F457476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 512 | 355 | 451 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0346144|Ga0496110_0346144_517_1299 |
| Length | 250 |
| Sequence | LIISATQSVLGLASGMLVGFSLGLVGGGGSILAVPLMVYVVGVPEPHVAIGTSAIAVAANAAINLSNHARGGTVIWSCALVFALAGIVGAFGGSILGKMVEGHRLLALFALVTRSRVGLPDVKISMSNMPAIAGLGLATGTLSGFFGIGGGFLIVPALMLATGMPIMNAVSSSLVAVTAFGMTTAASYAWSGLVSWALAGLFVAGGIVGGLAGTRSARHLAEKRGALNIVFAVVIIAVALYMLARNISIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 8 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 9 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 10 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 11 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 12 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 13 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 14 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 15 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 16 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 17 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 18 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 19 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 20 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 21 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 22 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 23 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 24 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 25 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 26 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 27 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 28 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 29 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 30 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 31 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 32 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 33 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 34 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 35 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 36 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 37 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 38 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 39 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 40 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 41 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 42 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 43 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 44 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 45 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 46 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 47 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 50 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 96 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 97 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 173 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 280 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 310 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 316 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 317 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 318 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 319 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 324 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 331 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 332 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 336 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 338 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 341 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 343 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 344 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 345 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 346 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 347 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 348 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 349 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 350 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 351 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 352 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 353 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 354 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 355 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.61 |
| Metatranscriptomes | 0 |
| Isolates | 11.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.48 |
| Nodule | 7.81 |
| Rhizoplane | 4.49 |
| Rhizosphere | 59.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10020481 | 3300001989 | Bacteria | 2363 |
| 2 | JGI25406J46586_10006811 | 3300003203 | Bacteria | 5249 |
| 3 | JGI25153J46596_10014855 | 3300003215 | Bacteria | 3211 |
| 4 | rootH1_10168036 | 3300003323 | Bacteria | 1249 |
| 5 | JGI25404J52841_10012836 | 3300003659 | Bacteria | 1817 |
| 6 | JGI25405J52794_10011833 | 3300003911 | Bacteria | 1672 |
| 7 | Ga0070683_100042686 | 3300005329 | Bacteria | 4176 |
| 8 | Ga0070666_10079528 | 3300005335 | Bacteria | 2239 |
| 9 | Ga0070680_100024909 | 3300005336 | Bacteria | 4782 |
| 10 | Ga0070680_100133796 | 3300005336 | Bacteria | 2075 |
| 11 | Ga0070680_100516187 | 3300005336 | Bacteria | 1023 |
| 12 | Ga0068868_100202431 | 3300005338 | Bacteria | 1655 |
| 13 | Ga0070660_100031659 | 3300005339 | Bacteria | 3974 |
| 14 | Ga0070660_100089416 | 3300005339 | Bacteria | 2426 |
| 15 | Ga0070709_10003090 | 3300005434 | Bacteria | 8947 |
| 16 | Ga0070709_10012323 | 3300005434 | Bacteria | 4784 |
| 17 | Ga0070714_100111985 | 3300005435 | Bacteria | 2418 |
| 18 | Ga0070714_100145279 | 3300005435 | Bacteria | 2133 |
| 19 | Ga0070713_100002234 | 3300005436 | Bacteria | 12560 |
| 20 | Ga0070713_100090709 | 3300005436 | Bacteria | 2628 |
| 21 | Ga0070713_100126117 | 3300005436 | Bacteria | 2252 |
| 22 | Ga0070713_100138135 | 3300005436 | Bacteria | 2156 |
| 23 | Ga0070713_100247749 | 3300005436 | Bacteria | 1624 |
| 24 | Ga0070710_10000552 | 3300005437 | Bacteria | 17723 |
| 25 | Ga0070711_100052534 | 3300005439 | Bacteria | 2804 |
| 26 | Ga0070711_100062871 | 3300005439 | Bacteria | 2589 |
| 27 | Ga0070711_100166520 | 3300005439 | Bacteria | 1676 |
| 28 | Ga0070663_100005926 | 3300005455 | Bacteria | 7315 |
| 29 | Ga0070678_100004690 | 3300005456 | Bacteria | 7779 |
| 30 | Ga0070678_100029982 | 3300005456 | Bacteria | 3732 |
| 31 | Ga0070678_100158147 | 3300005456 | Bacteria | 1833 |
| 32 | Ga0070681_10037527 | 3300005458 | Bacteria | 4861 |
| 33 | Ga0070681_10051933 | 3300005458 | Bacteria | 4088 |
| 34 | Ga0070679_100034291 | 3300005530 | Bacteria | 5029 |
| 35 | Ga0070684_100003258 | 3300005535 | Bacteria | 12159 |
| 36 | Ga0068853_100039832 | 3300005539 | Bacteria | 4008 |
| 37 | Ga0070665_100089594 | 3300005548 | Bacteria | 3082 |
| 38 | Ga0070665_100268422 | 3300005548 | Bacteria | 1708 |
| 39 | Ga0068855_100015587 | 3300005563 | Bacteria | 9146 |
| 40 | Ga0068855_100055139 | 3300005563 | Bacteria | 4669 |
| 41 | Ga0068855_100188786 | 3300005563 | Bacteria | 2326 |
| 42 | Ga0068855_100217196 | 3300005563 | Bacteria | 2146 |
| 43 | Ga0070664_100069626 | 3300005564 | Bacteria | 3011 |
| 44 | Ga0068857_100191246 | 3300005577 | Bacteria | 1864 |
| 45 | Ga0068854_100018315 | 3300005578 | Bacteria | 4700 |
| 46 | Ga0068854_100032424 | 3300005578 | Bacteria | 3635 |
| 47 | Ga0068856_100000226 | 3300005614 | Bacteria | 61246 |
| 48 | Ga0068856_100485879 | 3300005614 | Bacteria | 1256 |
| 49 | Ga0068859_100575677 | 3300005617 | Bacteria | 1220 |
| 50 | Ga0068864_100065432 | 3300005618 | Bacteria | 3154 |
| 51 | Ga0068864_100348669 | 3300005618 | Bacteria | 1396 |
| 52 | Ga0068861_100404911 | 3300005719 | Bacteria | 1212 |
| 53 | Ga0068851_10036633 | 3300005834 | Bacteria | 2457 |
| 54 | Ga0068863_100158456 | 3300005841 | Bacteria | 2168 |
| 55 | Ga0068858_100150433 | 3300005842 | Bacteria | 2189 |
| 56 | Ga0068860_100000858 | 3300005843 | Bacteria | 33869 |
| 57 | Ga0068860_100279690 | 3300005843 | Bacteria | 1630 |
| 58 | Ga0068862_100049064 | 3300005844 | Bacteria | 3605 |
| 59 | Ga0081455_10003156 | 3300005937 | Bacteria | 19144 |
| 60 | Ga0081455_10006663 | 3300005937 | Bacteria | 12343 |
| 61 | Ga0081540_1002121 | 3300005983 | Bacteria | 16515 |
| 62 | Ga0081540_1003865 | 3300005983 | Bacteria | 11692 |
| 63 | Ga0081540_1012706 | 3300005983 | Bacteria | 5523 |
| 64 | Ga0081540_1015207 | 3300005983 | Bacteria | 4882 |
| 65 | Ga0081540_1018462 | 3300005983 | Bacteria | 4276 |
| 66 | Ga0081540_1038308 | 3300005983 | Bacteria | 2528 |
| 67 | Ga0081539_10000729 | 3300005985 | Bacteria | 65907 |
| 68 | Ga0081539_10105118 | 3300005985 | Bacteria | 1432 |
| 69 | Ga0070717_10001026 | 3300006028 | Bacteria | 18703 |
| 70 | Ga0075365_10033779 | 3300006038 | Bacteria | 3299 |
| 71 | Ga0075368_10067264 | 3300006042 | Bacteria | 1442 |
| 72 | Ga0070712_100310272 | 3300006175 | Bacteria | 1280 |
| 73 | Ga0075362_10105324 | 3300006177 | Bacteria | 1323 |
| 74 | Ga0075367_10078884 | 3300006178 | Bacteria | 1989 |
| 75 | Ga0075369_10038354 | 3300006186 | Bacteria | 2043 |
| 76 | Ga0097621_100200369 | 3300006237 | Bacteria | 1733 |
| 77 | Ga0068865_100093629 | 3300006881 | Bacteria | 2185 |
| 78 | Ga0097620_100575723 | 3300006931 | Bacteria | 1220 |
| 79 | Ga0099825_1043182 | 3300006941 | Bacteria | 1217 |
| 80 | Ga0099824_1002047 | 3300006942 | Bacteria | 29222 |
| 81 | Ga0099822_1004737 | 3300006943 | Bacteria | 17740 |
| 82 | Ga0099795_10005299 | 3300007788 | Bacteria | 3415 |
| 83 | Ga0105240_10131327 | 3300009093 | Bacteria | 3004 |
| 84 | Ga0105240_10133881 | 3300009093 | Bacteria | 2969 |
| 85 | Ga0105240_10183475 | 3300009093 | Bacteria | 2467 |
| 86 | Ga0105245_10540213 | 3300009098 | Bacteria | 1187 |
| 87 | Ga0105248_10042923 | 3300009177 | Bacteria | 5071 |
| 88 | Ga0105248_10195037 | 3300009177 | Bacteria | 2282 |
| 89 | Ga0105248_10487473 | 3300009177 | Bacteria | 1389 |
| 90 | Ga0105237_10006999 | 3300009545 | Bacteria | 12427 |
| 91 | Ga0105237_10264897 | 3300009545 | Bacteria | 1721 |
| 92 | Ga0105238_10063133 | 3300009551 | Bacteria | 3704 |
| 93 | Ga0099796_10001766 | 3300010159 | Bacteria | 4513 |
| 94 | Ga0105239_10142048 | 3300010375 | Bacteria | 2676 |
| 95 | Ga0105239_10714585 | 3300010375 | Bacteria | 1146 |
| 96 | Ga0157370_10177782 | 3300013104 | Bacteria | 1978 |
| 97 | Ga0157369_10017488 | 3300013105 | Bacteria | 8058 |
| 98 | Ga0157369_10102904 | 3300013105 | Bacteria | 3042 |
| 99 | Ga0157369_10533430 | 3300013105 | Bacteria | 1214 |
| 100 | Ga0157378_10002449 | 3300013297 | Bacteria | 16521 |
| 101 | Ga0157378_10146176 | 3300013297 | Bacteria | 2199 |
| 102 | Ga0157372_10390416 | 3300013307 | Bacteria | 1622 |
| 103 | Ga0163163_10418720 | 3300014325 | Bacteria | 1398 |
| 104 | Ga0213876_10002755 | 3300021384 | Bacteria | 10233 |
| 105 | Ga0213876_10054844 | 3300021384 | Bacteria | 2104 |
| 106 | Ga0213875_10053389 | 3300021388 | Bacteria | 1892 |
| 107 | Ga0209148_1000037 | 3300025254 | Bacteria | 494767 |
| 108 | Ga0209148_1015603 | 3300025254 | Bacteria | 1323 |
| 109 | Ga0209455_1000036 | 3300025272 | Bacteria | 473309 |
| 110 | Ga0209564_1000687 | 3300025295 | Bacteria | 49778 |
| 111 | Ga0209758_1005049 | 3300025297 | Bacteria | 10483 |
| 112 | Ga0209758_1030953 | 3300025297 | Bacteria | 2205 |
| 113 | Ga0207697_10067420 | 3300025315 | Bacteria | 1496 |
| 114 | Ga0207692_10001302 | 3300025898 | Bacteria | 9295 |
| 115 | Ga0207692_10244897 | 3300025898 | Bacteria | 1072 |
| 116 | Ga0207699_10023510 | 3300025906 | Bacteria | 3355 |
| 117 | Ga0207699_10043714 | 3300025906 | Bacteria | 2604 |
| 118 | Ga0207699_10045183 | 3300025906 | Bacteria | 2569 |
| 119 | Ga0207699_10054158 | 3300025906 | Bacteria | 2382 |
| 120 | Ga0207707_10103376 | 3300025912 | Bacteria | 2490 |
| 121 | Ga0207707_10401777 | 3300025912 | Bacteria | 1176 |
| 122 | Ga0207695_10043272 | 3300025913 | Bacteria | 4800 |
| 123 | Ga0207671_10035801 | 3300025914 | Bacteria | 3681 |
| 124 | Ga0207671_10069327 | 3300025914 | Bacteria | 2629 |
| 125 | Ga0207671_10213178 | 3300025914 | Bacteria | 1511 |
| 126 | Ga0207693_10052998 | 3300025915 | Bacteria | 3183 |
| 127 | Ga0207663_10017392 | 3300025916 | Bacteria | 4006 |
| 128 | Ga0207663_10349165 | 3300025916 | Bacteria | 1119 |
| 129 | Ga0207660_10058742 | 3300025917 | Bacteria | 2759 |
| 130 | Ga0207660_10087395 | 3300025917 | Bacteria | 2303 |
| 131 | Ga0207662_10253407 | 3300025918 | Bacteria | 1156 |
| 132 | Ga0207657_10008393 | 3300025919 | Bacteria | 10485 |
| 133 | Ga0207652_10047083 | 3300025921 | Bacteria | 3683 |
| 134 | Ga0207652_10201228 | 3300025921 | Bacteria | 1792 |
| 135 | Ga0207659_10648911 | 3300025926 | Bacteria | 902 |
| 136 | Ga0207700_10067007 | 3300025928 | Bacteria | 2746 |
| 137 | Ga0207700_10104751 | 3300025928 | Bacteria | 2264 |
| 138 | Ga0207700_10170217 | 3300025928 | Bacteria | 1817 |
| 139 | Ga0207700_10178628 | 3300025928 | Bacteria | 1776 |
| 140 | Ga0207700_10194546 | 3300025928 | Bacteria | 1706 |
| 141 | Ga0207700_10306910 | 3300025928 | Bacteria | 1372 |
| 142 | Ga0207664_10083898 | 3300025929 | Bacteria | 2598 |
| 143 | Ga0207664_10106409 | 3300025929 | Bacteria | 2325 |
| 144 | Ga0207706_10207672 | 3300025933 | Bacteria | 1717 |
| 145 | Ga0207669_10309118 | 3300025937 | Bacteria | 1205 |
| 146 | Ga0207665_10014858 | 3300025939 | Bacteria | 5119 |
| 147 | Ga0207691_10106876 | 3300025940 | Bacteria | 2492 |
| 148 | Ga0207661_10000959 | 3300025944 | Bacteria | 18985 |
| 149 | Ga0207661_10131837 | 3300025944 | Bacteria | 2142 |
| 150 | Ga0207679_10030874 | 3300025945 | Bacteria | 3746 |
| 151 | Ga0207679_10254565 | 3300025945 | Bacteria | 1494 |
| 152 | Ga0207667_10044714 | 3300025949 | Bacteria | 4691 |
| 153 | Ga0207651_10444586 | 3300025960 | Bacteria | 1111 |
| 154 | Ga0207668_10145275 | 3300025972 | Bacteria | 1829 |
| 155 | Ga0207668_10269404 | 3300025972 | Bacteria | 1391 |
| 156 | Ga0207677_10034976 | 3300026023 | Bacteria | 3258 |
| 157 | Ga0207639_10118793 | 3300026041 | Bacteria | 2168 |
| 158 | Ga0207639_10397786 | 3300026041 | Bacteria | 1240 |
| 159 | Ga0207678_10004600 | 3300026067 | Bacteria | 12396 |
| 160 | Ga0207678_10007829 | 3300026067 | Bacteria | 9431 |
| 161 | Ga0207702_10000191 | 3300026078 | Bacteria | 72810 |
| 162 | Ga0207676_10064715 | 3300026095 | Bacteria | 2909 |
| 163 | Ga0207674_10055839 | 3300026116 | Bacteria | 4013 |
| 164 | Ga0207683_10041933 | 3300026121 | Bacteria | 3997 |
| 165 | Ga0207698_10048829 | 3300026142 | Bacteria | 3216 |
| 166 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 167 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 168 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 169 | Ga0268266_10000638 | 3300028379 | Bacteria | 47680 |
| 170 | Ga0268265_10793281 | 3300028380 | Bacteria | 922 |
| 171 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 172 | Ga0268264_10186784 | 3300028381 | Bacteria | 1886 |
| 173 | Ga0307515_10027090 | 3300028794 | Bacteria | 9818 |
| 174 | Ga0307515_10226688 | 3300028794 | Bacteria | 1672 |
| 175 | Ga0265338_10013087 | 3300028800 | Bacteria | 9401 |
| 176 | Ga0265325_10014373 | 3300031241 | Bacteria | 4476 |
| 177 | Ga0265339_10000047 | 3300031249 | Bacteria | 110601 |
| 178 | Ga0265316_10286909 | 3300031344 | Bacteria | 1202 |
| 179 | Ga0307513_10125136 | 3300031456 | Bacteria | 2528 |
| 180 | Ga0307509_10133330 | 3300031507 | Bacteria | 2435 |
| 181 | Ga0307509_10228166 | 3300031507 | Bacteria | 1668 |
| 182 | Ga0265313_10000992 | 3300031595 | Bacteria | 27897 |
| 183 | Ga0307508_10014562 | 3300031616 | Bacteria | 7175 |
| 184 | Ga0265314_10006028 | 3300031711 | Bacteria | 10795 |
| 185 | Ga0265342_10035731 | 3300031712 | Bacteria | 3039 |
| 186 | Ga0265342_10040613 | 3300031712 | Bacteria | 2821 |
| 187 | Ga0307405_10095835 | 3300031731 | Bacteria | 1977 |
| 188 | Ga0307409_100119908 | 3300031995 | Bacteria | 2225 |
| 189 | Ga0307411_10186486 | 3300032005 | Bacteria | 1579 |
| 190 | Ga0307415_100114467 | 3300032126 | Bacteria | 2008 |
| 191 | Ga0307507_10103959 | 3300033179 | Bacteria | 2360 |
| 192 | Ga0307510_10022034 | 3300033180 | Bacteria | 7406 |
| 193 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 194 | Ga0373930_0013158 | 3300034816 | Bacteria | 1521 |
| 195 | Ga0373940_0065551 | 3300035088 | Bacteria | 1047 |
| 196 | Ga0373944_0039053 | 3300035089 | Bacteria | 1460 |
| 197 | Ga0373952_0006580 | 3300035092 | Bacteria | 2152 |
| 198 | Ga0373939_0076868 | 3300035114 | Bacteria | 1100 |
| 199 | Ga0373953_0035701 | 3300035117 | Bacteria | 1955 |
| 200 | Ga0373943_0092982 | 3300035170 | Bacteria | 1565 |
| 201 | Ga0373946_0076373 | 3300035171 | Bacteria | 1458 |
| 202 | Ga0373955_0116311 | 3300035172 | Bacteria | 1550 |
| 203 | Ga0373924_0027656 | 3300035410 | Bacteria | 2256 |
| 204 | Ga0373931_0008723 | 3300035691 | Bacteria | 4824 |
| 205 | Ga0373935_0000106 | 3300035692 | Bacteria | 37674 |
| 206 | Ga0373935_0123625 | 3300035692 | Bacteria | 1731 |
| 207 | Ga0373927_0000267 | 3300035695 | Bacteria | 41137 |
| 208 | Ga0373927_0032140 | 3300035695 | Bacteria | 3418 |
| 209 | Ga0373933_0000018 | 3300035724 | Bacteria | 98044 |
| 210 | Ga0373933_0094311 | 3300035724 | Bacteria | 1851 |
| 211 | Ga0373925_0002245 | 3300037068 | Bacteria | 15641 |
| 212 | Ga0373925_0047539 | 3300037068 | Bacteria | 3194 |
| 213 | Ga0373925_0127017 | 3300037068 | Bacteria | 1985 |
| 214 | Ga0395900_0265761 | 3300037418 | Bacteria | 1711 |
| 215 | Ga0395900_0499688 | 3300037418 | Bacteria | 1167 |
| 216 | Ga0395898_0004875 | 3300037466 | Bacteria | 14570 |
| 217 | Ga0436364_0310036 | 3300037853 | Bacteria | 2843 |
| 218 | Ga0436364_0482403 | 3300037853 | Bacteria | 6543 |
| 219 | Ga0436364_0699776 | 3300037853 | Bacteria | 2850 |
| 220 | Ga0436365_0093274 | 3300039437 | Bacteria | 81442 |
| 221 | Ga0436365_0372041 | 3300039437 | Bacteria | 3768 |
| 222 | Ga0436365_1240066 | 3300039437 | Bacteria | 1817 |
| 223 | Ga0436365_1925389 | 3300039437 | Bacteria | 925 |
| 224 | Ga0436363_1370601 | 3300039450 | Bacteria | 1094 |
| 225 | Ga0436362_0626323 | 3300039453 | Bacteria | 7982 |
| 226 | Ga0451787_672321 | 3300041441 | Bacteria | 894 |
| 227 | Ga0451791_0080411 | 3300041451 | Bacteria | 1300 |
| 228 | Ga0466963_0285305 | 3300044694 | Bacteria | 1160 |
| 229 | Ga0466971_0019749 | 3300044719 | Bacteria | 2994 |
| 230 | Ga0466968_0086115 | 3300044735 | Bacteria | 1387 |
| 231 | Ga0466957_0115331 | 3300044842 | Bacteria | 1708 |
| 232 | Ga0466957_0149230 | 3300044842 | Bacteria | 1511 |
| 233 | Ga0466959_0080951 | 3300045049 | Bacteria | 2340 |
| 234 | Ga0466967_0019242 | 3300045976 | Bacteria | 5486 |
| 235 | Ga0466967_0372433 | 3300045976 | Bacteria | 1385 |
| 236 | Ga0495592_0023918 | 3300046454 | Bacteria | 4647 |
| 237 | Ga0495603_0000609 | 3300046455 | Bacteria | 20089 |
| 238 | Ga0495603_0016899 | 3300046455 | Bacteria | 4415 |
| 239 | Ga0495629_0000074 | 3300046459 | Bacteria | 87355 |
| 240 | Ga0495629_0008434 | 3300046459 | Bacteria | 7586 |
| 241 | Ga0495638_0065480 | 3300046460 | Bacteria | 2236 |
| 242 | Ga0495641_0016556 | 3300046461 | Bacteria | 3880 |
| 243 | Ga0495651_0029243 | 3300046462 | Bacteria | 4297 |
| 244 | Ga0495651_0052130 | 3300046462 | Bacteria | 3152 |
| 245 | Ga0495580_0000467 | 3300046472 | Bacteria | 33629 |
| 246 | Ga0495580_0092623 | 3300046472 | Bacteria | 2104 |
| 247 | Ga0495582_0000059 | 3300046473 | Bacteria | 55798 |
| 248 | Ga0495639_0000283 | 3300046475 | Bacteria | 25017 |
| 249 | Ga0495639_0051655 | 3300046475 | Bacteria | 1870 |
| 250 | Ga0495662_0001173 | 3300046476 | Bacteria | 12925 |
| 251 | Ga0495662_0001630 | 3300046476 | Bacteria | 11166 |
| 252 | Ga0495664_0005211 | 3300046477 | Bacteria | 7132 |
| 253 | Ga0495664_0042959 | 3300046477 | Bacteria | 2678 |
| 254 | Ga0495664_0078824 | 3300046477 | Bacteria | 1973 |
| 255 | Ga0495594_0000621 | 3300046499 | Bacteria | 18249 |
| 256 | Ga0495607_0036953 | 3300046501 | Bacteria | 2937 |
| 257 | Ga0495583_0068953 | 3300046506 | Bacteria | 1558 |
| 258 | Ga0495606_0148206 | 3300046507 | Bacteria | 1379 |
| 259 | Ga0495608_0307479 | 3300046511 | Bacteria | 981 |
| 260 | Ga0495610_0112737 | 3300046512 | Bacteria | 1202 |
| 261 | Ga0495616_0074302 | 3300046513 | Bacteria | 1638 |
| 262 | Ga0495620_0014109 | 3300046515 | Bacteria | 4071 |
| 263 | Ga0495620_0020979 | 3300046515 | Bacteria | 3180 |
| 264 | Ga0495628_0026181 | 3300046516 | Bacteria | 4761 |
| 265 | Ga0495630_0012889 | 3300046517 | Bacteria | 6073 |
| 266 | Ga0495631_0052674 | 3300046518 | Bacteria | 1777 |
| 267 | Ga0495632_0093296 | 3300046519 | Bacteria | 1425 |
| 268 | Ga0495637_0011311 | 3300046520 | Bacteria | 4292 |
| 269 | Ga0495643_0001099 | 3300046522 | Bacteria | 26914 |
| 270 | Ga0495648_0005796 | 3300046524 | Bacteria | 10186 |
| 271 | Ga0495648_0122351 | 3300046524 | Bacteria | 1396 |
| 272 | Ga0495640_0015782 | 3300046533 | Bacteria | 5668 |
| 273 | Ga0495645_0017494 | 3300046543 | Bacteria | 5135 |
| 274 | Ga0495622_0016584 | 3300046557 | Bacteria | 3431 |
| 275 | Ga0495622_0019759 | 3300046557 | Bacteria | 3136 |
| 276 | Ga0495668_0037434 | 3300046616 | Bacteria | 2714 |
| 277 | Ga0495668_0082045 | 3300046616 | Bacteria | 1769 |
| 278 | Ga0495634_0010682 | 3300046642 | Bacteria | 6721 |
| 279 | Ga0495634_0075118 | 3300046642 | Bacteria | 2220 |
| 280 | Ga0495625_0022814 | 3300046660 | Bacteria | 4790 |
| 281 | Ga0495625_0029631 | 3300046660 | Bacteria | 4090 |
| 282 | Ga0495635_0000177 | 3300046663 | Bacteria | 40081 |
| 283 | Ga0495661_0132333 | 3300046665 | Bacteria | 1365 |
| 284 | Ga0495588_0002207 | 3300046674 | Bacteria | 8335 |
| 285 | Ga0495588_0032016 | 3300046674 | Bacteria | 2649 |
| 286 | Ga0495657_0079265 | 3300046675 | Bacteria | 2127 |
| 287 | Ga0495599_0079243 | 3300046678 | Bacteria | 2051 |
| 288 | Ga0495647_0001565 | 3300046681 | Bacteria | 7063 |
| 289 | Ga0495658_0000338 | 3300046683 | Bacteria | 26426 |
| 290 | Ga0495658_0012964 | 3300046683 | Bacteria | 4234 |
| 291 | Ga0495669_0225628 | 3300046684 | Bacteria | 898 |
| 292 | Ga0495613_0022290 | 3300046689 | Bacteria | 4720 |
| 293 | Ga0495613_0158065 | 3300046689 | Bacteria | 1614 |
| 294 | Ga0495624_0000963 | 3300046690 | Bacteria | 22722 |
| 295 | Ga0495670_0021255 | 3300046691 | Bacteria | 3200 |
| 296 | Ga0495671_0179488 | 3300046692 | Bacteria | 1028 |
| 297 | Ga0495649_0024040 | 3300046694 | Bacteria | 3401 |
| 298 | Ga0495589_0130857 | 3300046794 | Bacteria | 1205 |
| 299 | Ga0495600_0062169 | 3300046809 | Bacteria | 2439 |
| 300 | Ga0495600_0342650 | 3300046809 | Bacteria | 937 |
| 301 | Ga0495660_0025568 | 3300046810 | Bacteria | 3352 |
| 302 | Ga0495581_0000784 | 3300047315 | Bacteria | 16864 |
| 303 | Ga0495581_0014180 | 3300047315 | Bacteria | 4620 |
| 304 | Ga0495674_0003252 | 3300047319 | Bacteria | 15782 |
| 305 | Ga0495674_0018428 | 3300047319 | Bacteria | 6499 |
| 306 | Ga0495672_0017605 | 3300047320 | Bacteria | 4776 |
| 307 | Ga0495676_0033076 | 3300047321 | Bacteria | 4359 |
| 308 | Ga0495683_0053092 | 3300047323 | Bacteria | 2022 |
| 309 | Ga0495683_0228714 | 3300047323 | Bacteria | 826 |
| 310 | Ga0495685_091745 | 3300047447 | Bacteria | 1007 |
| 311 | Ga0495681_0118621 | 3300047470 | Bacteria | 1138 |
| 312 | Ga0495684_0073141 | 3300047471 | Bacteria | 2604 |
| 313 | Ga0495686_0049137 | 3300047472 | Bacteria | 2655 |
| 314 | Ga0495686_0071432 | 3300047472 | Bacteria | 2136 |
| 315 | Ga0495686_0169747 | 3300047472 | Bacteria | 1269 |
| 316 | Ga0495686_0227773 | 3300047472 | Unclassified | 1057 |
| 317 | Ga0495593_0000158 | 3300047673 | Bacteria | 34211 |
| 318 | Ga0495626_0015687 | 3300048091 | Bacteria | 3873 |
| 319 | Ga0496101_0149898 | 3300048904 | Bacteria | 1783 |
| 320 | Ga0496103_0208623 | 3300048906 | Bacteria | 1256 |
| 321 | Ga0496104_0068302 | 3300048907 | Bacteria | 3377 |
| 322 | Ga0496104_0464738 | 3300048907 | Bacteria | 1177 |
| 323 | Ga0496104_0730355 | 3300048907 | Bacteria | 898 |
| 324 | Ga0496105_0083710 | 3300048908 | Bacteria | 2634 |
| 325 | Ga0496106_0026873 | 3300048909 | Bacteria | 4286 |
| 326 | Ga0496106_0481954 | 3300048909 | Bacteria | 996 |
| 327 | Ga0496107_0164616 | 3300048910 | Bacteria | 1644 |
| 328 | Ga0496107_0193489 | 3300048910 | Bacteria | 1511 |
| 329 | Ga0496108_0012004 | 3300048911 | Bacteria | 7048 |
| 330 | Ga0496109_0275200 | 3300048912 | Bacteria | 1586 |
| 331 | Ga0496110_0032329 | 3300048913 | Bacteria | 4517 |
| 332 | Ga0496110_0346144 | 3300048913 | Bacteria | 1354 |
| 333 | Ga0496111_0083734 | 3300048914 | Bacteria | 2331 |
| 334 | Ga0496111_0152814 | 3300048914 | Bacteria | 1712 |
| 335 | Ga0496112_0000137 | 3300048915 | Bacteria | 45501 |
| 336 | Ga0496113_0004044 | 3300048916 | Bacteria | 8931 |
| 337 | Ga0496115_0306204 | 3300048918 | Bacteria | 1301 |
| 338 | Ga0496116_0001246 | 3300048919 | Bacteria | 29566 |
| 339 | Ga0496116_0063694 | 3300048919 | Bacteria | 2374 |
| 340 | Ga0496117_0013506 | 3300048920 | Bacteria | 7119 |
| 341 | Ga0496117_0041411 | 3300048920 | Bacteria | 3375 |
| 342 | Ga0496117_0215047 | 3300048920 | Bacteria | 1074 |
| 343 | Ga0496118_0002445 | 3300048921 | Bacteria | 25000 |
| 344 | Ga0496118_0027788 | 3300048921 | Bacteria | 4779 |
| 345 | Ga0496118_0117338 | 3300048921 | Bacteria | 1746 |
| 346 | Ga0496120_0036223 | 3300048923 | Bacteria | 2939 |
| 347 | Ga0496121_0000452 | 3300048924 | Bacteria | 80796 |
| 348 | Ga0496121_0035706 | 3300048924 | Bacteria | 4447 |
| 349 | Ga0496121_0067401 | 3300048924 | Bacteria | 2901 |
| 350 | Ga0496121_0137450 | 3300048924 | Bacteria | 1818 |
| 351 | Ga0496121_0291390 | 3300048924 | Bacteria | 1112 |
| 352 | Ga0496121_0305373 | 3300048924 | Bacteria | 1078 |
| 353 | Ga0496122_0016327 | 3300048925 | Bacteria | 7036 |
| 354 | Ga0496122_0035418 | 3300048925 | Bacteria | 4061 |
| 355 | Ga0496123_0024620 | 3300048926 | Bacteria | 4569 |
| 356 | Ga0496123_0034258 | 3300048926 | Bacteria | 3641 |
| 357 | Ga0496124_0000267 | 3300048927 | Bacteria | 101138 |
| 358 | Ga0496124_0118562 | 3300048927 | Bacteria | 2119 |
| 359 | Ga0496124_0206905 | 3300048927 | Bacteria | 1488 |
| 360 | Ga0496124_0297662 | 3300048927 | Bacteria | 1167 |
| 361 | Ga0496125_0001227 | 3300048928 | Bacteria | 38397 |
| 362 | Ga0496125_0010362 | 3300048928 | Bacteria | 9430 |
| 363 | Ga0496125_0043745 | 3300048928 | Bacteria | 3796 |
| 364 | Ga0496125_0058125 | 3300048928 | Bacteria | 3126 |
| 365 | Ga0496126_0015704 | 3300048929 | Bacteria | 7609 |
| 366 | Ga0496126_0016726 | 3300048929 | Bacteria | 7325 |
| 367 | Ga0496126_0035587 | 3300048929 | Bacteria | 4665 |
| 368 | Ga0496126_0059836 | 3300048929 | Bacteria | 3429 |
| 369 | Ga0496126_0095624 | 3300048929 | Bacteria | 2605 |
| 370 | Ga0496126_0223370 | 3300048929 | Bacteria | 1581 |
| 371 | Ga0496126_0285067 | 3300048929 | Bacteria | 1367 |
| 372 | Ga0495678_037365 | 3300049459 | Bacteria | 1974 |
| 373 | Ga0495682_0055834 | 3300049460 | Bacteria | 1432 |
| 374 | Ga0501031_0152499 | 3300049568 | Bacteria | 1510 |
| 375 | Ga0501033_0005716 | 3300049570 | Bacteria | 9806 |
| 376 | Ga0501034_0173443 | 3300049571 | Bacteria | 2123 |
| 377 | Ga0501046_0062849 | 3300049580 | Bacteria | 2900 |
| 378 | Ga0501047_0167254 | 3300049581 | Bacteria | 2069 |
| 379 | Ga0501067_0042258 | 3300049583 | Bacteria | 2531 |
| 380 | Ga0501067_0115062 | 3300049583 | Bacteria | 1496 |
| 381 | Ga0501069_0037341 | 3300049585 | Bacteria | 2681 |
| 382 | Ga0501070_0249142 | 3300049586 | Bacteria | 1453 |
| 383 | Ga0501071_0209641 | 3300049587 | Bacteria | 1465 |
| 384 | Ga0501073_0002257 | 3300049589 | Bacteria | 14427 |
| 385 | Ga0501073_0011678 | 3300049589 | Bacteria | 6415 |
| 386 | Ga0501074_0128801 | 3300049590 | Bacteria | 1811 |
| 387 | Ga0501075_0102416 | 3300049591 | Bacteria | 2175 |
| 388 | Ga0501076_0163667 | 3300049592 | Bacteria | 1813 |
| 389 | Ga0501079_0130759 | 3300049741 | Bacteria | 1954 |
| 390 | Ga0501080_0152396 | 3300049742 | Bacteria | 2136 |
| 391 | Ga0501081_0222824 | 3300049743 | Bacteria | 1372 |
| 392 | nmdc:mga03683_92025_c1 | 3300050489 | Bacteria | 1323 |
| 393 | nmdc:mga0yw44_237366_c1 | 3300050492 | Bacteria | 1211 |
| 394 | nmdc:mga0yw44_24266_c1 | 3300050492 | Bacteria | 3429 |
| 395 | nmdc:mga06z11_12993_c1 | 3300050494 | Bacteria | 3639 |
| 396 | nmdc:mga06z11_47463_c1 | 3300050494 | Bacteria | 2181 |
| 397 | nmdc:mga0sz30_1095_c3 | 3300050516 | Bacteria | 2861 |
| 398 | Ga0495601_0046485 | 3300053077 | Bacteria | 2732 |
| 399 | Ga0495601_0233990 | 3300053077 | Bacteria | 1200 |
| 400 | Ga0500643_010794 | 3300053087 | Bacteria | 3377 |
| 401 | Ga0500581_032719 | 3300053089 | Bacteria | 2661 |
| 402 | Ga0500651_0044396 | 3300053093 | Bacteria | 2799 |
| 403 | Ga0500566_0000244 | 3300053094 | Bacteria | 29168 |
| 404 | Ga0500566_0001348 | 3300053094 | Bacteria | 14353 |
| 405 | Ga0500566_0002949 | 3300053094 | Bacteria | 10161 |
| 406 | Ga0500566_0069046 | 3300053094 | Bacteria | 1986 |
| 407 | Ga0500640_002409 | 3300053095 | Bacteria | 6174 |
| 408 | Ga0500641_0003823 | 3300053096 | Bacteria | 5321 |
| 409 | Ga0500641_0027837 | 3300053096 | Bacteria | 2203 |
| 410 | Ga0500650_0000274 | 3300053098 | Bacteria | 12448 |
| 411 | Ga0500556_0000051 | 3300053104 | Bacteria | 119031 |
| 412 | Ga0500558_062917 | 3300053106 | Bacteria | 1546 |
| 413 | Ga0500562_007572 | 3300053108 | Bacteria | 2737 |
| 414 | Ga0500572_001039 | 3300053111 | Bacteria | 8281 |
| 415 | Ga0500594_0030830 | 3300053118 | Bacteria | 1410 |
| 416 | Ga0500595_000580 | 3300053119 | Bacteria | 21802 |
| 417 | Ga0500595_035904 | 3300053119 | Bacteria | 1629 |
| 418 | Ga0500608_000737 | 3300053122 | Bacteria | 11940 |
| 419 | Ga0500614_000443 | 3300053123 | Bacteria | 10794 |
| 420 | Ga0500618_023794 | 3300053125 | Bacteria | 1480 |
| 421 | Ga0500642_0000041 | 3300053130 | Bacteria | 89564 |
| 422 | Ga0500652_000513 | 3300053131 | Bacteria | 13653 |
| 423 | Ga0500658_0026902 | 3300053134 | Bacteria | 2219 |
| 424 | Ga0500559_0000188 | 3300053136 | Bacteria | 49358 |
| 425 | Ga0500559_0004499 | 3300053136 | Bacteria | 6599 |
| 426 | Ga0500568_0000715 | 3300053139 | Bacteria | 23772 |
| 427 | Ga0500568_0043749 | 3300053139 | Bacteria | 1789 |
| 428 | Ga0500577_0060755 | 3300053142 | Bacteria | 1452 |
| 429 | Ga0500588_0124297 | 3300053146 | Bacteria | 913 |
| 430 | Ga0500589_096302 | 3300053147 | Bacteria | 1293 |
| 431 | Ga0500590_001257 | 3300053148 | Bacteria | 10155 |
| 432 | Ga0500590_010732 | 3300053148 | Bacteria | 4633 |
| 433 | Ga0500590_101687 | 3300053148 | Bacteria | 1380 |
| 434 | Ga0500603_000194 | 3300053150 | Bacteria | 15890 |
| 435 | Ga0500603_000673 | 3300053150 | Bacteria | 8320 |
| 436 | Ga0500604_0005437 | 3300053151 | Bacteria | 3363 |
| 437 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 438 | Ga0500622_0000502 | 3300053156 | Bacteria | 36464 |
| 439 | Ga0500627_0103399 | 3300053158 | Bacteria | 1279 |
| 440 | Ga0500630_001162 | 3300053159 | Bacteria | 12332 |
| 441 | Ga0500638_010257 | 3300053162 | Bacteria | 4094 |
| 442 | Ga0500638_016392 | 3300053162 | Bacteria | 3418 |
| 443 | Ga0500638_042327 | 3300053162 | Bacteria | 2212 |
| 444 | Ga0500639_000012 | 3300053163 | Bacteria | 127545 |
| 445 | Ga0500637_0000303 | 3300053178 | Bacteria | 18607 |
| 446 | Ga0500637_0003301 | 3300053178 | Bacteria | 7417 |
| 447 | Ga0500637_0057844 | 3300053178 | Bacteria | 2217 |
| 448 | Ga0500596_006582 | 3300053735 | Bacteria | 1955 |
| 449 | Ga0500601_004120 | 3300053737 | Bacteria | 1576 |
| 450 | Ga0500661_001086 | 3300055283 | Bacteria | 5115 |
| 451 | Ga0466962_0065136 | 3300061719 | Bacteria | 1740 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0000018 | Ga0373933_0000018_25782_26594 | 229 |
| 2 | 3300025945 | Ga0207679_10254565 | Ga0207679_102545652 | 234 |
| 3 | 3300031995 | Ga0307409_100119908 | Ga0307409_1001199082 | 236 |
| 4 | 3300032005 | Ga0307411_10186486 | Ga0307411_101864862 | 236 |
| 5 | 3300032126 | Ga0307415_100114467 | Ga0307415_1001144672 | 236 |
| 6 | 3300041451 | Ga0451791_0080411 | Ga0451791_0080411_236_1138 | 237 |
| 7 | 3300005335 | Ga0070666_10079528 | Ga0070666_100795284 | 239 |
| 8 | 3300005339 | Ga0070660_100031659 | Ga0070660_1000316592 | 239 |
| 9 | 3300005548 | Ga0070665_100089594 | Ga0070665_1000895943 | 239 |
| 10 | 3300005617 | Ga0068859_100575677 | Ga0068859_1005756772 | 239 |
| 11 | 3300006931 | Ga0097620_100575723 | Ga0097620_1005757232 | 239 |
| 12 | 3300034816 | Ga0373930_0013158 | Ga0373930_0013158_97_879 | 239 |
| 13 | 3300035088 | Ga0373940_0065551 | Ga0373940_0065551_122_904 | 239 |
| 14 | 3300035089 | Ga0373944_0039053 | Ga0373944_0039053_374_1213 | 239 |
| 15 | 3300035092 | Ga0373952_0006580 | Ga0373952_0006580_1332_2114 | 239 |
| 16 | 3300035114 | Ga0373939_0076868 | Ga0373939_0076868_162_944 | 239 |
| 17 | 3300035117 | Ga0373953_0035701 | Ga0373953_0035701_930_1712 | 239 |
| 18 | 3300035170 | Ga0373943_0092982 | Ga0373943_0092982_287_1132 | 239 |
| 19 | 3300035172 | Ga0373955_0116311 | Ga0373955_0116311_495_1277 | 239 |
| 20 | 3300035410 | Ga0373924_0027656 | Ga0373924_0027656_1229_2074 | 239 |
| 21 | 3300035691 | Ga0373931_0008723 | Ga0373931_0008723_500_1282 | 239 |
| 22 | 3300035692 | Ga0373935_0000106 | Ga0373935_0000106_21054_21836 | 239 |
| 23 | 3300035695 | Ga0373927_0000267 | Ga0373927_0000267_10931_11713 | 239 |
| 24 | 3300035724 | Ga0373933_0094311 | Ga0373933_0094311_641_1423 | 239 |
| 25 | 3300037068 | Ga0373925_0002245 | Ga0373925_0002245_2676_3458 | 239 |
| 26 | 3300046454 | Ga0495592_0023918 | Ga0495592_0023918_449_1231 | 239 |
| 27 | 3300046455 | Ga0495603_0000609 | Ga0495603_0000609_5443_6225 | 239 |
| 28 | 3300046459 | Ga0495629_0000074 | Ga0495629_0000074_60336_61118 | 239 |
| 29 | 3300046461 | Ga0495641_0016556 | Ga0495641_0016556_638_1420 | 239 |
| 30 | 3300046472 | Ga0495580_0000467 | Ga0495580_0000467_25103_25885 | 239 |
| 31 | 3300046473 | Ga0495582_0000059 | Ga0495582_0000059_4244_5026 | 239 |
| 32 | 3300046475 | Ga0495639_0000283 | Ga0495639_0000283_22111_22893 | 239 |
| 33 | 3300046476 | Ga0495662_0001173 | Ga0495662_0001173_11353_12135 | 239 |
| 34 | 3300046477 | Ga0495664_0005211 | Ga0495664_0005211_3609_4391 | 239 |
| 35 | 3300046477 | Ga0495664_0078824 | Ga0495664_0078824_287_1132 | 239 |
| 36 | 3300046499 | Ga0495594_0000621 | Ga0495594_0000621_13215_13997 | 239 |
| 37 | 3300046516 | Ga0495628_0026181 | Ga0495628_0026181_3345_4127 | 239 |
| 38 | 3300046517 | Ga0495630_0012889 | Ga0495630_0012889_2081_2863 | 239 |
| 39 | 3300046533 | Ga0495640_0015782 | Ga0495640_0015782_2509_3291 | 239 |
| 40 | 3300046557 | Ga0495622_0019759 | Ga0495622_0019759_1584_2366 | 239 |
| 41 | 3300046642 | Ga0495634_0010682 | Ga0495634_0010682_5150_5932 | 239 |
| 42 | 3300046642 | Ga0495634_0075118 | Ga0495634_0075118_853_1698 | 239 |
| 43 | 3300046663 | Ga0495635_0000177 | Ga0495635_0000177_38543_39325 | 239 |
| 44 | 3300046674 | Ga0495588_0002207 | Ga0495588_0002207_5448_6230 | 239 |
| 45 | 3300046678 | Ga0495599_0079243 | Ga0495599_0079243_599_1381 | 239 |
| 46 | 3300046681 | Ga0495647_0001565 | Ga0495647_0001565_3006_3788 | 239 |
| 47 | 3300046683 | Ga0495658_0000338 | Ga0495658_0000338_8771_9553 | 239 |
| 48 | 3300046689 | Ga0495613_0022290 | Ga0495613_0022290_3275_4057 | 239 |
| 49 | 3300046690 | Ga0495624_0000963 | Ga0495624_0000963_4755_5537 | 239 |
| 50 | 3300047315 | Ga0495581_0000784 | Ga0495581_0000784_13303_14085 | 239 |
| 51 | 3300047315 | Ga0495581_0014180 | Ga0495581_0014180_1470_2315 | 239 |
| 52 | 3300047319 | Ga0495674_0003252 | Ga0495674_0003252_14303_15085 | 239 |
| 53 | 3300047319 | Ga0495674_0018428 | Ga0495674_0018428_3817_4662 | 239 |
| 54 | 3300047321 | Ga0495676_0033076 | Ga0495676_0033076_2942_3724 | 239 |
| 55 | 3300047471 | Ga0495684_0073141 | Ga0495684_0073141_1161_1943 | 239 |
| 56 | 3300047673 | Ga0495593_0000158 | Ga0495593_0000158_4494_5276 | 239 |
| 57 | 3300048906 | Ga0496103_0208623 | Ga0496103_0208623_292_1074 | 239 |
| 58 | 3300048909 | Ga0496106_0481954 | Ga0496106_0481954_135_917 | 239 |
| 59 | 3300048912 | Ga0496109_0275200 | Ga0496109_0275200_76_858 | 239 |
| 60 | 3300048914 | Ga0496111_0152814 | Ga0496111_0152814_911_1693 | 239 |
| 61 | 3300048916 | Ga0496113_0004044 | Ga0496113_0004044_6667_7449 | 239 |
| 62 | 3300006175 | Ga0070712_100310272 | Ga0070712_1003102722 | 240 |
| 63 | 3300025915 | Ga0207693_10052998 | Ga0207693_100529984 | 240 |
| 64 | 3300025918 | Ga0207662_10253407 | Ga0207662_102534072 | 240 |
| 65 | 3300025254 | Ga0209148_1015603 | Ga0209148_10156031 | 241 |
| 66 | 3300061719 | Ga0466962_0065136 | Ga0466962_0065136_695_1480 | 241 |
| 67 | iso_pu_bacteria | 2513237096 | 2513656157 | 241 |
| 68 | iso_pu_bacteria | 2513237145 | 2513917663 | 241 |
| 69 | iso_pu_bacteria | 2903748898 | 2903750756 | 241 |
| 70 | iso_pu_bacteria | 2906635258 | 2906642493 | 241 |
| 71 | iso_pu_bacteria | 2906660503 | 2906661053 | 241 |
| 72 | 3300005563 | Ga0068855_100188786 | Ga0068855_1001887862 | 242 |
| 73 | 3300025297 | Ga0209758_1030953 | Ga0209758_10309534 | 242 |
| 74 | 3300044842 | Ga0466957_0115331 | Ga0466957_0115331_315_1103 | 242 |
| 75 | 3300047323 | Ga0495683_0228714 | Ga0495683_0228714_11_754 | 242 |
| 76 | 3300005434 | Ga0070709_10012323 | Ga0070709_100123235 | 243 |
| 77 | 3300005436 | Ga0070713_100090709 | Ga0070713_1000907092 | 243 |
| 78 | 3300005439 | Ga0070711_100052534 | Ga0070711_1000525343 | 243 |
| 79 | 3300009177 | Ga0105248_10042923 | Ga0105248_100429234 | 243 |
| 80 | 3300025906 | Ga0207699_10043714 | Ga0207699_100437144 | 243 |
| 81 | 3300033180 | Ga0307510_10022034 | Ga0307510_100220345 | 243 |
| 82 | 3300046462 | Ga0495651_0029243 | Ga0495651_0029243_1979_2746 | 243 |
| 83 | 3300046506 | Ga0495583_0068953 | Ga0495583_0068953_349_1125 | 243 |
| 84 | 3300048929 | Ga0496126_0223370 | Ga0496126_0223370_706_1482 | 243 |
| 85 | 3300049460 | Ga0495682_0055834 | Ga0495682_0055834_212_1000 | 243 |
| 86 | 3300005456 | Ga0070678_100004690 | Ga0070678_1000046905 | 244 |
| 87 | 3300009098 | Ga0105245_10540213 | Ga0105245_105402131 | 244 |
| 88 | 3300021384 | Ga0213876_10002755 | Ga0213876_1000275510 | 244 |
| 89 | 3300026067 | Ga0207678_10004600 | Ga0207678_1000460014 | 244 |
| 90 | 3300028380 | Ga0268265_10793281 | Ga0268265_107932811 | 244 |
| 91 | 3300028794 | Ga0307515_10226688 | Ga0307515_102266882 | 244 |
| 92 | 3300033179 | Ga0307507_10103959 | Ga0307507_101039592 | 244 |
| 93 | 3300035695 | Ga0373927_0032140 | Ga0373927_0032140_190_969 | 244 |
| 94 | 3300037068 | Ga0373925_0047539 | Ga0373925_0047539_1792_2571 | 244 |
| 95 | 3300045976 | Ga0466967_0019242 | Ga0466967_0019242_2239_3024 | 244 |
| 96 | 3300046460 | Ga0495638_0065480 | Ga0495638_0065480_1411_2190 | 244 |
| 97 | 3300046501 | Ga0495607_0036953 | Ga0495607_0036953_364_1143 | 244 |
| 98 | 3300046512 | Ga0495610_0112737 | Ga0495610_0112737_262_1041 | 244 |
| 99 | 3300046513 | Ga0495616_0074302 | Ga0495616_0074302_625_1404 | 244 |
| 100 | 3300046515 | Ga0495620_0014109 | Ga0495620_0014109_245_1024 | 244 |
| 101 | 3300046518 | Ga0495631_0052674 | Ga0495631_0052674_487_1266 | 244 |
| 102 | 3300046520 | Ga0495637_0011311 | Ga0495637_0011311_948_1727 | 244 |
| 103 | 3300046616 | Ga0495668_0037434 | Ga0495668_0037434_1253_2032 | 244 |
| 104 | 3300046660 | Ga0495625_0022814 | Ga0495625_0022814_3117_3896 | 244 |
| 105 | 3300046665 | Ga0495661_0132333 | Ga0495661_0132333_470_1249 | 244 |
| 106 | 3300046683 | Ga0495658_0012964 | Ga0495658_0012964_3430_4209 | 244 |
| 107 | 3300046689 | Ga0495613_0158065 | Ga0495613_0158065_348_1127 | 244 |
| 108 | 3300046691 | Ga0495670_0021255 | Ga0495670_0021255_240_1019 | 244 |
| 109 | 3300046692 | Ga0495671_0179488 | Ga0495671_0179488_161_940 | 244 |
| 110 | 3300046810 | Ga0495660_0025568 | Ga0495660_0025568_1164_1943 | 244 |
| 111 | 3300047472 | Ga0495686_0049137 | Ga0495686_0049137_1750_2529 | 244 |
| 112 | 3300048091 | Ga0495626_0015687 | Ga0495626_0015687_1975_2754 | 244 |
| 113 | 3300048919 | Ga0496116_0063694 | Ga0496116_0063694_901_1680 | 244 |
| 114 | 3300048920 | Ga0496117_0215047 | Ga0496117_0215047_205_984 | 244 |
| 115 | 3300048923 | Ga0496120_0036223 | Ga0496120_0036223_1487_2266 | 244 |
| 116 | 3300048925 | Ga0496122_0035418 | Ga0496122_0035418_2150_2929 | 244 |
| 117 | 3300048926 | Ga0496123_0024620 | Ga0496123_0024620_1678_2457 | 244 |
| 118 | 3300048928 | Ga0496125_0001227 | Ga0496125_0001227_26511_27290 | 244 |
| 119 | 3300048929 | Ga0496126_0095624 | Ga0496126_0095624_1150_1929 | 244 |
| 120 | 3300050492 | nmdc:mga0yw44_24266_c1 | nmdc:mga0yw44_24266_c1_2007_2786 | 244 |
| 121 | 3300053087 | Ga0500643_010794 | Ga0500643_010794_1204_1983 | 244 |
| 122 | 3300053089 | Ga0500581_032719 | Ga0500581_032719_981_1760 | 244 |
| 123 | 3300053093 | Ga0500651_0044396 | Ga0500651_0044396_1395_2174 | 244 |
| 124 | 3300053096 | Ga0500641_0003823 | Ga0500641_0003823_1552_2331 | 244 |
| 125 | 3300053098 | Ga0500650_0000274 | Ga0500650_0000274_9188_9967 | 244 |
| 126 | 3300053104 | Ga0500556_0000051 | Ga0500556_0000051_57210_57989 | 244 |
| 127 | 3300053108 | Ga0500562_007572 | Ga0500562_007572_1613_2392 | 244 |
| 128 | 3300053118 | Ga0500594_0030830 | Ga0500594_0030830_608_1387 | 244 |
| 129 | 3300053130 | Ga0500642_0000041 | Ga0500642_0000041_24267_25046 | 244 |
| 130 | 3300053131 | Ga0500652_000513 | Ga0500652_000513_12255_13034 | 244 |
| 131 | 3300053134 | Ga0500658_0026902 | Ga0500658_0026902_656_1435 | 244 |
| 132 | 3300053139 | Ga0500568_0000715 | Ga0500568_0000715_6795_7574 | 244 |
| 133 | 3300053142 | Ga0500577_0060755 | Ga0500577_0060755_557_1336 | 244 |
| 134 | 3300053146 | Ga0500588_0124297 | Ga0500588_0124297_75_854 | 244 |
| 135 | 3300053151 | Ga0500604_0005437 | Ga0500604_0005437_2213_2992 | 244 |
| 136 | 3300053153 | Ga0500616_0000150 | Ga0500616_0000150_56337_57116 | 244 |
| 137 | 3300053156 | Ga0500622_0000502 | Ga0500622_0000502_28538_29317 | 244 |
| 138 | 3300053158 | Ga0500627_0103399 | Ga0500627_0103399_47_826 | 244 |
| 139 | 3300009093 | Ga0105240_10183475 | Ga0105240_101834753 | 245 |
| 140 | 3300025933 | Ga0207706_10207672 | Ga0207706_102076723 | 245 |
| 141 | 3300039450 | Ga0436363_1370601 | Ga0436363_1370601_55_843 | 245 |
| 142 | 3300048910 | Ga0496107_0164616 | Ga0496107_0164616_31_768 | 245 |
| 143 | 3300048911 | Ga0496108_0012004 | Ga0496108_0012004_3535_4302 | 245 |
| 144 | 3300005548 | Ga0070665_100268422 | Ga0070665_1002684223 | 246 |
| 145 | 3300021384 | Ga0213876_10054844 | Ga0213876_100548442 | 246 |
| 146 | 3300025906 | Ga0207699_10023510 | Ga0207699_100235103 | 246 |
| 147 | 3300028794 | Ga0307515_10027090 | Ga0307515_100270907 | 246 |
| 148 | 3300031456 | Ga0307513_10125136 | Ga0307513_101251362 | 246 |
| 149 | 3300031507 | Ga0307509_10133330 | Ga0307509_101333302 | 246 |
| 150 | 3300039437 | Ga0436365_1240066 | Ga0436365_1240066_918_1703 | 246 |
| 151 | 3300047320 | Ga0495672_0017605 | Ga0495672_0017605_2739_3527 | 246 |
| 152 | 3300047470 | Ga0495681_0118621 | Ga0495681_0118621_36_824 | 246 |
| 153 | 3300048924 | Ga0496121_0305373 | Ga0496121_0305373_273_1058 | 246 |
| 154 | 3300006941 | Ga0099825_1043182 | Ga0099825_10431822 | 247 |
| 155 | 3300006942 | Ga0099824_1002047 | Ga0099824_100204717 | 247 |
| 156 | 3300006943 | Ga0099822_1004737 | Ga0099822_100473714 | 247 |
| 157 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005244 | 247 |
| 158 | 3300027361 | Ga0209489_100005 | Ga0209489_100005244 | 247 |
| 159 | 3300027363 | Ga0209700_100006 | Ga0209700_100006244 | 247 |
| 160 | 3300046524 | Ga0495648_0122351 | Ga0495648_0122351_299_1078 | 247 |
| 161 | 3300048921 | Ga0496118_0027788 | Ga0496118_0027788_1575_2360 | 247 |
| 162 | 3300048924 | Ga0496121_0035706 | Ga0496121_0035706_2481_3260 | 247 |
| 163 | 3300039437 | Ga0436365_0093274 | Ga0436365_0093274_50561_51349 | 248 |
| 164 | 3300039453 | Ga0436362_0626323 | Ga0436362_0626323_3413_4201 | 248 |
| 165 | iso_pu_bacteria | 2513237137 | 2513861584 | 248 |
| 166 | iso_pu_bacteria | 2904690495 | 2904695181 | 248 |
| 167 | iso_pu_bacteria | 2908756301 | 2908757589 | 248 |
| 168 | 3300005338 | Ga0068868_100202431 | Ga0068868_1002024311 | 249 |
| 169 | 3300005455 | Ga0070663_100005926 | Ga0070663_1000059265 | 249 |
| 170 | 3300005564 | Ga0070664_100069626 | Ga0070664_1000696264 | 249 |
| 171 | 3300005618 | Ga0068864_100065432 | Ga0068864_1000654325 | 249 |
| 172 | 3300005834 | Ga0068851_10036633 | Ga0068851_100366334 | 249 |
| 173 | 3300005842 | Ga0068858_100150433 | Ga0068858_1001504331 | 249 |
| 174 | 3300006237 | Ga0097621_100200369 | Ga0097621_1002003692 | 249 |
| 175 | 3300006881 | Ga0068865_100093629 | Ga0068865_1000936293 | 249 |
| 176 | 3300009177 | Ga0105248_10195037 | Ga0105248_101950373 | 249 |
| 177 | 3300009545 | Ga0105237_10264897 | Ga0105237_102648972 | 249 |
| 178 | 3300025315 | Ga0207697_10067420 | Ga0207697_100674202 | 249 |
| 179 | 3300025914 | Ga0207671_10213178 | Ga0207671_102131781 | 249 |
| 180 | 3300025945 | Ga0207679_10030874 | Ga0207679_100308745 | 249 |
| 181 | 3300025960 | Ga0207651_10444586 | Ga0207651_104445861 | 249 |
| 182 | 3300026023 | Ga0207677_10034976 | Ga0207677_100349764 | 249 |
| 183 | 3300026067 | Ga0207678_10007829 | Ga0207678_100078297 | 249 |
| 184 | 3300026095 | Ga0207676_10064715 | Ga0207676_100647152 | 249 |
| 185 | 3300026142 | Ga0207698_10048829 | Ga0207698_100488292 | 249 |
| 186 | 3300031731 | Ga0307405_10095835 | Ga0307405_100958352 | 249 |
| 187 | 3300046459 | Ga0495629_0008434 | Ga0495629_0008434_3304_4092 | 249 |
| 188 | 3300046507 | Ga0495606_0148206 | Ga0495606_0148206_223_1002 | 249 |
| 189 | 3300046511 | Ga0495608_0307479 | Ga0495608_0307479_120_908 | 249 |
| 190 | 3300046557 | Ga0495622_0016584 | Ga0495622_0016584_1727_2506 | 249 |
| 191 | 3300048904 | Ga0496101_0149898 | Ga0496101_0149898_101_883 | 249 |
| 192 | 3300048907 | Ga0496104_0068302 | Ga0496104_0068302_1029_1811 | 249 |
| 193 | 3300048908 | Ga0496105_0083710 | Ga0496105_0083710_442_1224 | 249 |
| 194 | 3300048910 | Ga0496107_0193489 | Ga0496107_0193489_105_887 | 249 |
| 195 | 3300048913 | Ga0496110_0032329 | Ga0496110_0032329_3353_4135 | 249 |
| 196 | 3300048913 | Ga0496110_0346144 | Ga0496110_0346144_517_1299 | 249 |
| 197 | 3300048918 | Ga0496115_0306204 | Ga0496115_0306204_31_813 | 249 |
| 198 | 3300048927 | Ga0496124_0118562 | Ga0496124_0118562_970_1749 | 249 |
| 199 | 3300053094 | Ga0500566_0001348 | Ga0500566_0001348_3536_4315 | 249 |
| 200 | 3300053122 | Ga0500608_000737 | Ga0500608_000737_10098_10937 | 249 |
| 201 | 3300053136 | Ga0500559_0000188 | Ga0500559_0000188_39517_40356 | 249 |
| 202 | 3300053148 | Ga0500590_010732 | Ga0500590_010732_1448_2287 | 249 |
| 203 | 3300053178 | Ga0500637_0057844 | Ga0500637_0057844_686_1465 | 249 |
| 204 | iso_pu_bacteria | 3005445848 | 3005451913 | 249 |
| 205 | 3300005456 | Ga0070678_100029982 | Ga0070678_1000299825 | 250 |
| 206 | 3300005983 | Ga0081540_1002121 | Ga0081540_100212110 | 250 |
| 207 | 3300005983 | Ga0081540_1018462 | Ga0081540_10184622 | 250 |
| 208 | 3300025940 | Ga0207691_10106876 | Ga0207691_101068762 | 250 |
| 209 | 3300025972 | Ga0207668_10145275 | Ga0207668_101452752 | 250 |
| 210 | 3300026121 | Ga0207683_10041933 | Ga0207683_100419331 | 250 |
| 211 | 3300005436 | Ga0070713_100002234 | Ga0070713_10000223412 | 251 |
| 212 | 3300005439 | Ga0070711_100166520 | Ga0070711_1001665202 | 251 |
| 213 | 3300005458 | Ga0070681_10051933 | Ga0070681_100519334 | 251 |
| 214 | 3300005563 | Ga0068855_100217196 | Ga0068855_1002171962 | 251 |
| 215 | 3300005578 | Ga0068854_100032424 | Ga0068854_1000324246 | 251 |
| 216 | 3300005614 | Ga0068856_100485879 | Ga0068856_1004858792 | 251 |
| 217 | 3300005719 | Ga0068861_100404911 | Ga0068861_1004049112 | 251 |
| 218 | 3300005841 | Ga0068863_100158456 | Ga0068863_1001584562 | 251 |
| 219 | 3300005843 | Ga0068860_100279690 | Ga0068860_1002796902 | 251 |
| 220 | 3300005844 | Ga0068862_100049064 | Ga0068862_1000490646 | 251 |
| 221 | 3300006028 | Ga0070717_10001026 | Ga0070717_100010269 | 251 |
| 222 | 3300006177 | Ga0075362_10105324 | Ga0075362_101053242 | 251 |
| 223 | 3300010375 | Ga0105239_10142048 | Ga0105239_101420483 | 251 |
| 224 | 3300025912 | Ga0207707_10401777 | Ga0207707_104017771 | 251 |
| 225 | 3300025916 | Ga0207663_10349165 | Ga0207663_103491652 | 251 |
| 226 | 3300025928 | Ga0207700_10194546 | Ga0207700_101945462 | 251 |
| 227 | 3300025972 | Ga0207668_10269404 | Ga0207668_102694041 | 251 |
| 228 | 3300026041 | Ga0207639_10397786 | Ga0207639_103977862 | 251 |
| 229 | 3300028379 | Ga0268266_10000638 | Ga0268266_100006383 | 251 |
| 230 | 3300028381 | Ga0268264_10186784 | Ga0268264_101867842 | 251 |
| 231 | 3300031507 | Ga0307509_10228166 | Ga0307509_102281662 | 251 |
| 232 | 3300035692 | Ga0373935_0123625 | Ga0373935_0123625_349_1131 | 251 |
| 233 | 3300037068 | Ga0373925_0127017 | Ga0373925_0127017_857_1645 | 251 |
| 234 | 3300037853 | Ga0436364_0310036 | Ga0436364_0310036_1281_2063 | 251 |
| 235 | 3300045976 | Ga0466967_0372433 | Ga0466967_0372433_29_811 | 251 |
| 236 | 3300046472 | Ga0495580_0092623 | Ga0495580_0092623_799_1587 | 251 |
| 237 | 3300046674 | Ga0495588_0032016 | Ga0495588_0032016_1325_2113 | 251 |
| 238 | 3300047447 | Ga0495685_091745 | Ga0495685_091745_18_821 | 251 |
| 239 | 3300048909 | Ga0496106_0026873 | Ga0496106_0026873_1652_2434 | 251 |
| 240 | 3300048914 | Ga0496111_0083734 | Ga0496111_0083734_355_1143 | 251 |
| 241 | 3300048920 | Ga0496117_0041411 | Ga0496117_0041411_317_1099 | 251 |
| 242 | 3300048921 | Ga0496118_0002445 | Ga0496118_0002445_22356_23138 | 251 |
| 243 | 3300048924 | Ga0496121_0000452 | Ga0496121_0000452_31984_32766 | 251 |
| 244 | 3300048924 | Ga0496121_0137450 | Ga0496121_0137450_434_1222 | 251 |
| 245 | 3300048927 | Ga0496124_0000267 | Ga0496124_0000267_59709_60491 | 251 |
| 246 | 3300048927 | Ga0496124_0297662 | Ga0496124_0297662_355_1143 | 251 |
| 247 | 3300048928 | Ga0496125_0043745 | Ga0496125_0043745_1530_2315 | 251 |
| 248 | 3300048928 | Ga0496125_0058125 | Ga0496125_0058125_1873_2655 | 251 |
| 249 | 3300048929 | Ga0496126_0016726 | Ga0496126_0016726_6048_6830 | 251 |
| 250 | 3300049591 | Ga0501075_0102416 | Ga0501075_0102416_970_1758 | 251 |
| 251 | 3300049592 | Ga0501076_0163667 | Ga0501076_0163667_833_1621 | 251 |
| 252 | 3300049743 | Ga0501081_0222824 | Ga0501081_0222824_510_1298 | 251 |
| 253 | 3300050489 | nmdc:mga03683_92025_c1 | nmdc:mga03683_92025_c1_346_1134 | 251 |
| 254 | 3300053077 | Ga0495601_0233990 | Ga0495601_0233990_349_1131 | 251 |
| 255 | 3300053094 | Ga0500566_0069046 | Ga0500566_0069046_369_1151 | 251 |
| 256 | 3300053096 | Ga0500641_0027837 | Ga0500641_0027837_1133_1921 | 251 |
| 257 | 3300053119 | Ga0500595_035904 | Ga0500595_035904_670_1452 | 251 |
| 258 | 3300053139 | Ga0500568_0043749 | Ga0500568_0043749_189_977 | 251 |
| 259 | 3300053147 | Ga0500589_096302 | Ga0500589_096302_61_849 | 251 |
| 260 | 3300053148 | Ga0500590_101687 | Ga0500590_101687_330_1112 | 251 |
| 261 | iso_pu_bacteria | 2508501128 | 2509146351 | 251 |
| 262 | 3300005843 | Ga0068860_100000858 | Ga0068860_10000085820 | 252 |
| 263 | 3300006038 | Ga0075365_10033779 | Ga0075365_100337792 | 252 |
| 264 | 3300006186 | Ga0075369_10038354 | Ga0075369_100383543 | 252 |
| 265 | 3300009545 | Ga0105237_10006999 | Ga0105237_100069997 | 252 |
| 266 | 3300025914 | Ga0207671_10035801 | Ga0207671_100358012 | 252 |
| 267 | 3300028381 | Ga0268264_10000051 | Ga0268264_10000051179 | 252 |
| 268 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005190 | 252 |
| 269 | 3300046675 | Ga0495657_0079265 | Ga0495657_0079265_560_1351 | 252 |
| 270 | 3300047472 | Ga0495686_0071432 | Ga0495686_0071432_1229_2008 | 252 |
| 271 | 3300048919 | Ga0496116_0001246 | Ga0496116_0001246_2578_3357 | 252 |
| 272 | 3300048920 | Ga0496117_0013506 | Ga0496117_0013506_2893_3672 | 252 |
| 273 | 3300048921 | Ga0496118_0117338 | Ga0496118_0117338_694_1473 | 252 |
| 274 | 3300048925 | Ga0496122_0016327 | Ga0496122_0016327_2060_2839 | 252 |
| 275 | 3300048926 | Ga0496123_0034258 | Ga0496123_0034258_1119_1898 | 252 |
| 276 | 3300048928 | Ga0496125_0010362 | Ga0496125_0010362_3964_4743 | 252 |
| 277 | 3300050494 | nmdc:mga06z11_12993_c1 | nmdc:mga06z11_12993_c1_645_1424 | 252 |
| 278 | 3300050516 | nmdc:mga0sz30_1095_c3 | nmdc:mga0sz30_1095_c3_751_1530 | 252 |
| 279 | 3300053094 | Ga0500566_0000244 | Ga0500566_0000244_6741_7523 | 252 |
| 280 | 3300053095 | Ga0500640_002409 | Ga0500640_002409_3459_4241 | 252 |
| 281 | 3300053111 | Ga0500572_001039 | Ga0500572_001039_2696_3478 | 252 |
| 282 | 3300053123 | Ga0500614_000443 | Ga0500614_000443_6350_7132 | 252 |
| 283 | 3300053136 | Ga0500559_0004499 | Ga0500559_0004499_2458_3240 | 252 |
| 284 | 3300053150 | Ga0500603_000673 | Ga0500603_000673_57_839 | 252 |
| 285 | 3300053159 | Ga0500630_001162 | Ga0500630_001162_8305_9087 | 252 |
| 286 | 3300053162 | Ga0500638_010257 | Ga0500638_010257_166_948 | 252 |
| 287 | 3300053163 | Ga0500639_000012 | Ga0500639_000012_5438_6220 | 252 |
| 288 | 3300053737 | Ga0500601_004120 | Ga0500601_004120_157_939 | 252 |
| 289 | iso_pu_bacteria | 2585427590 | 2585824056 | 252 |
| 290 | 3300005329 | Ga0070683_100042686 | Ga0070683_1000426866 | 253 |
| 291 | 3300005535 | Ga0070684_100003258 | Ga0070684_10000325812 | 253 |
| 292 | 3300006178 | Ga0075367_10078884 | Ga0075367_100788842 | 253 |
| 293 | 3300009093 | Ga0105240_10133881 | Ga0105240_101338811 | 253 |
| 294 | 3300013105 | Ga0157369_10102904 | Ga0157369_101029044 | 253 |
| 295 | 3300013307 | Ga0157372_10390416 | Ga0157372_103904162 | 253 |
| 296 | 3300025944 | Ga0207661_10000959 | Ga0207661_1000095914 | 253 |
| 297 | 3300035171 | Ga0373946_0076373 | Ga0373946_0076373_296_1081 | 253 |
| 298 | 3300046462 | Ga0495651_0052130 | Ga0495651_0052130_2060_2851 | 253 |
| 299 | 3300046476 | Ga0495662_0001630 | Ga0495662_0001630_6671_7462 | 253 |
| 300 | 3300050494 | nmdc:mga06z11_47463_c1 | nmdc:mga06z11_47463_c1_993_1775 | 253 |
| 301 | 3300005336 | Ga0070680_100516187 | Ga0070680_1005161871 | 254 |
| 302 | iso_pu_bacteria | 2582581867 | 2585403234 | 254 |
| 303 | 3300005436 | Ga0070713_100247749 | Ga0070713_1002477492 | 255 |
| 304 | 3300025928 | Ga0207700_10306910 | Ga0207700_103069102 | 255 |
| 305 | 3300031711 | Ga0265314_10006028 | Ga0265314_100060288 | 255 |
| 306 | 3300031712 | Ga0265342_10035731 | Ga0265342_100357315 | 255 |
| 307 | 3300037853 | Ga0436364_0699776 | Ga0436364_0699776_1840_2625 | 255 |
| 308 | 3300048927 | Ga0496124_0206905 | Ga0496124_0206905_257_1024 | 255 |
| 309 | 3300048929 | Ga0496126_0035587 | Ga0496126_0035587_841_1608 | 255 |
| 310 | iso_pu_bacteria | 2513237096 | 2513660634 | 255 |
| 311 | iso_pu_bacteria | 2513237145 | 2513922427 | 255 |
| 312 | iso_pu_bacteria | 2602042107 | 2603862374 | 255 |
| 313 | iso_pu_bacteria | 2643221599 | 2644004965 | 255 |
| 314 | iso_pu_bacteria | 2791355267 | 2793366170 | 255 |
| 315 | iso_pu_bacteria | 2857524615 | 2857525736 | 255 |
| 316 | iso_pu_bacteria | 2893066018 | 2893071816 | 255 |
| 317 | iso_pu_bacteria | 2919073203 | 2919074400 | 255 |
| 318 | iso_pu_bacteria | 3004334049 | 3004334960 | 255 |
| 319 | iso_pu_bacteria | 8018127388 | 8018128574 | 255 |
| 320 | iso_pu_bacteria | 8018150411 | 8018152506 | 255 |
| 321 | 3300003215 | JGI25153J46596_10014855 | JGI25153J46596_100148551 | 256 |
| 322 | 3300003911 | JGI25405J52794_10011833 | JGI25405J52794_100118332 | 256 |
| 323 | 3300005937 | Ga0081455_10003156 | Ga0081455_1000315611 | 256 |
| 324 | 3300025297 | Ga0209758_1005049 | Ga0209758_10050498 | 256 |
| 325 | 3300046455 | Ga0495603_0016899 | Ga0495603_0016899_2953_3741 | 256 |
| 326 | 3300046477 | Ga0495664_0042959 | Ga0495664_0042959_729_1514 | 256 |
| 327 | 3300046515 | Ga0495620_0020979 | Ga0495620_0020979_739_1527 | 256 |
| 328 | 3300046519 | Ga0495632_0093296 | Ga0495632_0093296_29_799 | 256 |
| 329 | 3300046522 | Ga0495643_0001099 | Ga0495643_0001099_2469_3239 | 256 |
| 330 | 3300046543 | Ga0495645_0017494 | Ga0495645_0017494_3806_4591 | 256 |
| 331 | 3300046660 | Ga0495625_0029631 | Ga0495625_0029631_3194_3964 | 256 |
| 332 | 3300046694 | Ga0495649_0024040 | Ga0495649_0024040_388_1158 | 256 |
| 333 | 3300047323 | Ga0495683_0053092 | Ga0495683_0053092_281_1051 | 256 |
| 334 | 3300047472 | Ga0495686_0169747 | Ga0495686_0169747_110_898 | 256 |
| 335 | 3300047472 | Ga0495686_0227773 | Ga0495686_0227773_259_1029 | 256 |
| 336 | 3300049459 | Ga0495678_037365 | Ga0495678_037365_23_793 | 256 |
| 337 | 3300053077 | Ga0495601_0046485 | Ga0495601_0046485_1457_2242 | 256 |
| 338 | iso_pu_bacteria | 2517572143 | 2517889802 | 256 |
| 339 | iso_pu_bacteria | 2643221579 | 2643906822 | 256 |
| 340 | iso_pu_bacteria | 2667528175 | 2671119649 | 256 |
| 341 | iso_pu_bacteria | 2728368998 | 2728748322 | 256 |
| 342 | iso_pu_bacteria | 2791355197 | 2793070198 | 256 |
| 343 | iso_pu_bacteria | 2882456835 | 2882460156 | 256 |
| 344 | iso_pu_bacteria | 2885374607 | 2885375449 | 256 |
| 345 | iso_pu_bacteria | 2906610324 | 2906612470 | 256 |
| 346 | iso_pu_bacteria | 2908739725 | 2908745739 | 256 |
| 347 | iso_pu_bacteria | 2922425934 | 2922433025 | 256 |
| 348 | iso_pu_bacteria | 2935630451 | 2935632985 | 256 |
| 349 | iso_pu_bacteria | 2941507105 | 2941509713 | 256 |
| 350 | iso_pu_bacteria | 2941515067 | 2941517542 | 256 |
| 351 | iso_pu_bacteria | 2941523033 | 2941526505 | 256 |
| 352 | iso_pu_bacteria | 3005474847 | 3005476003 | 256 |
| 353 | iso_pu_bacteria | 8019555841 | 8019561318 | 256 |
| 354 | iso_pu_bacteria | 8019565922 | 8019571401 | 256 |
| 355 | 3300005434 | Ga0070709_10003090 | Ga0070709_100030902 | 257 |
| 356 | 3300005435 | Ga0070714_100145279 | Ga0070714_1001452792 | 257 |
| 357 | 3300005436 | Ga0070713_100126117 | Ga0070713_1001261173 | 257 |
| 358 | 3300005437 | Ga0070710_10000552 | Ga0070710_100005524 | 257 |
| 359 | 3300005439 | Ga0070711_100062871 | Ga0070711_1000628711 | 257 |
| 360 | 3300025898 | Ga0207692_10001302 | Ga0207692_100013022 | 257 |
| 361 | 3300025906 | Ga0207699_10045183 | Ga0207699_100451833 | 257 |
| 362 | 3300025916 | Ga0207663_10017392 | Ga0207663_100173923 | 257 |
| 363 | 3300025928 | Ga0207700_10067007 | Ga0207700_100670072 | 257 |
| 364 | 3300025929 | Ga0207664_10083898 | Ga0207664_100838984 | 257 |
| 365 | 3300025939 | Ga0207665_10014858 | Ga0207665_100148585 | 257 |
| 366 | iso_pu_bacteria | 2891088606 | 2891092513 | 257 |
| 367 | 3300005435 | Ga0070714_100111985 | Ga0070714_1001119853 | 258 |
| 368 | 3300013105 | Ga0157369_10533430 | Ga0157369_105334301 | 258 |
| 369 | 3300025898 | Ga0207692_10244897 | Ga0207692_102448972 | 258 |
| 370 | 3300025928 | Ga0207700_10178628 | Ga0207700_101786282 | 258 |
| 371 | 3300041441 | Ga0451787_672321 | Ga0451787_672321_68_877 | 258 |
| 372 | 3300048929 | Ga0496126_0059836 | Ga0496126_0059836_21_797 | 258 |
| 373 | iso_pu_bacteria | 2513237101 | 2513694580 | 258 |
| 374 | iso_pu_bacteria | 2738541317 | 2738944704 | 258 |
| 375 | iso_pu_bacteria | 2775507266 | 2778174708 | 258 |
| 376 | iso_pu_bacteria | 2791355199 | 2793078765 | 258 |
| 377 | iso_pu_bacteria | 2842509118 | 2842514412 | 258 |
| 378 | iso_pu_bacteria | 2852387548 | 2852395344 | 258 |
| 379 | iso_pu_bacteria | 2874604998 | 2874608912 | 258 |
| 380 | iso_pu_bacteria | 2879110137 | 2879112372 | 258 |
| 381 | iso_pu_bacteria | 2889033259 | 2889034385 | 258 |
| 382 | iso_pu_bacteria | 2913308742 | 2913309325 | 258 |
| 383 | iso_pu_bacteria | 2922361189 | 2922364835 | 258 |
| 384 | iso_pu_bacteria | 2922386360 | 2922391702 | 258 |
| 385 | iso_pu_bacteria | 2989771324 | 2989775565 | 258 |
| 386 | iso_pu_bacteria | 8006964411 | 8006965272 | 258 |
| 387 | iso_pu_bacteria | 8006984368 | 8006991604 | 258 |
| 388 | iso_pu_bacteria | 8006994254 | 8006995425 | 258 |
| 389 | iso_pu_bacteria | 8046767195 | 8046774320 | 258 |
| 390 | iso_pu_bacteria | 8057575449 | 8057579275 | 258 |
| 391 | 3300005336 | Ga0070680_100024909 | Ga0070680_1000249092 | 259 |
| 392 | 3300005336 | Ga0070680_100133796 | Ga0070680_1001337962 | 259 |
| 393 | 3300005339 | Ga0070660_100089416 | Ga0070660_1000894162 | 259 |
| 394 | 3300005458 | Ga0070681_10037527 | Ga0070681_100375276 | 259 |
| 395 | 3300005530 | Ga0070679_100034291 | Ga0070679_1000342912 | 259 |
| 396 | 3300005539 | Ga0068853_100039832 | Ga0068853_1000398324 | 259 |
| 397 | 3300005563 | Ga0068855_100015587 | Ga0068855_1000155877 | 259 |
| 398 | 3300005563 | Ga0068855_100055139 | Ga0068855_1000551392 | 259 |
| 399 | 3300005577 | Ga0068857_100191246 | Ga0068857_1001912462 | 259 |
| 400 | 3300005618 | Ga0068864_100348669 | Ga0068864_1003486691 | 259 |
| 401 | 3300007788 | Ga0099795_10005299 | Ga0099795_100052995 | 259 |
| 402 | 3300009177 | Ga0105248_10487473 | Ga0105248_104874732 | 259 |
| 403 | 3300010159 | Ga0099796_10001766 | Ga0099796_100017666 | 259 |
| 404 | 3300010375 | Ga0105239_10714585 | Ga0105239_107145851 | 259 |
| 405 | 3300013297 | Ga0157378_10002449 | Ga0157378_100024499 | 259 |
| 406 | 3300013297 | Ga0157378_10146176 | Ga0157378_101461761 | 259 |
| 407 | 3300025254 | Ga0209148_1000037 | Ga0209148_1000037188 | 259 |
| 408 | 3300025272 | Ga0209455_1000036 | Ga0209455_1000036165 | 259 |
| 409 | 3300025295 | Ga0209564_1000687 | Ga0209564_100068747 | 259 |
| 410 | 3300025912 | Ga0207707_10103376 | Ga0207707_101033762 | 259 |
| 411 | 3300025913 | Ga0207695_10043272 | Ga0207695_100432722 | 259 |
| 412 | 3300025917 | Ga0207660_10058742 | Ga0207660_100587422 | 259 |
| 413 | 3300025917 | Ga0207660_10087395 | Ga0207660_100873953 | 259 |
| 414 | 3300025919 | Ga0207657_10008393 | Ga0207657_100083937 | 259 |
| 415 | 3300025921 | Ga0207652_10047083 | Ga0207652_100470835 | 259 |
| 416 | 3300025921 | Ga0207652_10201228 | Ga0207652_102012282 | 259 |
| 417 | 3300025949 | Ga0207667_10044714 | Ga0207667_100447146 | 259 |
| 418 | 3300026041 | Ga0207639_10118793 | Ga0207639_101187932 | 259 |
| 419 | 3300031616 | Ga0307508_10014562 | Ga0307508_100145627 | 259 |
| 420 | 3300037418 | Ga0395900_0499688 | Ga0395900_0499688_252_1031 | 259 |
| 421 | 3300039437 | Ga0436365_0372041 | Ga0436365_0372041_1468_2250 | 259 |
| 422 | 3300046524 | Ga0495648_0005796 | Ga0495648_0005796_2660_3439 | 259 |
| 423 | 3300046809 | Ga0495600_0342650 | Ga0495600_0342650_67_846 | 259 |
| 424 | 3300048907 | Ga0496104_0730355 | Ga0496104_0730355_95_877 | 259 |
| 425 | 3300048915 | Ga0496112_0000137 | Ga0496112_0000137_25353_26135 | 259 |
| 426 | 3300048924 | Ga0496121_0067401 | Ga0496121_0067401_1396_2241 | 259 |
| 427 | 3300048924 | Ga0496121_0291390 | Ga0496121_0291390_152_934 | 259 |
| 428 | 3300048929 | Ga0496126_0285067 | Ga0496126_0285067_78_860 | 259 |
| 429 | 3300049568 | Ga0501031_0152499 | Ga0501031_0152499_53_874 | 259 |
| 430 | 3300049570 | Ga0501033_0005716 | Ga0501033_0005716_8860_9681 | 259 |
| 431 | 3300049571 | Ga0501034_0173443 | Ga0501034_0173443_820_1641 | 259 |
| 432 | 3300049580 | Ga0501046_0062849 | Ga0501046_0062849_1295_2116 | 259 |
| 433 | 3300049581 | Ga0501047_0167254 | Ga0501047_0167254_233_1015 | 259 |
| 434 | 3300049583 | Ga0501067_0115062 | Ga0501067_0115062_651_1472 | 259 |
| 435 | 3300049585 | Ga0501069_0037341 | Ga0501069_0037341_163_984 | 259 |
| 436 | 3300049586 | Ga0501070_0249142 | Ga0501070_0249142_620_1405 | 259 |
| 437 | 3300049587 | Ga0501071_0209641 | Ga0501071_0209641_260_1081 | 259 |
| 438 | 3300049589 | Ga0501073_0002257 | Ga0501073_0002257_5572_6357 | 259 |
| 439 | 3300049589 | Ga0501073_0011678 | Ga0501073_0011678_4588_5373 | 259 |
| 440 | 3300049590 | Ga0501074_0128801 | Ga0501074_0128801_1016_1798 | 259 |
| 441 | 3300049741 | Ga0501079_0130759 | Ga0501079_0130759_32_817 | 259 |
| 442 | 3300049742 | Ga0501080_0152396 | Ga0501080_0152396_415_1197 | 259 |
| 443 | 3300053094 | Ga0500566_0002949 | Ga0500566_0002949_9057_9839 | 259 |
| 444 | 3300053106 | Ga0500558_062917 | Ga0500558_062917_669_1451 | 259 |
| 445 | 3300053119 | Ga0500595_000580 | Ga0500595_000580_9688_10470 | 259 |
| 446 | 3300053125 | Ga0500618_023794 | Ga0500618_023794_23_862 | 259 |
| 447 | 3300053162 | Ga0500638_016392 | Ga0500638_016392_1382_2164 | 259 |
| 448 | 3300053162 | Ga0500638_042327 | Ga0500638_042327_474_1256 | 259 |
| 449 | 3300053178 | Ga0500637_0000303 | Ga0500637_0000303_11266_12048 | 259 |
| 450 | 3300053735 | Ga0500596_006582 | Ga0500596_006582_326_1108 | 259 |
| 451 | 3300055283 | Ga0500661_001086 | Ga0500661_001086_2168_2950 | 259 |
| 452 | iso_pu_bacteria | 8006933436 | 8006937311 | 259 |
| 453 | iso_pu_bacteria | 8006973647 | 8006977343 | 259 |
| 454 | 3300031344 | Ga0265316_10286909 | Ga0265316_102869092 | 260 |
| 455 | 3300003203 | JGI25406J46586_10006811 | JGI25406J46586_100068114 | 261 |
| 456 | 3300003323 | rootH1_10168036 | rootH1_101680362 | 261 |
| 457 | 3300003659 | JGI25404J52841_10012836 | JGI25404J52841_100128362 | 261 |
| 458 | 3300005436 | Ga0070713_100138135 | Ga0070713_1001381352 | 261 |
| 459 | 3300005456 | Ga0070678_100158147 | Ga0070678_1001581473 | 261 |
| 460 | 3300005578 | Ga0068854_100018315 | Ga0068854_1000183155 | 261 |
| 461 | 3300005614 | Ga0068856_100000226 | Ga0068856_10000022664 | 261 |
| 462 | 3300005937 | Ga0081455_10006663 | Ga0081455_1000666314 | 261 |
| 463 | 3300005983 | Ga0081540_1003865 | Ga0081540_10038659 | 261 |
| 464 | 3300005983 | Ga0081540_1012706 | Ga0081540_10127066 | 261 |
| 465 | 3300005983 | Ga0081540_1015207 | Ga0081540_10152077 | 261 |
| 466 | 3300005983 | Ga0081540_1038308 | Ga0081540_10383085 | 261 |
| 467 | 3300005985 | Ga0081539_10000729 | Ga0081539_1000072949 | 261 |
| 468 | 3300005985 | Ga0081539_10105118 | Ga0081539_101051181 | 261 |
| 469 | 3300006042 | Ga0075368_10067264 | Ga0075368_100672642 | 261 |
| 470 | 3300009093 | Ga0105240_10131327 | Ga0105240_101313275 | 261 |
| 471 | 3300009551 | Ga0105238_10063133 | Ga0105238_100631331 | 261 |
| 472 | 3300013104 | Ga0157370_10177782 | Ga0157370_101777822 | 261 |
| 473 | 3300013105 | Ga0157369_10017488 | Ga0157369_100174886 | 261 |
| 474 | 3300014325 | Ga0163163_10418720 | Ga0163163_104187202 | 261 |
| 475 | 3300021388 | Ga0213875_10053389 | Ga0213875_100533892 | 261 |
| 476 | 3300025906 | Ga0207699_10054158 | Ga0207699_100541582 | 261 |
| 477 | 3300025914 | Ga0207671_10069327 | Ga0207671_100693272 | 261 |
| 478 | 3300025926 | Ga0207659_10648911 | Ga0207659_106489111 | 261 |
| 479 | 3300025928 | Ga0207700_10104751 | Ga0207700_101047512 | 261 |
| 480 | 3300025928 | Ga0207700_10170217 | Ga0207700_101702172 | 261 |
| 481 | 3300025929 | Ga0207664_10106409 | Ga0207664_101064092 | 261 |
| 482 | 3300025937 | Ga0207669_10309118 | Ga0207669_103091181 | 261 |
| 483 | 3300025944 | Ga0207661_10131837 | Ga0207661_101318373 | 261 |
| 484 | 3300026078 | Ga0207702_10000191 | Ga0207702_1000019113 | 261 |
| 485 | 3300026116 | Ga0207674_10055839 | Ga0207674_100558394 | 261 |
| 486 | 3300028800 | Ga0265338_10013087 | Ga0265338_1001308713 | 261 |
| 487 | 3300031241 | Ga0265325_10014373 | Ga0265325_100143732 | 261 |
| 488 | 3300031249 | Ga0265339_10000047 | Ga0265339_100000473 | 261 |
| 489 | 3300031595 | Ga0265313_10000992 | Ga0265313_1000099223 | 261 |
| 490 | 3300031712 | Ga0265342_10040613 | Ga0265342_100406134 | 261 |
| 491 | 3300037418 | Ga0395900_0265761 | Ga0395900_0265761_736_1521 | 261 |
| 492 | 3300037466 | Ga0395898_0004875 | Ga0395898_0004875_5566_6351 | 261 |
| 493 | 3300037853 | Ga0436364_0482403 | Ga0436364_0482403_494_1282 | 261 |
| 494 | 3300039437 | Ga0436365_1925389 | Ga0436365_1925389_90_878 | 261 |
| 495 | 3300044694 | Ga0466963_0285305 | Ga0466963_0285305_258_1043 | 261 |
| 496 | 3300044719 | Ga0466971_0019749 | Ga0466971_0019749_121_906 | 261 |
| 497 | 3300044735 | Ga0466968_0086115 | Ga0466968_0086115_66_851 | 261 |
| 498 | 3300044842 | Ga0466957_0149230 | Ga0466957_0149230_360_1145 | 261 |
| 499 | 3300045049 | Ga0466959_0080951 | Ga0466959_0080951_976_1761 | 261 |
| 500 | 3300046475 | Ga0495639_0051655 | Ga0495639_0051655_134_922 | 261 |
| 501 | 3300046616 | Ga0495668_0082045 | Ga0495668_0082045_684_1472 | 261 |
| 502 | 3300046684 | Ga0495669_0225628 | Ga0495669_0225628_64_852 | 261 |
| 503 | 3300046794 | Ga0495589_0130857 | Ga0495589_0130857_345_1133 | 261 |
| 504 | 3300046809 | Ga0495600_0062169 | Ga0495600_0062169_1187_1978 | 261 |
| 505 | 3300048907 | Ga0496104_0464738 | Ga0496104_0464738_118_906 | 261 |
| 506 | 3300048929 | Ga0496126_0015704 | Ga0496126_0015704_5586_6371 | 261 |
| 507 | 3300049583 | Ga0501067_0042258 | Ga0501067_0042258_1396_2298 | 261 |
| 508 | 3300050492 | nmdc:mga0yw44_237366_c1 | nmdc:mga0yw44_237366_c1_16_804 | 261 |
| 509 | 3300053148 | Ga0500590_001257 | Ga0500590_001257_818_1609 | 261 |
| 510 | 3300001989 | JGI24739J22299_10020481 | JGI24739J22299_100204813 | 262 |
| 511 | 3300053150 | Ga0500603_000194 | Ga0500603_000194_3020_3808 | 262 |
| 512 | 3300053178 | Ga0500637_0003301 | Ga0500637_0003301_4854_5642 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5308 | 6 | 256 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5292 | 6 | 255 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5212 | 6 | 255 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5133 | 6 | 256 |
| 8ex4-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1) | 0.4429 | 1 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1R0_3_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4967 | 1 | 254 | 1.20.1250.20 |
| af_K7KKQ1_1_284_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4891 | 4 | 252 | 1.20.1250.20 |
| af_Q9Y5Y0_102_514_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4719 | 3 | 251 | 1.20.1250.20 |
| af_F1R0H0_3_336_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4678 | 2 | 257 | 1.20.1250.20 |
| af_Q2G1R0_3_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4648 | 1 | 254 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A348FZT1-F1-model_v4 | Probable membrane transporter protein | 0.9871 | 2 | 258 |
GO:0005886
|
| AF-A0A059FJF6-F1-model_v4 | Probable membrane transporter protein | 0.9842 | 5 | 260 |
GO:0005886
|
| AF-A0A259LNW5-F1-model_v4 | Probable membrane transporter protein | 0.9841 | 5 | 221 |
GO:0005886
|
| AF-F7QGW6-F1-model_v4 | Probable membrane transporter protein | 0.9838 | 1 | 256 |
GO:0005886
|
| AF-A0A4Y3U0P3-F1-model_v4 | Probable membrane transporter protein | 0.9832 | 3 | 256 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar