ga0395901_0438893	Ga0395901_0438893_76_903	270
300	3300042005	Ga0439448_0001333	Ga0439448_0001333_3987_4814	270
301	3300048903	Ga0496100_0066097	Ga0496100_0066097_859_1686	270
302	3300048906	Ga0496103_0206120	Ga0496103_0206120_79_906	270
303	3300048907	Ga0496104_0002088	Ga0496104_0002088_10962_11789	270
304	3300048908	Ga0496105_0001206	Ga0496105_0001206_13516_14343	270
305	3300048909	Ga0496106_0001804	Ga0496106_0001804_8511_9338	270
306	3300048910	Ga0496107_0118964	Ga0496107_0118964_318_1145	270
307	3300048911	Ga0496108_0008208	Ga0496108_0008208_2938_3765	270
308	3300048912	Ga0496109_0011319	Ga0496109_0011319_6228_7055	270
309	3300048913	Ga0496110_0002864	Ga0496110_0002864_8528_9355	270
310	3300048914	Ga0496111_0002783	Ga0496111_0002783_5543_6370	270
311	3300048915	Ga0496112_0027626	Ga0496112_0027626_4383_5210	270
312	3300048916	Ga0496113_0009713	Ga0496113_0009713_4727_5554	270
313	3300050511	nmdc:mga08y16_3829_c1	nmdc:mga08y16_3829_c1_4646_5473	270
314	3300050512	nmdc:mga0n895_4325_c1	nmdc:mga0n895_4325_c1_7911_8738	270
315	3300050515	nmdc:mga0a205_6794_c1	nmdc:mga0a205_6794_c1_5029_5856	270
316	3300005366	Ga0070659_100167751	Ga0070659_1001677513	271
317	3300005535	Ga0070684_100050238	Ga0070684_1000502383	271
318	3300005535	Ga0070684_100680160	Ga0070684_1006801601	271
319	3300005548	Ga0070665_100695240	Ga0070665_1006952402	271
320	3300005614	Ga0068856_100271123	Ga0068856_1002711232	271
321	3300009098	Ga0105245_10326109	Ga0105245_103261092	271
322	3300014325	Ga0163163_10242226	Ga0163163_102422262	271
323	3300014969	Ga0157376_10232429	Ga0157376_102324292	271
324	3300025924	Ga0207694_10428466	Ga0207694_104284662	271
325	3300025927	Ga0207687_10174721	Ga0207687_101747212	271
326	3300025932	Ga0207690_10086564	Ga0207690_100865641	271
327	3300025932	Ga0207690_10421274	Ga0207690_104212741	271
328	3300028379	Ga0268266_10541207	Ga0268266_105412072	271
329	3300032002	Ga0307416_100225049	Ga0307416_1002250491	271
330	3300037466	Ga0395898_0140583	Ga0395898_0140583_886_1707	271
331	3300038443	Ga0395901_0002530	Ga0395901_0002530_6215_7036	271
332	3300041453	Ga0451797_0654696	Ga0451797_0654696_162_992	271
333	3300045976	Ga0466967_0015666	Ga0466967_0015666_2354_3175	271
334	3300045976	Ga0466967_0065642	Ga0466967_0065642_1055_1882	271
335	3300045976	Ga0466967_0154405	Ga0466967_0154405_44_868	271
336	3300046476	Ga0495662_0029140	Ga0495662_0029140_1749_2567	271
337	3300046477	Ga0495664_0100818	Ga0495664_0100818_873_1691	271
338	3300046536	Ga0495587_0059077	Ga0495587_0059077_1074_1892	271
339	3300046559	Ga0495667_0151504	Ga0495667_0151504_413_1231	271
340	3300047317	Ga0495604_0280085	Ga0495604_0280085_140_958	271
341	3300048905	Ga0496102_0191237	Ga0496102_0191237_162_980	271
342	3300048907	Ga0496104_0009170	Ga0496104_0009170_315_1133	271
343	3300048911	Ga0496108_0186485	Ga0496108_0186485_562_1380	271
344	3300048911	Ga0496108_0268492	Ga0496108_0268492_63_884	271
345	3300048912	Ga0496109_0177054	Ga0496109_0177054_342_1160	271
346	3300048912	Ga0496109_0288952	Ga0496109_0288952_319_1140	271
347	3300048913	Ga0496110_0000572	Ga0496110_0000572_14568_15386	271
348	3300048916	Ga0496113_0028285	Ga0496113_0028285_2728_3546	271
349	3300048917	Ga0496114_0180498	Ga0496114_0180498_156_998	271
350	3300048917	Ga0496114_0398582	Ga0496114_0398582_319_1137	271
351	3300053084	Ga0495595_0117839	Ga0495595_0117839_356_1174	271
352	3300053090	Ga0500646_0000148	Ga0500646_0000148_15935_16768	271
353	3300053146	Ga0500588_0000940	Ga0500588_0000940_806_1639	271
354	3300005719	Ga0068861_100084795	Ga0068861_1000847952	272
355	3300005937	Ga0081455_10004519	Ga0081455_1000451913	272
356	3300006038	Ga0075365_10010786	Ga0075365_100107862	272
357	3300006881	Ga0068865_100369249	Ga0068865_1003692492	272
358	3300013308	Ga0157375_10374074	Ga0157375_103740742	272
359	3300014497	Ga0182008_10208128	Ga0182008_102081281	272
360	3300021388	Ga0213875_10000802	Ga0213875_1000080210	272
361	3300025938	Ga0207704_10326354	Ga0207704_103263541	272
362	3300031852	Ga0307410_10244730	Ga0307410_102447302	272
363	3300031911	Ga0307412_10240151	Ga0307412_102401512	272
364	3300032002	Ga0307416_100181412	Ga0307416_1001814122	272
365	3300032005	Ga0307411_10368690	Ga0307411_103686901	272
366	3300032126	Ga0307415_100726423	Ga0307415_1007264231	272
367	3300037853	Ga0436364_0141456	Ga0436364_0141456_67790_68623	272
368	3300044694	Ga0466963_0048657	Ga0466963_0048657_623_1447	272
369	3300044706	Ga0466964_0032253	Ga0466964_0032253_1176_2000	272
370	3300045976	Ga0466967_0295408	Ga0466967_0295408_677_1501	272
371	3300046516	Ga0495628_0275600	Ga0495628_0275600_358_1191	272
372	3300049581	Ga0501047_0010445	Ga0501047_0010445_2986_3822	272
373	3300053085	Ga0495619_0264322	Ga0495619_0264322_186_1010	272
374	3300001990	JGI24737J22298_10006123	JGI24737J22298_100061235	273
375	3300002077	JGI24744J21845_10001848	JGI24744J21845_100018481	273
376	3300005329	Ga0070683_100015382	Ga0070683_1000153822	273
377	3300005337	Ga0070682_100003421	Ga0070682_1000034212	273
378	3300005337	Ga0070682_100052519	Ga0070682_1000525192	273
379	3300005338	Ga0068868_100124167	Ga0068868_1001241672	273
380	3300005339	Ga0070660_100193258	Ga0070660_1001932582	273
381	3300005341	Ga0070691_10114157	Ga0070691_101141572	273
382	3300005345	Ga0070692_10172251	Ga0070692_101722511	273
383	3300005347	Ga0070668_100396209	Ga0070668_1003962091	273
384	3300005354	Ga0070675_100118197	Ga0070675_1001181972	273
385	3300005356	Ga0070674_100033255	Ga0070674_1000332552	273
386	3300005364	Ga0070673_100055377	Ga0070673_1000553772	273
387	3300005366	Ga0070659_100153436	Ga0070659_1001534361	273
388	3300005367	Ga0070667_100117012	Ga0070667_1001170122	273
389	3300005367	Ga0070667_100210080	Ga0070667_1002100802	273
390	3300005438	Ga0070701_10001503	Ga0070701_100015039	273
391	3300005441	Ga0070700_100002449	Ga0070700_1000024492	273
392	3300005455	Ga0070663_100066178	Ga0070663_1000661782	273
393	3300005459	Ga0068867_100005539	Ga0068867_1000055392	273
394	3300005535	Ga0070684_100077063	Ga0070684_1000770632	273
395	3300005539	Ga0068853_100408684	Ga0068853_1004086842	273
396	3300005543	Ga0070672_100025298	Ga0070672_1000252982	273
397	3300005547	Ga0070693_100090032	Ga0070693_1000900322	273
398	3300005577	Ga0068857_100271006	Ga0068857_1002710063	273
399	3300005578	Ga0068854_100220062	Ga0068854_1002200622	273
400	3300005615	Ga0070702_100027279	Ga0070702_1000272792	273
401	3300005616	Ga0068852_100083660	Ga0068852_1000836603	273
402	3300005718	Ga0068866_10069456	Ga0068866_100694562	273
403	3300005719	Ga0068861_100045617	Ga0068861_1000456172	273
404	3300005840	Ga0068870_10006890	Ga0068870_100068903	273
405	3300005937	Ga0081455_10009149	Ga0081455_100091495	273
406	3300005937	Ga0081455_10127091	Ga0081455_101270912	273
407	3300006038	Ga0075365_10170940	Ga0075365_101709401	273
408	3300006881	Ga0068865_100159231	Ga0068865_1001592312	273
409	3300009094	Ga0111539_10088275	Ga0111539_100882754	273
410	3300009094	Ga0111539_10831519	Ga0111539_108315191	273
411	3300009098	Ga0105245_10016355	Ga0105245_100163552	273
412	3300009147	Ga0114129_11160907	Ga0114129_111609072	273
413	3300009148	Ga0105243_10026729	Ga0105243_100267293	273
414	3300009177	Ga0105248_10190266	Ga0105248_101902661	273
415	3300009551	Ga0105238_10088789	Ga0105238_100887892	273
416	3300009553	Ga0105249_10078558	Ga0105249_100785582	273
417	3300010375	Ga0105239_10533560	Ga0105239_105335601	273
418	3300011119	Ga0105246_10290340	Ga0105246_102903401	273
419	3300013307	Ga0157372_10047643	Ga0157372_100476433	273
420	3300013307	Ga0157372_10174539	Ga0157372_101745393	273
421	3300013307	Ga0157372_10429118	Ga0157372_104291181	273
422	3300013308	Ga0157375_10768617	Ga0157375_107686172	273
423	3300014325	Ga0163163_10062641	Ga0163163_100626413	273
424	3300014326	Ga0157380_10006487	Ga0157380_100064876	273
425	3300014497	Ga0182008_10091580	Ga0182008_100915801	273
426	3300014497	Ga0182008_10182336	Ga0182008_101823361	273
427	3300014745	Ga0157377_10026773	Ga0157377_100267732	273
428	3300025901	Ga0207688_10004516	Ga0207688_100045163	273
429	3300025908	Ga0207643_10003939	Ga0207643_100039396	273
430	3300025926	Ga0207659_10083048	Ga0207659_100830482	273
431	3300025927	Ga0207687_10312215	Ga0207687_103122152	273
432	3300025937	Ga0207669_10068201	Ga0207669_100682012	273
433	3300025940	Ga0207691_10012232	Ga0207691_100122322	273
434	3300025944	Ga0207661_10018692	Ga0207661_100186923	273
435	3300025944	Ga0207661_10372861	Ga0207661_103728612	273
436	3300025960	Ga0207651_10138664	Ga0207651_101386642	273
437	3300025972	Ga0207668_10354682	Ga0207668_103546822	273
438	3300025981	Ga0207640_10134653	Ga0207640_101346532	273
439	3300025986	Ga0207658_10061441	Ga0207658_100614413	273
440	3300025986	Ga0207658_10388310	Ga0207658_103883102	273
441	3300026023	Ga0207677_10103893	Ga0207677_101038932	273
442	3300026035	Ga0207703_10165911	Ga0207703_101659112	273
443	3300026067	Ga0207678_10086486	Ga0207678_100864862	273
444	3300026075	Ga0207708_10003120	Ga0207708_100031209	273
445	3300026089	Ga0207648_10005677	Ga0207648_100056776	273
446	3300026116	Ga0207674_10375828	Ga0207674_103758282	273
447	3300026118	Ga0207675_100029712	Ga0207675_1000297125	273
448	3300026142	Ga0207698_10755396	Ga0207698_107553961	273
449	3300031548	Ga0307408_100527850	Ga0307408_1005278501	273
450	3300031731	Ga0307405_10072349	Ga0307405_100723492	273
451	3300031824	Ga0307413_10091201	Ga0307413_100912012	273
452	3300031852	Ga0307410_10021543	Ga0307410_100215432	273
453	3300031852	Ga0307410_10131837	Ga0307410_101318372	273
454	3300031852	Ga0307410_10665780	Ga0307410_106657801	273
455	3300031901	Ga0307406_10116480	Ga0307406_101164802	273
456	3300031901	Ga0307406_10154264	Ga0307406_101542642	273
457	3300031901	Ga0307406_10171698	Ga0307406_101716982	273
458	3300031903	Ga0307407_10009036	Ga0307407_100090362	273
459	3300031903	Ga0307407_10196953	Ga0307407_101969532	273
460	3300031995	Ga0307409_100021474	Ga0307409_1000214744	273
461	3300031995	Ga0307409_100044491	Ga0307409_1000444912	273
462	3300031995	Ga0307409_100106534	Ga0307409_1001065342	273
463	3300031995	Ga0307409_100168032	Ga0307409_1001680322	273
464	3300031995	Ga0307409_100339164	Ga0307409_1003391642	273
465	3300031995	Ga0307409_100346806	Ga0307409_1003468061	273
466	3300032002	Ga0307416_100002229	Ga0307416_1000022296	273
467	3300032002	Ga0307416_100023569	Ga0307416_1000235692	273
468	3300032002	Ga0307416_100536983	Ga0307416_1005369832	273
469	3300032004	Ga0307414_10132763	Ga0307414_101327632	273
470	3300032004	Ga0307414_10423698	Ga0307414_104236982	273
471	3300032126	Ga0307415_100000404	Ga0307415_10000040414	273
472	3300032126	Ga0307415_100046119	Ga0307415_1000461192	273
473	3300032126	Ga0307415_100054223	Ga0307415_1000542232	273
474	3300032126	Ga0307415_100077654	Ga0307415_1000776542	273
475	3300032126	Ga0307415_100500369	Ga0307415_1005003692	273
476	3300041443	Ga0451789_0398056	Ga0451789_0398056_1135_1965	273
477	3300041451	Ga0451791_0374616	Ga0451791_0374616_977_1807	273
478	3300041452	Ga0451793_0934301	Ga0451793_0934301_5782_6612	273
479	3300041453	Ga0451797_0038411	Ga0451797_0038411_688_1518	273
480	3300041460	Ga0451802_1693759	Ga0451802_1693759_1444_2274	273
481	3300041509	Ga0451843_0583516	Ga0451843_0583516_1188_2018	273
482	3300041512	Ga0451853_0112927	Ga0451853_0112927_462_1292	273
483	3300044694	Ga0466963_0107227	Ga0466963_0107227_403_1239	273
484	3300044694	Ga0466963_0431843	Ga0466963_0431843_68_895	273
485	3300044842	Ga0466957_0248865	Ga0466957_0248865_101_928	273
486	3300045976	Ga0466967_0005341	Ga0466967_0005341_3052_3888	273
487	3300045976	Ga0466967_0097827	Ga0466967_0097827_1501_2355	273
488	3300045976	Ga0466967_0837751	Ga0466967_0837751_31_861	273
489	3300046615	Ga0495656_0134399	Ga0495656_0134399_20_850	273
490	3300046615	Ga0495656_0158962	Ga0495656_0158962_129_956	273
491	3300046660	Ga0495625_0243797	Ga0495625_0243797_132_956	273
492	3300048904	Ga0496101_0072866	Ga0496101_0072866_1516_2343	273
493	3300048904	Ga0496101_0090885	Ga0496101_0090885_327_1157	273
494	3300048904	Ga0496101_0225058	Ga0496101_0225058_44_877	273
495	3300048905	Ga0496102_0008906	Ga0496102_0008906_4939_5769	273
496	3300048905	Ga0496102_0038378	Ga0496102_0038378_2912_3742	273
497	3300048905	Ga0496102_0330438	Ga0496102_0330438_293_1123	273
498	3300048907	Ga0496104_0068027	Ga0496104_0068027_596_1426	273
499	3300048907	Ga0496104_0081044	Ga0496104_0081044_685_1515	273
500	3300048908	Ga0496105_0022189	Ga0496105_0022189_2849_3679	273
501	3300048909	Ga0496106_0056437	Ga0496106_0056437_1677_2507	273
502	3300048910	Ga0496107_0015056	Ga0496107_0015056_3662_4492	273
503	3300048910	Ga0496107_0027342	Ga0496107_0027342_2787_3617	273
504	3300048911	Ga0496108_0039932	Ga0496108_0039932_518_1345	273
505	3300048911	Ga0496108_0145834	Ga0496108_0145834_387_1217	273
506	3300048911	Ga0496108_0172543	Ga0496108_0172543_412_1248	273
507	3300048911	Ga0496108_0203571	Ga0496108_0203571_87_908	273
508	3300048912	Ga0496109_0005206	Ga0496109_0005206_525_1355	273
509	3300048912	Ga0496109_0014971	Ga0496109_0014971_4747_5577	273
510	3300048912	Ga0496109_0042145	Ga0496109_0042145_1982_2809	273
511	3300048912	Ga0496109_0174183	Ga0496109_0174183_711_1541	273
512	3300048912	Ga0496109_0248990	Ga0496109_0248990_262_1092	273
513	3300048912	Ga0496109_0260885	Ga0496109_0260885_781_1608	273
514	3300048912	Ga0496109_0572650	Ga0496109_0572650_18_848	273
515	3300048913	Ga0496110_0248113	Ga0496110_0248113_192_1019	273
516	3300048913	Ga0496110_0522644	Ga0496110_0522644_182_1018	273
517	3300048915	Ga0496112_0201994	Ga0496112_0201994_715_1551	273
518	3300048916	Ga0496113_0176631	Ga0496113_0176631_374_1204	273
519	3300048917	Ga0496114_0009544	Ga0496114_0009544_4546_5376	273
520	3300048917	Ga0496114_0017960	Ga0496114_0017960_1349_2179	273
521	3300048917	Ga0496114_0029467	Ga0496114_0029467_2902_3732	273
522	3300048917	Ga0496114_0051449	Ga0496114_0051449_681_1511	273
523	3300048918	Ga0496115_0011008	Ga0496115_0011008_5578_6408	273
524	3300048918	Ga0496115_0032386	Ga0496115_0032386_504_1334	273
525	3300048918	Ga0496115_0047580	Ga0496115_0047580_659_1489	273
526	3300049823	Ga0501044_0313465	Ga0501044_0313465_164_985	273
527	3300061719	Ga0466962_0122586	Ga0466962_0122586_157_981	273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

13

64

0.97 PF01614

IclR

Bacterial transcriptional regulator

78

252

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1ysp-assembly1.cif.gz_A	crystal structure of the c-terminal domain of e. coli transcriptional regulator kdgr.	0.9185	85	255
4kmf-assembly1.cif.gz_A-2	crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna	0.9057	12	70
1ysp-assembly1.cif.gz_A	crystal structure of the c-terminal domain of e. coli transcriptional regulator kdgr.	0.9024	85	255
4wcg-assembly1.cif.gz_A	the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna	0.8938	14	70
5hpi-assembly4.cif.gz_D	crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter	0.8877	86	251

ID	Description	Score	Start	End	Superfamily
2ia2D01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9673	12	70	1.10.10.10
2ia2C01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9661	12	70	1.10.10.10
3r4kD01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9596	13	71	1.10.10.10
2g7uD01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9485	12	70	1.10.10.10
2ia2B01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9437	12	76	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4U9WHM4-F1-model_v4	Pectin degradation repressor protein kdgR	0.9065	96	255	GO:0003677 GO:0003700 GO:0045892
AF-H2K4J8-F1-model_v4	deleted	0.9	86	251
AF-X1EUD4-F1-model_v4	IclR-ED domain-containing protein	0.8876	90	255	GO:0003677 GO:0003700 GO:0045892
AF-A0A6C7Z857-F1-model_v4	deleted	0.881	87	226
AF-A0A353ZUB9-F1-model_v4	IclR family transcriptional regulator	0.8784	119	257	GO:0003677 GO:0003700 GO:0045892

Feature Viewer

pLDDT	pTM	Quality
85.36	0.68	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459579

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF09339

HTH_IclR

IclR helix-turn-helix domain

13

64

0.97

PF01614

IclR

Bacterial transcriptional regulator

78

252

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map