F457476

General Info

Members Datasets Scaffolds Average Seq Length
512 355 451 253

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0346144|Ga0496110_0346144_517_1299
Length 250
Sequence LIISATQSVLGLASGMLVGFSLGLVGGGGSILAVPLMVYVVGVPEPHVAIGTSAIAVAANAAINLSNHARGGTVIWSCALVFALAGIVGAFGGSILGKMVEGHRLLALFALVTRSRVGLPDVKISMSNMPAIAGLGLATGTLSGFFGIGGGFLIVPALMLATGMPIMNAVSSSLVAVTAFGMTTAASYAWSGLVSWALAGLFVAGGIVGGLAGTRSARHLAEKRGALNIVFAVVIIAVALYMLARNISIS

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
8 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
11 2643221599 Rhizobium sp. Root708 Isolate Unclassified
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
14 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
15 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
16 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
17 2791355267 Rhizobium sp. L18 Isolate Nodule
18 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
19 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
20 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
21 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
22 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
23 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
24 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
25 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
26 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
27 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
28 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
29 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
30 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
31 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
32 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
33 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
34 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
35 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
36 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
37 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
38 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
39 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
40 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
41 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
42 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
43 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
44 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
45 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
96 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
97 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
195 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
255 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
318 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
321 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
329 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
330 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
331 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
332 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
333 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
336 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
337 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
338 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
339 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
340 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
341 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
342 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
343 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
346 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
347 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
348 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
349 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
350 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
351 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
352 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
353 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
354 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
355 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.61
Metatranscriptomes 0
Isolates 11.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.48
Nodule 7.81
Rhizoplane 4.49
Rhizosphere 59.57
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020481 3300001989 Bacteria 2363
2 JGI25406J46586_10006811 3300003203 Bacteria 5249
3 JGI25153J46596_10014855 3300003215 Bacteria 3211
4 rootH1_10168036 3300003323 Bacteria 1249
5 JGI25404J52841_10012836 3300003659 Bacteria 1817
6 JGI25405J52794_10011833 3300003911 Bacteria 1672
7 Ga0070683_100042686 3300005329 Bacteria 4176
8 Ga0070666_10079528 3300005335 Bacteria 2239
9 Ga0070680_100024909 3300005336 Bacteria 4782
10 Ga0070680_100133796 3300005336 Bacteria 2075
11 Ga0070680_100516187 3300005336 Bacteria 1023
12 Ga0068868_100202431 3300005338 Bacteria 1655
13 Ga0070660_100031659 3300005339 Bacteria 3974
14 Ga0070660_100089416 3300005339 Bacteria 2426
15 Ga0070709_10003090 3300005434 Bacteria 8947
16 Ga0070709_10012323 3300005434 Bacteria 4784
17 Ga0070714_100111985 3300005435 Bacteria 2418
18 Ga0070714_100145279 3300005435 Bacteria 2133
19 Ga0070713_100002234 3300005436 Bacteria 12560
20 Ga0070713_100090709 3300005436 Bacteria 2628
21 Ga0070713_100126117 3300005436 Bacteria 2252
22 Ga0070713_100138135 3300005436 Bacteria 2156
23 Ga0070713_100247749 3300005436 Bacteria 1624
24 Ga0070710_10000552 3300005437 Bacteria 17723
25 Ga0070711_100052534 3300005439 Bacteria 2804
26 Ga0070711_100062871 3300005439 Bacteria 2589
27 Ga0070711_100166520 3300005439 Bacteria 1676
28 Ga0070663_100005926 3300005455 Bacteria 7315
29 Ga0070678_100004690 3300005456 Bacteria 7779
30 Ga0070678_100029982 3300005456 Bacteria 3732
31 Ga0070678_100158147 3300005456 Bacteria 1833
32 Ga0070681_10037527 3300005458 Bacteria 4861
33 Ga0070681_10051933 3300005458 Bacteria 4088
34 Ga0070679_100034291 3300005530 Bacteria 5029
35 Ga0070684_100003258 3300005535 Bacteria 12159
36 Ga0068853_100039832 3300005539 Bacteria 4008
37 Ga0070665_100089594 3300005548 Bacteria 3082
38 Ga0070665_100268422 3300005548 Bacteria 1708
39 Ga0068855_100015587 3300005563 Bacteria 9146
40 Ga0068855_100055139 3300005563 Bacteria 4669
41 Ga0068855_100188786 3300005563 Bacteria 2326
42 Ga0068855_100217196 3300005563 Bacteria 2146
43 Ga0070664_100069626 3300005564 Bacteria 3011
44 Ga0068857_100191246 3300005577 Bacteria 1864
45 Ga0068854_100018315 3300005578 Bacteria 4700
46 Ga0068854_100032424 3300005578 Bacteria 3635
47 Ga0068856_100000226 3300005614 Bacteria 61246
48 Ga0068856_100485879 3300005614 Bacteria 1256
49 Ga0068859_100575677 3300005617 Bacteria 1220
50 Ga0068864_100065432 3300005618 Bacteria 3154
51 Ga0068864_100348669 3300005618 Bacteria 1396
52 Ga0068861_100404911 3300005719 Bacteria 1212
53 Ga0068851_10036633 3300005834 Bacteria 2457
54 Ga0068863_100158456 3300005841 Bacteria 2168
55 Ga0068858_100150433 3300005842 Bacteria 2189
56 Ga0068860_100000858 3300005843 Bacteria 33869
57 Ga0068860_100279690 3300005843 Bacteria 1630
58 Ga0068862_100049064 3300005844 Bacteria 3605
59 Ga0081455_10003156 3300005937 Bacteria 19144
60 Ga0081455_10006663 3300005937 Bacteria 12343
61 Ga0081540_1002121 3300005983 Bacteria 16515
62 Ga0081540_1003865 3300005983 Bacteria 11692
63 Ga0081540_1012706 3300005983 Bacteria 5523
64 Ga0081540_1015207 3300005983 Bacteria 4882
65 Ga0081540_1018462 3300005983 Bacteria 4276
66 Ga0081540_1038308 3300005983 Bacteria 2528
67 Ga0081539_10000729 3300005985 Bacteria 65907
68 Ga0081539_10105118 3300005985 Bacteria 1432
69 Ga0070717_10001026 3300006028 Bacteria 18703
70 Ga0075365_10033779 3300006038 Bacteria 3299
71 Ga0075368_10067264 3300006042 Bacteria 1442
72 Ga0070712_100310272 3300006175 Bacteria 1280
73 Ga0075362_10105324 3300006177 Bacteria 1323
74 Ga0075367_10078884 3300006178 Bacteria 1989
75 Ga0075369_10038354 3300006186 Bacteria 2043
76 Ga0097621_100200369 3300006237 Bacteria 1733
77 Ga0068865_100093629 3300006881 Bacteria 2185
78 Ga0097620_100575723 3300006931 Bacteria 1220
79 Ga0099825_1043182 3300006941 Bacteria 1217
80 Ga0099824_1002047 3300006942 Bacteria 29222
81 Ga0099822_1004737 3300006943 Bacteria 17740
82 Ga0099795_10005299 3300007788 Bacteria 3415
83 Ga0105240_10131327 3300009093 Bacteria 3004
84 Ga0105240_10133881 3300009093 Bacteria 2969
85 Ga0105240_10183475 3300009093 Bacteria 2467
86 Ga0105245_10540213 3300009098 Bacteria 1187
87 Ga0105248_10042923 3300009177 Bacteria 5071
88 Ga0105248_10195037 3300009177 Bacteria 2282
89 Ga0105248_10487473 3300009177 Bacteria 1389
90 Ga0105237_10006999 3300009545 Bacteria 12427
91 Ga0105237_10264897 3300009545 Bacteria 1721
92 Ga0105238_10063133 3300009551 Bacteria 3704
93 Ga0099796_10001766 3300010159 Bacteria 4513
94 Ga0105239_10142048 3300010375 Bacteria 2676
95 Ga0105239_10714585 3300010375 Bacteria 1146
96 Ga0157370_10177782 3300013104 Bacteria 1978
97 Ga0157369_10017488 3300013105 Bacteria 8058
98 Ga0157369_10102904 3300013105 Bacteria 3042
99 Ga0157369_10533430 3300013105 Bacteria 1214
100 Ga0157378_10002449 3300013297 Bacteria 16521
101 Ga0157378_10146176 3300013297 Bacteria 2199
102 Ga0157372_10390416 3300013307 Bacteria 1622
103 Ga0163163_10418720 3300014325 Bacteria 1398
104 Ga0213876_10002755 3300021384 Bacteria 10233
105 Ga0213876_10054844 3300021384 Bacteria 2104
106 Ga0213875_10053389 3300021388 Bacteria 1892
107 Ga0209148_1000037 3300025254 Bacteria 494767
108 Ga0209148_1015603 3300025254 Bacteria 1323
109 Ga0209455_1000036 3300025272 Bacteria 473309
110 Ga0209564_1000687 3300025295 Bacteria 49778
111 Ga0209758_1005049 3300025297 Bacteria 10483
112 Ga0209758_1030953 3300025297 Bacteria 2205
113 Ga0207697_10067420 3300025315 Bacteria 1496
114 Ga0207692_10001302 3300025898 Bacteria 9295
115 Ga0207692_10244897 3300025898 Bacteria 1072
116 Ga0207699_10023510 3300025906 Bacteria 3355
117 Ga0207699_10043714 3300025906 Bacteria 2604
118 Ga0207699_10045183 3300025906 Bacteria 2569
119 Ga0207699_10054158 3300025906 Bacteria 2382
120 Ga0207707_10103376 3300025912 Bacteria 2490
121 Ga0207707_10401777 3300025912 Bacteria 1176
122 Ga0207695_10043272 3300025913 Bacteria 4800
123 Ga0207671_10035801 3300025914 Bacteria 3681
124 Ga0207671_10069327 3300025914 Bacteria 2629
125 Ga0207671_10213178 3300025914 Bacteria 1511
126 Ga0207693_10052998 3300025915 Bacteria 3183
127 Ga0207663_10017392 3300025916 Bacteria 4006
128 Ga0207663_10349165 3300025916 Bacteria 1119
129 Ga0207660_10058742 3300025917 Bacteria 2759
130 Ga0207660_10087395 3300025917 Bacteria 2303
131 Ga0207662_10253407 3300025918 Bacteria 1156
132 Ga0207657_10008393 3300025919 Bacteria 10485
133 Ga0207652_10047083 3300025921 Bacteria 3683
134 Ga0207652_10201228 3300025921 Bacteria 1792
135 Ga0207659_10648911 3300025926 Bacteria 902
136 Ga0207700_10067007 3300025928 Bacteria 2746
137 Ga0207700_10104751 3300025928 Bacteria 2264
138 Ga0207700_10170217 3300025928 Bacteria 1817
139 Ga0207700_10178628 3300025928 Bacteria 1776
140 Ga0207700_10194546 3300025928 Bacteria 1706
141 Ga0207700_10306910 3300025928 Bacteria 1372
142 Ga0207664_10083898 3300025929 Bacteria 2598
143 Ga0207664_10106409 3300025929 Bacteria 2325
144 Ga0207706_10207672 3300025933 Bacteria 1717
145 Ga0207669_10309118 3300025937 Bacteria 1205
146 Ga0207665_10014858 3300025939 Bacteria 5119
147 Ga0207691_10106876 3300025940 Bacteria 2492
148 Ga0207661_10000959 3300025944 Bacteria 18985
149 Ga0207661_10131837 3300025944 Bacteria 2142
150 Ga0207679_10030874 3300025945 Bacteria 3746
151 Ga0207679_10254565 3300025945 Bacteria 1494
152 Ga0207667_10044714 3300025949 Bacteria 4691
153 Ga0207651_10444586 3300025960 Bacteria 1111
154 Ga0207668_10145275 3300025972 Bacteria 1829
155 Ga0207668_10269404 3300025972 Bacteria 1391
156 Ga0207677_10034976 3300026023 Bacteria 3258
157 Ga0207639_10118793 3300026041 Bacteria 2168
158 Ga0207639_10397786 3300026041 Bacteria 1240
159 Ga0207678_10004600 3300026067 Bacteria 12396
160 Ga0207678_10007829 3300026067 Bacteria 9431
161 Ga0207702_10000191 3300026078 Bacteria 72810
162 Ga0207676_10064715 3300026095 Bacteria 2909
163 Ga0207674_10055839 3300026116 Bacteria 4013
164 Ga0207683_10041933 3300026121 Bacteria 3997
165 Ga0207698_10048829 3300026142 Bacteria 3216
166 Ga0209589_1000005 3300027357 Bacteria 530958
167 Ga0209489_100005 3300027361 Bacteria 530958
168 Ga0209700_100006 3300027363 Bacteria 530958
169 Ga0268266_10000638 3300028379 Bacteria 47680
170 Ga0268265_10793281 3300028380 Bacteria 922
171 Ga0268264_10000051 3300028381 Bacteria 321565
172 Ga0268264_10186784 3300028381 Bacteria 1886
173 Ga0307515_10027090 3300028794 Bacteria 9818
174 Ga0307515_10226688 3300028794 Bacteria 1672
175 Ga0265338_10013087 3300028800 Bacteria 9401
176 Ga0265325_10014373 3300031241 Bacteria 4476
177 Ga0265339_10000047 3300031249 Bacteria 110601
178 Ga0265316_10286909 3300031344 Bacteria 1202
179 Ga0307513_10125136 3300031456 Bacteria 2528
180 Ga0307509_10133330 3300031507 Bacteria 2435
181 Ga0307509_10228166 3300031507 Bacteria 1668
182 Ga0265313_10000992 3300031595 Bacteria 27897
183 Ga0307508_10014562 3300031616 Bacteria 7175
184 Ga0265314_10006028 3300031711 Bacteria 10795
185 Ga0265342_10035731 3300031712 Bacteria 3039
186 Ga0265342_10040613 3300031712 Bacteria 2821
187 Ga0307405_10095835 3300031731 Bacteria 1977
188 Ga0307409_100119908 3300031995 Bacteria 2225
189 Ga0307411_10186486 3300032005 Bacteria 1579
190 Ga0307415_100114467 3300032126 Bacteria 2008
191 Ga0307507_10103959 3300033179 Bacteria 2360
192 Ga0307510_10022034 3300033180 Bacteria 7406
193 Ga0315911_1000005 3300033442 Bacteria 426255
194 Ga0373930_0013158 3300034816 Bacteria 1521
195 Ga0373940_0065551 3300035088 Bacteria 1047
196 Ga0373944_0039053 3300035089 Bacteria 1460
197 Ga0373952_0006580 3300035092 Bacteria 2152
198 Ga0373939_0076868 3300035114 Bacteria 1100
199 Ga0373953_0035701 3300035117 Bacteria 1955
200 Ga0373943_0092982 3300035170 Bacteria 1565
201 Ga0373946_0076373 3300035171 Bacteria 1458
202 Ga0373955_0116311 3300035172 Bacteria 1550
203 Ga0373924_0027656 3300035410 Bacteria 2256
204 Ga0373931_0008723 3300035691 Bacteria 4824
205 Ga0373935_0000106 3300035692 Bacteria 37674
206 Ga0373935_0123625 3300035692 Bacteria 1731
207 Ga0373927_0000267 3300035695 Bacteria 41137
208 Ga0373927_0032140 3300035695 Bacteria 3418
209 Ga0373933_0000018 3300035724 Bacteria 98044
210 Ga0373933_0094311 3300035724 Bacteria 1851
211 Ga0373925_0002245 3300037068 Bacteria 15641
212 Ga0373925_0047539 3300037068 Bacteria 3194
213 Ga0373925_0127017 3300037068 Bacteria 1985
214 Ga0395900_0265761 3300037418 Bacteria 1711
215 Ga0395900_0499688 3300037418 Bacteria 1167
216 Ga0395898_0004875 3300037466 Bacteria 14570
217 Ga0436364_0310036 3300037853 Bacteria 2843
218 Ga0436364_0482403 3300037853 Bacteria 6543
219 Ga0436364_0699776 3300037853 Bacteria 2850
220 Ga0436365_0093274 3300039437 Bacteria 81442
221 Ga0436365_0372041 3300039437 Bacteria 3768
222 Ga0436365_1240066 3300039437 Bacteria 1817
223 Ga0436365_1925389 3300039437 Bacteria 925
224 Ga0436363_1370601 3300039450 Bacteria 1094
225 Ga0436362_0626323 3300039453 Bacteria 7982
226 Ga0451787_672321 3300041441 Bacteria 894
227 Ga0451791_0080411 3300041451 Bacteria 1300
228 Ga0466963_0285305 3300044694 Bacteria 1160
229 Ga0466971_0019749 3300044719 Bacteria 2994
230 Ga0466968_0086115 3300044735 Bacteria 1387
231 Ga0466957_0115331 3300044842 Bacteria 1708
232 Ga0466957_0149230 3300044842 Bacteria 1511
233 Ga0466959_0080951 3300045049 Bacteria 2340
234 Ga0466967_0019242 3300045976 Bacteria 5486
235 Ga0466967_0372433 3300045976 Bacteria 1385
236 Ga0495592_0023918 3300046454 Bacteria 4647
237 Ga0495603_0000609 3300046455 Bacteria 20089
238 Ga0495603_0016899 3300046455 Bacteria 4415
239 Ga0495629_0000074 3300046459 Bacteria 87355
240 Ga0495629_0008434 3300046459 Bacteria 7586
241 Ga0495638_0065480 3300046460 Bacteria 2236
242 Ga0495641_0016556 3300046461 Bacteria 3880
243 Ga0495651_0029243 3300046462 Bacteria 4297
244 Ga0495651_0052130 3300046462 Bacteria 3152
245 Ga0495580_0000467 3300046472 Bacteria 33629
246 Ga0495580_0092623 3300046472 Bacteria 2104
247 Ga0495582_0000059 3300046473 Bacteria 55798
248 Ga0495639_0000283 3300046475 Bacteria 25017
249 Ga0495639_0051655 3300046475 Bacteria 1870
250 Ga0495662_0001173 3300046476 Bacteria 12925
251 Ga0495662_0001630 3300046476 Bacteria 11166
252 Ga0495664_0005211 3300046477 Bacteria 7132
253 Ga0495664_0042959 3300046477 Bacteria 2678
254 Ga0495664_0078824 3300046477 Bacteria 1973
255 Ga0495594_0000621 3300046499 Bacteria 18249
256 Ga0495607_0036953 3300046501 Bacteria 2937
257 Ga0495583_0068953 3300046506 Bacteria 1558
258 Ga0495606_0148206 3300046507 Bacteria 1379
259 Ga0495608_0307479 3300046511 Bacteria 981
260 Ga0495610_0112737 3300046512 Bacteria 1202
261 Ga0495616_0074302 3300046513 Bacteria 1638
262 Ga0495620_0014109 3300046515 Bacteria 4071
263 Ga0495620_0020979 3300046515 Bacteria 3180
264 Ga0495628_0026181 3300046516 Bacteria 4761
265 Ga0495630_0012889 3300046517 Bacteria 6073
266 Ga0495631_0052674 3300046518 Bacteria 1777
267 Ga0495632_0093296 3300046519 Bacteria 1425
268 Ga0495637_0011311 3300046520 Bacteria 4292
269 Ga0495643_0001099 3300046522 Bacteria 26914
270 Ga0495648_0005796 3300046524 Bacteria 10186
271 Ga0495648_0122351 3300046524 Bacteria 1396
272 Ga0495640_0015782 3300046533 Bacteria 5668
273 Ga0495645_0017494 3300046543 Bacteria 5135
274 Ga0495622_0016584 3300046557 Bacteria 3431
275 Ga0495622_0019759 3300046557 Bacteria 3136
276 Ga0495668_0037434 3300046616 Bacteria 2714
277 Ga0495668_0082045 3300046616 Bacteria 1769
278 Ga0495634_0010682 3300046642 Bacteria 6721
279 Ga0495634_0075118 3300046642 Bacteria 2220
280 Ga0495625_0022814 3300046660 Bacteria 4790
281 Ga0495625_0029631 3300046660 Bacteria 4090
282 Ga0495635_0000177 3300046663 Bacteria 40081
283 Ga0495661_0132333 3300046665 Bacteria 1365
284 Ga0495588_0002207 3300046674 Bacteria 8335
285 Ga0495588_0032016 3300046674 Bacteria 2649
286 Ga0495657_0079265 3300046675 Bacteria 2127
287 Ga0495599_0079243 3300046678 Bacteria 2051
288 Ga0495647_0001565 3300046681 Bacteria 7063
289 Ga0495658_0000338 3300046683 Bacteria 26426
290 Ga0495658_0012964 3300046683 Bacteria 4234
291 Ga0495669_0225628 3300046684 Bacteria 898
292 Ga0495613_0022290 3300046689 Bacteria 4720
293 Ga0495613_0158065 3300046689 Bacteria 1614
294 Ga0495624_0000963 3300046690 Bacteria 22722
295 Ga0495670_0021255 3300046691 Bacteria 3200
296 Ga0495671_0179488 3300046692 Bacteria 1028
297 Ga0495649_0024040 3300046694 Bacteria 3401
298 Ga0495589_0130857 3300046794 Bacteria 1205
299 Ga0495600_0062169 3300046809 Bacteria 2439
300 Ga0495600_0342650 3300046809 Bacteria 937
301 Ga0495660_0025568 3300046810 Bacteria 3352
302 Ga0495581_0000784 3300047315 Bacteria 16864
303 Ga0495581_0014180 3300047315 Bacteria 4620
304 Ga0495674_0003252 3300047319 Bacteria 15782
305 Ga0495674_0018428 3300047319 Bacteria 6499
306 Ga0495672_0017605 3300047320 Bacteria 4776
307 Ga0495676_0033076 3300047321 Bacteria 4359
308 Ga0495683_0053092 3300047323 Bacteria 2022
309 Ga0495683_0228714 3300047323 Bacteria 826
310 Ga0495685_091745 3300047447 Bacteria 1007
311 Ga0495681_0118621 3300047470 Bacteria 1138
312 Ga0495684_0073141 3300047471 Bacteria 2604
313 Ga0495686_0049137 3300047472 Bacteria 2655
314 Ga0495686_0071432 3300047472 Bacteria 2136
315 Ga0495686_0169747 3300047472 Bacteria 1269
316 Ga0495686_0227773 3300047472 Unclassified 1057
317 Ga0495593_0000158 3300047673 Bacteria 34211
318 Ga0495626_0015687 3300048091 Bacteria 3873
319 Ga0496101_0149898 3300048904 Bacteria 1783
320 Ga0496103_0208623 3300048906 Bacteria 1256
321 Ga0496104_0068302 3300048907 Bacteria 3377
322 Ga0496104_0464738 3300048907 Bacteria 1177
323 Ga0496104_0730355 3300048907 Bacteria 898
324 Ga0496105_0083710 3300048908 Bacteria 2634
325 Ga0496106_0026873 3300048909 Bacteria 4286
326 Ga0496106_0481954 3300048909 Bacteria 996
327 Ga0496107_0164616 3300048910 Bacteria 1644
328 Ga0496107_0193489 3300048910 Bacteria 1511
329 Ga0496108_0012004 3300048911 Bacteria 7048
330 Ga0496109_0275200 3300048912 Bacteria 1586
331 Ga0496110_0032329 3300048913 Bacteria 4517
332 Ga0496110_0346144 3300048913 Bacteria 1354
333 Ga0496111_0083734 3300048914 Bacteria 2331
334 Ga0496111_0152814 3300048914 Bacteria 1712
335 Ga0496112_0000137 3300048915 Bacteria 45501
336 Ga0496113_0004044 3300048916 Bacteria 8931
337 Ga0496115_0306204 3300048918 Bacteria 1301
338 Ga0496116_0001246 3300048919 Bacteria 29566
339 Ga0496116_0063694 3300048919 Bacteria 2374
340 Ga0496117_0013506 3300048920 Bacteria 7119
341 Ga0496117_0041411 3300048920 Bacteria 3375
342 Ga0496117_0215047 3300048920 Bacteria 1074
343 Ga0496118_0002445 3300048921 Bacteria 25000
344 Ga0496118_0027788 3300048921 Bacteria 4779
345 Ga0496118_0117338 3300048921 Bacteria 1746
346 Ga0496120_0036223 3300048923 Bacteria 2939
347 Ga0496121_0000452 3300048924 Bacteria 80796
348 Ga0496121_0035706 3300048924 Bacteria 4447
349 Ga0496121_0067401 3300048924 Bacteria 2901
350 Ga0496121_0137450 3300048924 Bacteria 1818
351 Ga0496121_0291390 3300048924 Bacteria 1112
352 Ga0496121_0305373 3300048924 Bacteria 1078
353 Ga0496122_0016327 3300048925 Bacteria 7036
354 Ga0496122_0035418 3300048925 Bacteria 4061
355 Ga0496123_0024620 3300048926 Bacteria 4569
356 Ga0496123_0034258 3300048926 Bacteria 3641
357 Ga0496124_0000267 3300048927 Bacteria 101138
358 Ga0496124_0118562 3300048927 Bacteria 2119
359 Ga0496124_0206905 3300048927 Bacteria 1488
360 Ga0496124_0297662 3300048927 Bacteria 1167
361 Ga0496125_0001227 3300048928 Bacteria 38397
362 Ga0496125_0010362 3300048928 Bacteria 9430
363 Ga0496125_0043745 3300048928 Bacteria 3796
364 Ga0496125_0058125 3300048928 Bacteria 3126
365 Ga0496126_0015704 3300048929 Bacteria 7609
366 Ga0496126_0016726 3300048929 Bacteria 7325
367 Ga0496126_0035587 3300048929 Bacteria 4665
368 Ga0496126_0059836 3300048929 Bacteria 3429
369 Ga0496126_0095624 3300048929 Bacteria 2605
370 Ga0496126_0223370 3300048929 Bacteria 1581
371 Ga0496126_0285067 3300048929 Bacteria 1367
372 Ga0495678_037365 3300049459 Bacteria 1974
373 Ga0495682_0055834 3300049460 Bacteria 1432
374 Ga0501031_0152499 3300049568 Bacteria 1510
375 Ga0501033_0005716 3300049570 Bacteria 9806
376 Ga0501034_0173443 3300049571 Bacteria 2123
377 Ga0501046_0062849 3300049580 Bacteria 2900
378 Ga0501047_0167254 3300049581 Bacteria 2069
379 Ga0501067_0042258 3300049583 Bacteria 2531
380 Ga0501067_0115062 3300049583 Bacteria 1496
381 Ga0501069_0037341 3300049585 Bacteria 2681
382 Ga0501070_0249142 3300049586 Bacteria 1453
383 Ga0501071_0209641 3300049587 Bacteria 1465
384 Ga0501073_0002257 3300049589 Bacteria 14427
385 Ga0501073_0011678 3300049589 Bacteria 6415
386 Ga0501074_0128801 3300049590 Bacteria 1811
387 Ga0501075_0102416 3300049591 Bacteria 2175
388 Ga0501076_0163667 3300049592 Bacteria 1813
389 Ga0501079_0130759 3300049741 Bacteria 1954
390 Ga0501080_0152396 3300049742 Bacteria 2136
391 Ga0501081_0222824 3300049743 Bacteria 1372
392 nmdc:mga03683_92025_c1 3300050489 Bacteria 1323
393 nmdc:mga0yw44_237366_c1 3300050492 Bacteria 1211
394 nmdc:mga0yw44_24266_c1 3300050492 Bacteria 3429
395 nmdc:mga06z11_12993_c1 3300050494 Bacteria 3639
396 nmdc:mga06z11_47463_c1 3300050494 Bacteria 2181
397 nmdc:mga0sz30_1095_c3 3300050516 Bacteria 2861
398 Ga0495601_0046485 3300053077 Bacteria 2732
399 Ga0495601_0233990 3300053077 Bacteria 1200
400 Ga0500643_010794 3300053087 Bacteria 3377
401 Ga0500581_032719 3300053089 Bacteria 2661
402 Ga0500651_0044396 3300053093 Bacteria 2799
403 Ga0500566_0000244 3300053094 Bacteria 29168
404 Ga0500566_0001348 3300053094 Bacteria 14353
405 Ga0500566_0002949 3300053094 Bacteria 10161
406 Ga0500566_0069046 3300053094 Bacteria 1986
407 Ga0500640_002409 3300053095 Bacteria 6174
408 Ga0500641_0003823 3300053096 Bacteria 5321
409 Ga0500641_0027837 3300053096 Bacteria 2203
410 Ga0500650_0000274 3300053098 Bacteria 12448
411 Ga0500556_0000051 3300053104 Bacteria 119031
412 Ga0500558_062917 3300053106 Bacteria 1546
413 Ga0500562_007572 3300053108 Bacteria 2737
414 Ga0500572_001039 3300053111 Bacteria 8281
415 Ga0500594_0030830 3300053118 Bacteria 1410
416 Ga0500595_000580 3300053119 Bacteria 21802
417 Ga0500595_035904 3300053119 Bacteria 1629
418 Ga0500608_000737 3300053122 Bacteria 11940
419 Ga0500614_000443 3300053123 Bacteria 10794
420 Ga0500618_023794 3300053125 Bacteria 1480
421 Ga0500642_0000041 3300053130 Bacteria 89564
422 Ga0500652_000513 3300053131 Bacteria 13653
423 Ga0500658_0026902 3300053134 Bacteria 2219
424 Ga0500559_0000188 3300053136 Bacteria 49358
425 Ga0500559_0004499 3300053136 Bacteria 6599
426 Ga0500568_0000715 3300053139 Bacteria 23772
427 Ga0500568_0043749 3300053139 Bacteria 1789
428 Ga0500577_0060755 3300053142 Bacteria 1452
429 Ga0500588_0124297 3300053146 Bacteria 913
430 Ga0500589_096302 3300053147 Bacteria 1293
431 Ga0500590_001257 3300053148 Bacteria 10155
432 Ga0500590_010732 3300053148 Bacteria 4633
433 Ga0500590_101687 3300053148 Bacteria 1380
434 Ga0500603_000194 3300053150 Bacteria 15890
435 Ga0500603_000673 3300053150 Bacteria 8320
436 Ga0500604_0005437 3300053151 Bacteria 3363
437 Ga0500616_0000150 3300053153 Bacteria 117918
438 Ga0500622_0000502 3300053156 Bacteria 36464
439 Ga0500627_0103399 3300053158 Bacteria 1279
440 Ga0500630_001162 3300053159 Bacteria 12332
441 Ga0500638_010257 3300053162 Bacteria 4094
442 Ga0500638_016392 3300053162 Bacteria 3418
443 Ga0500638_042327 3300053162 Bacteria 2212
444 Ga0500639_000012 3300053163 Bacteria 127545
445 Ga0500637_0000303 3300053178 Bacteria 18607
446 Ga0500637_0003301 3300053178 Bacteria 7417
447 Ga0500637_0057844 3300053178 Bacteria 2217
448 Ga0500596_006582 3300053735 Bacteria 1955
449 Ga0500601_004120 3300053737 Bacteria 1576
450 Ga0500661_001086 3300055283 Bacteria 5115
451 Ga0466962_0065136 3300061719 Bacteria 1740

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0000018 Ga0373933_0000018_25782_26594 229
2 3300025945 Ga0207679_10254565 Ga0207679_102545652 234
3 3300031995 Ga0307409_100119908 Ga0307409_1001199082 236
4 3300032005 Ga0307411_10186486 Ga0307411_101864862 236
5 3300032126 Ga0307415_100114467 Ga0307415_1001144672 236
6 3300041451 Ga0451791_0080411 Ga0451791_0080411_236_1138 237
7 3300005335 Ga0070666_10079528 Ga0070666_100795284 239
8 3300005339 Ga0070660_100031659 Ga0070660_1000316592 239
9 3300005548 Ga0070665_100089594 Ga0070665_1000895943 239
10 3300005617 Ga0068859_100575677 Ga0068859_1005756772 239
11 3300006931 Ga0097620_100575723 Ga0097620_1005757232 239
12 3300034816 Ga0373930_0013158 Ga0373930_0013158_97_879 239
13 3300035088 Ga0373940_0065551 Ga0373940_0065551_122_904 239
14 3300035089 Ga0373944_0039053 Ga0373944_0039053_374_1213 239
15 3300035092 Ga0373952_0006580 Ga0373952_0006580_1332_2114 239
16 3300035114 Ga0373939_0076868 Ga0373939_0076868_162_944 239
17 3300035117 Ga0373953_0035701 Ga0373953_0035701_930_1712 239
18 3300035170 Ga0373943_0092982 Ga0373943_0092982_287_1132 239
19 3300035172 Ga0373955_0116311 Ga0373955_0116311_495_1277 239
20 3300035410 Ga0373924_0027656 Ga0373924_0027656_1229_2074 239
21 3300035691 Ga0373931_0008723 Ga0373931_0008723_500_1282 239
22 3300035692 Ga0373935_0000106 Ga0373935_0000106_21054_21836 239
23 3300035695 Ga0373927_0000267 Ga0373927_0000267_10931_11713 239
24 3300035724 Ga0373933_0094311 Ga0373933_0094311_641_1423 239
25 3300037068 Ga0373925_0002245 Ga0373925_0002245_2676_3458 239
26 3300046454 Ga0495592_0023918 Ga0495592_0023918_449_1231 239
27 3300046455 Ga0495603_0000609 Ga0495603_0000609_5443_6225 239
28 3300046459 Ga0495629_0000074 Ga0495629_0000074_60336_61118 239
29 3300046461 Ga0495641_0016556 Ga0495641_0016556_638_1420 239
30 3300046472 Ga0495580_0000467 Ga0495580_0000467_25103_25885 239
31 3300046473 Ga0495582_0000059 Ga0495582_0000059_4244_5026 239
32 3300046475 Ga0495639_0000283 Ga0495639_0000283_22111_22893 239
33 3300046476 Ga0495662_0001173 Ga0495662_0001173_11353_12135 239
34 3300046477 Ga0495664_0005211 Ga0495664_0005211_3609_4391 239
35 3300046477 Ga0495664_0078824 Ga0495664_0078824_287_1132 239
36 3300046499 Ga0495594_0000621 Ga0495594_0000621_13215_13997 239
37 3300046516 Ga0495628_0026181 Ga0495628_0026181_3345_4127 239
38 3300046517 Ga0495630_0012889 Ga0495630_0012889_2081_2863 239
39 3300046533 Ga0495640_0015782 Ga0495640_0015782_2509_3291 239
40 3300046557 Ga0495622_0019759 Ga0495622_0019759_1584_2366 239
41 3300046642 Ga0495634_0010682 Ga0495634_0010682_5150_5932 239
42 3300046642 Ga0495634_0075118 Ga0495634_0075118_853_1698 239
43 3300046663 Ga0495635_0000177 Ga0495635_0000177_38543_39325 239
44 3300046674 Ga0495588_0002207 Ga0495588_0002207_5448_6230 239
45 3300046678 Ga0495599_0079243 Ga0495599_0079243_599_1381 239
46 3300046681 Ga0495647_0001565 Ga0495647_0001565_3006_3788 239
47 3300046683 Ga0495658_0000338 Ga0495658_0000338_8771_9553 239
48 3300046689 Ga0495613_0022290 Ga0495613_0022290_3275_4057 239
49 3300046690 Ga0495624_0000963 Ga0495624_0000963_4755_5537 239
50 3300047315 Ga0495581_0000784 Ga0495581_0000784_13303_14085 239
51 3300047315 Ga0495581_0014180 Ga0495581_0014180_1470_2315 239
52 3300047319 Ga0495674_0003252 Ga0495674_0003252_14303_15085 239
53 3300047319 Ga0495674_0018428 Ga0495674_0018428_3817_4662 239
54 3300047321 Ga0495676_0033076 Ga0495676_0033076_2942_3724 239
55 3300047471 Ga0495684_0073141 Ga0495684_0073141_1161_1943 239
56 3300047673 Ga0495593_0000158 Ga0495593_0000158_4494_5276 239
57 3300048906 Ga0496103_0208623 Ga0496103_0208623_292_1074 239
58 3300048909 Ga0496106_0481954 Ga0496106_0481954_135_917 239
59 3300048912 Ga0496109_0275200 Ga0496109_0275200_76_858 239
60 3300048914 Ga0496111_0152814 Ga0496111_0152814_911_1693 239
61 3300048916 Ga0496113_0004044 Ga0496113_0004044_6667_7449 239
62 3300006175 Ga0070712_100310272 Ga0070712_1003102722 240
63 3300025915 Ga0207693_10052998 Ga0207693_100529984 240
64 3300025918 Ga0207662_10253407 Ga0207662_102534072 240
65 3300025254 Ga0209148_1015603 Ga0209148_10156031 241
66 3300061719 Ga0466962_0065136 Ga0466962_0065136_695_1480 241
67 iso_pu_bacteria 2513237096 2513656157 241
68 iso_pu_bacteria 2513237145 2513917663 241
69 iso_pu_bacteria 2903748898 2903750756 241
70 iso_pu_bacteria 2906635258 2906642493 241
71 iso_pu_bacteria 2906660503 2906661053 241
72 3300005563 Ga0068855_100188786 Ga0068855_1001887862 242
73 3300025297 Ga0209758_1030953 Ga0209758_10309534 242
74 3300044842 Ga0466957_0115331 Ga0466957_0115331_315_1103 242
75 3300047323 Ga0495683_0228714 Ga0495683_0228714_11_754 242
76 3300005434 Ga0070709_10012323 Ga0070709_100123235 243
77 3300005436 Ga0070713_100090709 Ga0070713_1000907092 243
78 3300005439 Ga0070711_100052534 Ga0070711_1000525343 243
79 3300009177 Ga0105248_10042923 Ga0105248_100429234 243
80 3300025906 Ga0207699_10043714 Ga0207699_100437144 243
81 3300033180 Ga0307510_10022034 Ga0307510_100220345 243
82 3300046462 Ga0495651_0029243 Ga0495651_0029243_1979_2746 243
83 3300046506 Ga0495583_0068953 Ga0495583_0068953_349_1125 243
84 3300048929 Ga0496126_0223370 Ga0496126_0223370_706_1482 243
85 3300049460 Ga0495682_0055834 Ga0495682_0055834_212_1000 243
86 3300005456 Ga0070678_100004690 Ga0070678_1000046905 244
87 3300009098 Ga0105245_10540213 Ga0105245_105402131 244
88 3300021384 Ga0213876_10002755 Ga0213876_1000275510 244
89 3300026067 Ga0207678_10004600 Ga0207678_1000460014 244
90 3300028380 Ga0268265_10793281 Ga0268265_107932811 244
91 3300028794 Ga0307515_10226688 Ga0307515_102266882 244
92 3300033179 Ga0307507_10103959 Ga0307507_101039592 244
93 3300035695 Ga0373927_0032140 Ga0373927_0032140_190_969 244
94 3300037068 Ga0373925_0047539 Ga0373925_0047539_1792_2571 244
95 3300045976 Ga0466967_0019242 Ga0466967_0019242_2239_3024 244
96 3300046460 Ga0495638_0065480 Ga0495638_0065480_1411_2190 244
97 3300046501 Ga0495607_0036953 Ga0495607_0036953_364_1143 244
98 3300046512 Ga0495610_0112737 Ga0495610_0112737_262_1041 244
99 3300046513 Ga0495616_0074302 Ga0495616_0074302_625_1404 244
100 3300046515 Ga0495620_0014109 Ga0495620_0014109_245_1024 244
101 3300046518 Ga0495631_0052674 Ga0495631_0052674_487_1266 244
102 3300046520 Ga0495637_0011311 Ga0495637_0011311_948_1727 244
103 3300046616 Ga0495668_0037434 Ga0495668_0037434_1253_2032 244
104 3300046660 Ga0495625_0022814 Ga0495625_0022814_3117_3896 244
105 3300046665 Ga0495661_0132333 Ga0495661_0132333_470_1249 244
106 3300046683 Ga0495658_0012964 Ga0495658_0012964_3430_4209 244
107 3300046689 Ga0495613_0158065 Ga0495613_0158065_348_1127 244
108 3300046691 Ga0495670_0021255 Ga0495670_0021255_240_1019 244
109 3300046692 Ga0495671_0179488 Ga0495671_0179488_161_940 244
110 3300046810 Ga0495660_0025568 Ga0495660_0025568_1164_1943 244
111 3300047472 Ga0495686_0049137 Ga0495686_0049137_1750_2529 244
112 3300048091 Ga0495626_0015687 Ga0495626_0015687_1975_2754 244
113 3300048919 Ga0496116_0063694 Ga0496116_0063694_901_1680 244
114 3300048920 Ga0496117_0215047 Ga0496117_0215047_205_984 244
115 3300048923 Ga0496120_0036223 Ga0496120_0036223_1487_2266 244
116 3300048925 Ga0496122_0035418 Ga0496122_0035418_2150_2929 244
117 3300048926 Ga0496123_0024620 Ga0496123_0024620_1678_2457 244
118 3300048928 Ga0496125_0001227 Ga0496125_0001227_26511_27290 244
119 3300048929 Ga0496126_0095624 Ga0496126_0095624_1150_1929 244
120 3300050492 nmdc:mga0yw44_24266_c1 nmdc:mga0yw44_24266_c1_2007_2786 244
121 3300053087 Ga0500643_010794 Ga0500643_010794_1204_1983 244
122 3300053089 Ga0500581_032719 Ga0500581_032719_981_1760 244
123 3300053093 Ga0500651_0044396 Ga0500651_0044396_1395_2174 244
124 3300053096 Ga0500641_0003823 Ga0500641_0003823_1552_2331 244
125 3300053098 Ga0500650_0000274 Ga0500650_0000274_9188_9967 244
126 3300053104 Ga0500556_0000051 Ga0500556_0000051_57210_57989 244
127 3300053108 Ga0500562_007572 Ga0500562_007572_1613_2392 244
128 3300053118 Ga0500594_0030830 Ga0500594_0030830_608_1387 244
129 3300053130 Ga0500642_0000041 Ga0500642_0000041_24267_25046 244
130 3300053131 Ga0500652_000513 Ga0500652_000513_12255_13034 244
131 3300053134 Ga0500658_0026902 Ga0500658_0026902_656_1435 244
132 3300053139 Ga0500568_0000715 Ga0500568_0000715_6795_7574 244
133 3300053142 Ga0500577_0060755 Ga0500577_0060755_557_1336 244
134 3300053146 Ga0500588_0124297 Ga0500588_0124297_75_854 244
135 3300053151 Ga0500604_0005437 Ga0500604_0005437_2213_2992 244
136 3300053153 Ga0500616_0000150 Ga0500616_0000150_56337_57116 244
137 3300053156 Ga0500622_0000502 Ga0500622_0000502_28538_29317 244
138 3300053158 Ga0500627_0103399 Ga0500627_0103399_47_826 244
139 3300009093 Ga0105240_10183475 Ga0105240_101834753 245
140 3300025933 Ga0207706_10207672 Ga0207706_102076723 245
141 3300039450 Ga0436363_1370601 Ga0436363_1370601_55_843 245
142 3300048910 Ga0496107_0164616 Ga0496107_0164616_31_768 245
143 3300048911 Ga0496108_0012004 Ga0496108_0012004_3535_4302 245
144 3300005548 Ga0070665_100268422 Ga0070665_1002684223 246
145 3300021384 Ga0213876_10054844 Ga0213876_100548442 246
146 3300025906 Ga0207699_10023510 Ga0207699_100235103 246
147 3300028794 Ga0307515_10027090 Ga0307515_100270907 246
148 3300031456 Ga0307513_10125136 Ga0307513_101251362 246
149 3300031507 Ga0307509_10133330 Ga0307509_101333302 246
150 3300039437 Ga0436365_1240066 Ga0436365_1240066_918_1703 246
151 3300047320 Ga0495672_0017605 Ga0495672_0017605_2739_3527 246
152 3300047470 Ga0495681_0118621 Ga0495681_0118621_36_824 246
153 3300048924 Ga0496121_0305373 Ga0496121_0305373_273_1058 246
154 3300006941 Ga0099825_1043182 Ga0099825_10431822 247
155 3300006942 Ga0099824_1002047 Ga0099824_100204717 247
156 3300006943 Ga0099822_1004737 Ga0099822_100473714 247
157 3300027357 Ga0209589_1000005 Ga0209589_1000005244 247
158 3300027361 Ga0209489_100005 Ga0209489_100005244 247
159 3300027363 Ga0209700_100006 Ga0209700_100006244 247
160 3300046524 Ga0495648_0122351 Ga0495648_0122351_299_1078 247
161 3300048921 Ga0496118_0027788 Ga0496118_0027788_1575_2360 247
162 3300048924 Ga0496121_0035706 Ga0496121_0035706_2481_3260 247
163 3300039437 Ga0436365_0093274 Ga0436365_0093274_50561_51349 248
164 3300039453 Ga0436362_0626323 Ga0436362_0626323_3413_4201 248
165 iso_pu_bacteria 2513237137 2513861584 248
166 iso_pu_bacteria 2904690495 2904695181 248
167 iso_pu_bacteria 2908756301 2908757589 248
168 3300005338 Ga0068868_100202431 Ga0068868_1002024311 249
169 3300005455 Ga0070663_100005926 Ga0070663_1000059265 249
170 3300005564 Ga0070664_100069626 Ga0070664_1000696264 249
171 3300005618 Ga0068864_100065432 Ga0068864_1000654325 249
172 3300005834 Ga0068851_10036633 Ga0068851_100366334 249
173 3300005842 Ga0068858_100150433 Ga0068858_1001504331 249
174 3300006237 Ga0097621_100200369 Ga0097621_1002003692 249
175 3300006881 Ga0068865_100093629 Ga0068865_1000936293 249
176 3300009177 Ga0105248_10195037 Ga0105248_101950373 249
177 3300009545 Ga0105237_10264897 Ga0105237_102648972 249
178 3300025315 Ga0207697_10067420 Ga0207697_100674202 249
179 3300025914 Ga0207671_10213178 Ga0207671_102131781 249
180 3300025945 Ga0207679_10030874 Ga0207679_100308745 249
181 3300025960 Ga0207651_10444586 Ga0207651_104445861 249
182 3300026023 Ga0207677_10034976 Ga0207677_100349764 249
183 3300026067 Ga0207678_10007829 Ga0207678_100078297 249
184 3300026095 Ga0207676_10064715 Ga0207676_100647152 249
185 3300026142 Ga0207698_10048829 Ga0207698_100488292 249
186 3300031731 Ga0307405_10095835 Ga0307405_100958352 249
187 3300046459 Ga0495629_0008434 Ga0495629_0008434_3304_4092 249
188 3300046507 Ga0495606_0148206 Ga0495606_0148206_223_1002 249
189 3300046511 Ga0495608_0307479 Ga0495608_0307479_120_908 249
190 3300046557 Ga0495622_0016584 Ga0495622_0016584_1727_2506 249
191 3300048904 Ga0496101_0149898 Ga0496101_0149898_101_883 249
192 3300048907 Ga0496104_0068302 Ga0496104_0068302_1029_1811 249
193 3300048908 Ga0496105_0083710 Ga0496105_0083710_442_1224 249
194 3300048910 Ga0496107_0193489 Ga0496107_0193489_105_887 249
195 3300048913 Ga0496110_0032329 Ga0496110_0032329_3353_4135 249
196 3300048913 Ga0496110_0346144 Ga0496110_0346144_517_1299 249
197 3300048918 Ga0496115_0306204 Ga0496115_0306204_31_813 249
198 3300048927 Ga0496124_0118562 Ga0496124_0118562_970_1749 249
199 3300053094 Ga0500566_0001348 Ga0500566_0001348_3536_4315 249
200 3300053122 Ga0500608_000737 Ga0500608_000737_10098_10937 249
201 3300053136 Ga0500559_0000188 Ga0500559_0000188_39517_40356 249
202 3300053148 Ga0500590_010732 Ga0500590_010732_1448_2287 249
203 3300053178 Ga0500637_0057844 Ga0500637_0057844_686_1465 249
204 iso_pu_bacteria 3005445848 3005451913 249
205 3300005456 Ga0070678_100029982 Ga0070678_1000299825 250
206 3300005983 Ga0081540_1002121 Ga0081540_100212110 250
207 3300005983 Ga0081540_1018462 Ga0081540_10184622 250
208 3300025940 Ga0207691_10106876 Ga0207691_101068762 250
209 3300025972 Ga0207668_10145275 Ga0207668_101452752 250
210 3300026121 Ga0207683_10041933 Ga0207683_100419331 250
211 3300005436 Ga0070713_100002234 Ga0070713_10000223412 251
212 3300005439 Ga0070711_100166520 Ga0070711_1001665202 251
213 3300005458 Ga0070681_10051933 Ga0070681_100519334 251
214 3300005563 Ga0068855_100217196 Ga0068855_1002171962 251
215 3300005578 Ga0068854_100032424 Ga0068854_1000324246 251
216 3300005614 Ga0068856_100485879 Ga0068856_1004858792 251
217 3300005719 Ga0068861_100404911 Ga0068861_1004049112 251
218 3300005841 Ga0068863_100158456 Ga0068863_1001584562 251
219 3300005843 Ga0068860_100279690 Ga0068860_1002796902 251
220 3300005844 Ga0068862_100049064 Ga0068862_1000490646 251
221 3300006028 Ga0070717_10001026 Ga0070717_100010269 251
222 3300006177 Ga0075362_10105324 Ga0075362_101053242 251
223 3300010375 Ga0105239_10142048 Ga0105239_101420483 251
224 3300025912 Ga0207707_10401777 Ga0207707_104017771 251
225 3300025916 Ga0207663_10349165 Ga0207663_103491652 251
226 3300025928 Ga0207700_10194546 Ga0207700_101945462 251
227 3300025972 Ga0207668_10269404 Ga0207668_102694041 251
228 3300026041 Ga0207639_10397786 Ga0207639_103977862 251
229 3300028379 Ga0268266_10000638 Ga0268266_100006383 251
230 3300028381 Ga0268264_10186784 Ga0268264_101867842 251
231 3300031507 Ga0307509_10228166 Ga0307509_102281662 251
232 3300035692 Ga0373935_0123625 Ga0373935_0123625_349_1131 251
233 3300037068 Ga0373925_0127017 Ga0373925_0127017_857_1645 251
234 3300037853 Ga0436364_0310036 Ga0436364_0310036_1281_2063 251
235 3300045976 Ga0466967_0372433 Ga0466967_0372433_29_811 251
236 3300046472 Ga0495580_0092623 Ga0495580_0092623_799_1587 251
237 3300046674 Ga0495588_0032016 Ga0495588_0032016_1325_2113 251
238 3300047447 Ga0495685_091745 Ga0495685_091745_18_821 251
239 3300048909 Ga0496106_0026873 Ga0496106_0026873_1652_2434 251
240 3300048914 Ga0496111_0083734 Ga0496111_0083734_355_1143 251
241 3300048920 Ga0496117_0041411 Ga0496117_0041411_317_1099 251
242 3300048921 Ga0496118_0002445 Ga0496118_0002445_22356_23138 251
243 3300048924 Ga0496121_0000452 Ga0496121_0000452_31984_32766 251
244 3300048924 Ga0496121_0137450 Ga0496121_0137450_434_1222 251
245 3300048927 Ga0496124_0000267 Ga0496124_0000267_59709_60491 251
246 3300048927 Ga0496124_0297662 Ga0496124_0297662_355_1143 251
247 3300048928 Ga0496125_0043745 Ga0496125_0043745_1530_2315 251
248 3300048928 Ga0496125_0058125 Ga0496125_0058125_1873_2655 251
249 3300048929 Ga0496126_0016726 Ga0496126_0016726_6048_6830 251
250 3300049591 Ga0501075_0102416 Ga0501075_0102416_970_1758 251
251 3300049592 Ga0501076_0163667 Ga0501076_0163667_833_1621 251
252 3300049743 Ga0501081_0222824 Ga0501081_0222824_510_1298 251
253 3300050489 nmdc:mga03683_92025_c1 nmdc:mga03683_92025_c1_346_1134 251
254 3300053077 Ga0495601_0233990 Ga0495601_0233990_349_1131 251
255 3300053094 Ga0500566_0069046 Ga0500566_0069046_369_1151 251
256 3300053096 Ga0500641_0027837 Ga0500641_0027837_1133_1921 251
257 3300053119 Ga0500595_035904 Ga0500595_035904_670_1452 251
258 3300053139 Ga0500568_0043749 Ga0500568_0043749_189_977 251
259 3300053147 Ga0500589_096302 Ga0500589_096302_61_849 251
260 3300053148 Ga0500590_101687 Ga0500590_101687_330_1112 251
261 iso_pu_bacteria 2508501128 2509146351 251
262 3300005843 Ga0068860_100000858 Ga0068860_10000085820 252
263 3300006038 Ga0075365_10033779 Ga0075365_100337792 252
264 3300006186 Ga0075369_10038354 Ga0075369_100383543 252
265 3300009545 Ga0105237_10006999 Ga0105237_100069997 252
266 3300025914 Ga0207671_10035801 Ga0207671_100358012 252
267 3300028381 Ga0268264_10000051 Ga0268264_10000051179 252
268 3300033442 Ga0315911_1000005 Ga0315911_1000005190 252
269 3300046675 Ga0495657_0079265 Ga0495657_0079265_560_1351 252
270 3300047472 Ga0495686_0071432 Ga0495686_0071432_1229_2008 252
271 3300048919 Ga0496116_0001246 Ga0496116_0001246_2578_3357 252
272 3300048920 Ga0496117_0013506 Ga0496117_0013506_2893_3672 252
273 3300048921 Ga0496118_0117338 Ga0496118_0117338_694_1473 252
274 3300048925 Ga0496122_0016327 Ga0496122_0016327_2060_2839 252
275 3300048926 Ga0496123_0034258 Ga0496123_0034258_1119_1898 252
276 3300048928 Ga0496125_0010362 Ga0496125_0010362_3964_4743 252
277 3300050494 nmdc:mga06z11_12993_c1 nmdc:mga06z11_12993_c1_645_1424 252
278 3300050516 nmdc:mga0sz30_1095_c3 nmdc:mga0sz30_1095_c3_751_1530 252
279 3300053094 Ga0500566_0000244 Ga0500566_0000244_6741_7523 252
280 3300053095 Ga0500640_002409 Ga0500640_002409_3459_4241 252
281 3300053111 Ga0500572_001039 Ga0500572_001039_2696_3478 252
282 3300053123 Ga0500614_000443 Ga0500614_000443_6350_7132 252
283 3300053136 Ga0500559_0004499 Ga0500559_0004499_2458_3240 252
284 3300053150 Ga0500603_000673 Ga0500603_000673_57_839 252
285 3300053159 Ga0500630_001162 Ga0500630_001162_8305_9087 252
286 3300053162 Ga0500638_010257 Ga0500638_010257_166_948 252
287 3300053163 Ga0500639_000012 Ga0500639_000012_5438_6220 252
288 3300053737 Ga0500601_004120 Ga0500601_004120_157_939 252
289 iso_pu_bacteria 2585427590 2585824056 252
290 3300005329 Ga0070683_100042686 Ga0070683_1000426866 253
291 3300005535 Ga0070684_100003258 Ga0070684_10000325812 253
292 3300006178 Ga0075367_10078884 Ga0075367_100788842 253
293 3300009093 Ga0105240_10133881 Ga0105240_101338811 253
294 3300013105 Ga0157369_10102904 Ga0157369_101029044 253
295 3300013307 Ga0157372_10390416 Ga0157372_103904162 253
296 3300025944 Ga0207661_10000959 Ga0207661_1000095914 253
297 3300035171 Ga0373946_0076373 Ga0373946_0076373_296_1081 253
298 3300046462 Ga0495651_0052130 Ga0495651_0052130_2060_2851 253
299 3300046476 Ga0495662_0001630 Ga0495662_0001630_6671_7462 253
300 3300050494 nmdc:mga06z11_47463_c1 nmdc:mga06z11_47463_c1_993_1775 253
301 3300005336 Ga0070680_100516187 Ga0070680_1005161871 254
302 iso_pu_bacteria 2582581867 2585403234 254
303 3300005436 Ga0070713_100247749 Ga0070713_1002477492 255
304 3300025928 Ga0207700_10306910 Ga0207700_103069102 255
305 3300031711 Ga0265314_10006028 Ga0265314_100060288 255
306 3300031712 Ga0265342_10035731 Ga0265342_100357315 255
307 3300037853 Ga0436364_0699776 Ga0436364_0699776_1840_2625 255
308 3300048927 Ga0496124_0206905 Ga0496124_0206905_257_1024 255
309 3300048929 Ga0496126_0035587 Ga0496126_0035587_841_1608 255
310 iso_pu_bacteria 2513237096 2513660634 255
311 iso_pu_bacteria 2513237145 2513922427 255
312 iso_pu_bacteria 2602042107 2603862374 255
313 iso_pu_bacteria 2643221599 2644004965 255
314 iso_pu_bacteria 2791355267 2793366170 255
315 iso_pu_bacteria 2857524615 2857525736 255
316 iso_pu_bacteria 2893066018 2893071816 255
317 iso_pu_bacteria 2919073203 2919074400 255
318 iso_pu_bacteria 3004334049 3004334960 255
319 iso_pu_bacteria 8018127388 8018128574 255
320 iso_pu_bacteria 8018150411 8018152506 255
321 3300003215 JGI25153J46596_10014855 JGI25153J46596_100148551 256
322 3300003911 JGI25405J52794_10011833 JGI25405J52794_100118332 256
323 3300005937 Ga0081455_10003156 Ga0081455_1000315611 256
324 3300025297 Ga0209758_1005049 Ga0209758_10050498 256
325 3300046455 Ga0495603_0016899 Ga0495603_0016899_2953_3741 256
326 3300046477 Ga0495664_0042959 Ga0495664_0042959_729_1514 256
327 3300046515 Ga0495620_0020979 Ga0495620_0020979_739_1527 256
328 3300046519 Ga0495632_0093296 Ga0495632_0093296_29_799 256
329 3300046522 Ga0495643_0001099 Ga0495643_0001099_2469_3239 256
330 3300046543 Ga0495645_0017494 Ga0495645_0017494_3806_4591 256
331 3300046660 Ga0495625_0029631 Ga0495625_0029631_3194_3964 256
332 3300046694 Ga0495649_0024040 Ga0495649_0024040_388_1158 256
333 3300047323 Ga0495683_0053092 Ga0495683_0053092_281_1051 256
334 3300047472 Ga0495686_0169747 Ga0495686_0169747_110_898 256
335 3300047472 Ga0495686_0227773 Ga0495686_0227773_259_1029 256
336 3300049459 Ga0495678_037365 Ga0495678_037365_23_793 256
337 3300053077 Ga0495601_0046485 Ga0495601_0046485_1457_2242 256
338 iso_pu_bacteria 2517572143 2517889802 256
339 iso_pu_bacteria 2643221579 2643906822 256
340 iso_pu_bacteria 2667528175 2671119649 256
341 iso_pu_bacteria 2728368998 2728748322 256
342 iso_pu_bacteria 2791355197 2793070198 256
343 iso_pu_bacteria 2882456835 2882460156 256
344 iso_pu_bacteria 2885374607 2885375449 256
345 iso_pu_bacteria 2906610324 2906612470 256
346 iso_pu_bacteria 2908739725 2908745739 256
347 iso_pu_bacteria 2922425934 2922433025 256
348 iso_pu_bacteria 2935630451 2935632985 256
349 iso_pu_bacteria 2941507105 2941509713 256
350 iso_pu_bacteria 2941515067 2941517542 256
351 iso_pu_bacteria 2941523033 2941526505 256
352 iso_pu_bacteria 3005474847 3005476003 256
353 iso_pu_bacteria 8019555841 8019561318 256
354 iso_pu_bacteria 8019565922 8019571401 256
355 3300005434 Ga0070709_10003090 Ga0070709_100030902 257
356 3300005435 Ga0070714_100145279 Ga0070714_1001452792 257
357 3300005436 Ga0070713_100126117 Ga0070713_1001261173 257
358 3300005437 Ga0070710_10000552 Ga0070710_100005524 257
359 3300005439 Ga0070711_100062871 Ga0070711_1000628711 257
360 3300025898 Ga0207692_10001302 Ga0207692_100013022 257
361 3300025906 Ga0207699_10045183 Ga0207699_100451833 257
362 3300025916 Ga0207663_10017392 Ga0207663_100173923 257
363 3300025928 Ga0207700_10067007 Ga0207700_100670072 257
364 3300025929 Ga0207664_10083898 Ga0207664_100838984 257
365 3300025939 Ga0207665_10014858 Ga0207665_100148585 257
366 iso_pu_bacteria 2891088606 2891092513 257
367 3300005435 Ga0070714_100111985 Ga0070714_1001119853 258
368 3300013105 Ga0157369_10533430 Ga0157369_105334301 258
369 3300025898 Ga0207692_10244897 Ga0207692_102448972 258
370 3300025928 Ga0207700_10178628 Ga0207700_101786282 258
371 3300041441 Ga0451787_672321 Ga0451787_672321_68_877 258
372 3300048929 Ga0496126_0059836 Ga0496126_0059836_21_797 258
373 iso_pu_bacteria 2513237101 2513694580 258
374 iso_pu_bacteria 2738541317 2738944704 258
375 iso_pu_bacteria 2775507266 2778174708 258
376 iso_pu_bacteria 2791355199 2793078765 258
377 iso_pu_bacteria 2842509118 2842514412 258
378 iso_pu_bacteria 2852387548 2852395344 258
379 iso_pu_bacteria 2874604998 2874608912 258
380 iso_pu_bacteria 2879110137 2879112372 258
381 iso_pu_bacteria 2889033259 2889034385 258
382 iso_pu_bacteria 2913308742 2913309325 258
383 iso_pu_bacteria 2922361189 2922364835 258
384 iso_pu_bacteria 2922386360 2922391702 258
385 iso_pu_bacteria 2989771324 2989775565 258
386 iso_pu_bacteria 8006964411 8006965272 258
387 iso_pu_bacteria 8006984368 8006991604 258
388 iso_pu_bacteria 8006994254 8006995425 258
389 iso_pu_bacteria 8046767195 8046774320 258
390 iso_pu_bacteria 8057575449 8057579275 258
391 3300005336 Ga0070680_100024909 Ga0070680_1000249092 259
392 3300005336 Ga0070680_100133796 Ga0070680_1001337962 259
393 3300005339 Ga0070660_100089416 Ga0070660_1000894162 259
394 3300005458 Ga0070681_10037527 Ga0070681_100375276 259
395 3300005530 Ga0070679_100034291 Ga0070679_1000342912 259
396 3300005539 Ga0068853_100039832 Ga0068853_1000398324 259
397 3300005563 Ga0068855_100015587 Ga0068855_1000155877 259
398 3300005563 Ga0068855_100055139 Ga0068855_1000551392 259
399 3300005577 Ga0068857_100191246 Ga0068857_1001912462 259
400 3300005618 Ga0068864_100348669 Ga0068864_1003486691 259
401 3300007788 Ga0099795_10005299 Ga0099795_100052995 259
402 3300009177 Ga0105248_10487473 Ga0105248_104874732 259
403 3300010159 Ga0099796_10001766 Ga0099796_100017666 259
404 3300010375 Ga0105239_10714585 Ga0105239_107145851 259
405 3300013297 Ga0157378_10002449 Ga0157378_100024499 259
406 3300013297 Ga0157378_10146176 Ga0157378_101461761 259
407 3300025254 Ga0209148_1000037 Ga0209148_1000037188 259
408 3300025272 Ga0209455_1000036 Ga0209455_1000036165 259
409 3300025295 Ga0209564_1000687 Ga0209564_100068747 259
410 3300025912 Ga0207707_10103376 Ga0207707_101033762 259
411 3300025913 Ga0207695_10043272 Ga0207695_100432722 259
412 3300025917 Ga0207660_10058742 Ga0207660_100587422 259
413 3300025917 Ga0207660_10087395 Ga0207660_100873953 259
414 3300025919 Ga0207657_10008393 Ga0207657_100083937 259
415 3300025921 Ga0207652_10047083 Ga0207652_100470835 259
416 3300025921 Ga0207652_10201228 Ga0207652_102012282 259
417 3300025949 Ga0207667_10044714 Ga0207667_100447146 259
418 3300026041 Ga0207639_10118793 Ga0207639_101187932 259
419 3300031616 Ga0307508_10014562 Ga0307508_100145627 259
420 3300037418 Ga0395900_0499688 Ga0395900_0499688_252_1031 259
421 3300039437 Ga0436365_0372041 Ga0436365_0372041_1468_2250 259
422 3300046524 Ga0495648_0005796 Ga0495648_0005796_2660_3439 259
423 3300046809 Ga0495600_0342650 Ga0495600_0342650_67_846 259
424 3300048907 Ga0496104_0730355 Ga0496104_0730355_95_877 259
425 3300048915 Ga0496112_0000137 Ga0496112_0000137_25353_26135 259
426 3300048924 Ga0496121_0067401 Ga0496121_0067401_1396_2241 259
427 3300048924 Ga0496121_0291390 Ga0496121_0291390_152_934 259
428 3300048929 Ga0496126_0285067 Ga0496126_0285067_78_860 259
429 3300049568 Ga0501031_0152499 Ga0501031_0152499_53_874 259
430 3300049570 Ga0501033_0005716 Ga0501033_0005716_8860_9681 259
431 3300049571 Ga0501034_0173443 Ga0501034_0173443_820_1641 259
432 3300049580 Ga0501046_0062849 Ga0501046_0062849_1295_2116 259
433 3300049581 Ga0501047_0167254 Ga0501047_0167254_233_1015 259
434 3300049583 Ga0501067_0115062 Ga0501067_0115062_651_1472 259
435 3300049585 Ga0501069_0037341 Ga0501069_0037341_163_984 259
436 3300049586 Ga0501070_0249142 Ga0501070_0249142_620_1405 259
437 3300049587 Ga0501071_0209641 Ga0501071_0209641_260_1081 259
438 3300049589 Ga0501073_0002257 Ga0501073_0002257_5572_6357 259
439 3300049589 Ga0501073_0011678 Ga0501073_0011678_4588_5373 259
440 3300049590 Ga0501074_0128801 Ga0501074_0128801_1016_1798 259
441 3300049741 Ga0501079_0130759 Ga0501079_0130759_32_817 259
442 3300049742 Ga0501080_0152396 Ga0501080_0152396_415_1197 259
443 3300053094 Ga0500566_0002949 Ga0500566_0002949_9057_9839 259
444 3300053106 Ga0500558_062917 Ga0500558_062917_669_1451 259
445 3300053119 Ga0500595_000580 Ga0500595_000580_9688_10470 259
446 3300053125 Ga0500618_023794 Ga0500618_023794_23_862 259
447 3300053162 Ga0500638_016392 Ga0500638_016392_1382_2164 259
448 3300053162 Ga0500638_042327 Ga0500638_042327_474_1256 259
449 3300053178 Ga0500637_0000303 Ga0500637_0000303_11266_12048 259
450 3300053735 Ga0500596_006582 Ga0500596_006582_326_1108 259
451 3300055283 Ga0500661_001086 Ga0500661_001086_2168_2950 259
452 iso_pu_bacteria 8006933436 8006937311 259
453 iso_pu_bacteria 8006973647 8006977343 259
454 3300031344 Ga0265316_10286909 Ga0265316_102869092 260
455 3300003203 JGI25406J46586_10006811 JGI25406J46586_100068114 261
456 3300003323 rootH1_10168036 rootH1_101680362 261
457 3300003659 JGI25404J52841_10012836 JGI25404J52841_100128362 261
458 3300005436 Ga0070713_100138135 Ga0070713_1001381352 261
459 3300005456 Ga0070678_100158147 Ga0070678_1001581473 261
460 3300005578 Ga0068854_100018315 Ga0068854_1000183155 261
461 3300005614 Ga0068856_100000226 Ga0068856_10000022664 261
462 3300005937 Ga0081455_10006663 Ga0081455_1000666314 261
463 3300005983 Ga0081540_1003865 Ga0081540_10038659 261
464 3300005983 Ga0081540_1012706 Ga0081540_10127066 261
465 3300005983 Ga0081540_1015207 Ga0081540_10152077 261
466 3300005983 Ga0081540_1038308 Ga0081540_10383085 261
467 3300005985 Ga0081539_10000729 Ga0081539_1000072949 261
468 3300005985 Ga0081539_10105118 Ga0081539_101051181 261
469 3300006042 Ga0075368_10067264 Ga0075368_100672642 261
470 3300009093 Ga0105240_10131327 Ga0105240_101313275 261
471 3300009551 Ga0105238_10063133 Ga0105238_100631331 261
472 3300013104 Ga0157370_10177782 Ga0157370_101777822 261
473 3300013105 Ga0157369_10017488 Ga0157369_100174886 261
474 3300014325 Ga0163163_10418720 Ga0163163_104187202 261
475 3300021388 Ga0213875_10053389 Ga0213875_100533892 261
476 3300025906 Ga0207699_10054158 Ga0207699_100541582 261
477 3300025914 Ga0207671_10069327 Ga0207671_100693272 261
478 3300025926 Ga0207659_10648911 Ga0207659_106489111 261
479 3300025928 Ga0207700_10104751 Ga0207700_101047512 261
480 3300025928 Ga0207700_10170217 Ga0207700_101702172 261
481 3300025929 Ga0207664_10106409 Ga0207664_101064092 261
482 3300025937 Ga0207669_10309118 Ga0207669_103091181 261
483 3300025944 Ga0207661_10131837 Ga0207661_101318373 261
484 3300026078 Ga0207702_10000191 Ga0207702_1000019113 261
485 3300026116 Ga0207674_10055839 Ga0207674_100558394 261
486 3300028800 Ga0265338_10013087 Ga0265338_1001308713 261
487 3300031241 Ga0265325_10014373 Ga0265325_100143732 261
488 3300031249 Ga0265339_10000047 Ga0265339_100000473 261
489 3300031595 Ga0265313_10000992 Ga0265313_1000099223 261
490 3300031712 Ga0265342_10040613 Ga0265342_100406134 261
491 3300037418 Ga0395900_0265761 Ga0395900_0265761_736_1521 261
492 3300037466 Ga0395898_0004875 Ga0395898_0004875_5566_6351 261
493 3300037853 Ga0436364_0482403 Ga0436364_0482403_494_1282 261
494 3300039437 Ga0436365_1925389 Ga0436365_1925389_90_878 261
495 3300044694 Ga0466963_0285305 Ga0466963_0285305_258_1043 261
496 3300044719 Ga0466971_0019749 Ga0466971_0019749_121_906 261
497 3300044735 Ga0466968_0086115 Ga0466968_0086115_66_851 261
498 3300044842 Ga0466957_0149230 Ga0466957_0149230_360_1145 261
499 3300045049 Ga0466959_0080951 Ga0466959_0080951_976_1761 261
500 3300046475 Ga0495639_0051655 Ga0495639_0051655_134_922 261
501 3300046616 Ga0495668_0082045 Ga0495668_0082045_684_1472 261
502 3300046684 Ga0495669_0225628 Ga0495669_0225628_64_852 261
503 3300046794 Ga0495589_0130857 Ga0495589_0130857_345_1133 261
504 3300046809 Ga0495600_0062169 Ga0495600_0062169_1187_1978 261
505 3300048907 Ga0496104_0464738 Ga0496104_0464738_118_906 261
506 3300048929 Ga0496126_0015704 Ga0496126_0015704_5586_6371 261
507 3300049583 Ga0501067_0042258 Ga0501067_0042258_1396_2298 261
508 3300050492 nmdc:mga0yw44_237366_c1 nmdc:mga0yw44_237366_c1_16_804 261
509 3300053148 Ga0500590_001257 Ga0500590_001257_818_1609 261
510 3300001989 JGI24739J22299_10020481 JGI24739J22299_100204813 262
511 3300053150 Ga0500603_000194 Ga0500603_000194_3020_3808 262
512 3300053178 Ga0500637_0003301 Ga0500637_0003301_4854_5642 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

11

242

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5308 6 256
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5292 6 255
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5212 6 255
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5133 6 256
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.4429 1 252
ID Description Score Start End Superfamily
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4967 1 254 1.20.1250.20
af_K7KKQ1_1_284_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4891 4 252 1.20.1250.20
af_Q9Y5Y0_102_514_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4719 3 251 1.20.1250.20
af_F1R0H0_3_336_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4678 2 257 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4648 1 254 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A348FZT1-F1-model_v4 Probable membrane transporter protein 0.9871 2 258 GO:0005886
AF-A0A059FJF6-F1-model_v4 Probable membrane transporter protein 0.9842 5 260 GO:0005886
AF-A0A259LNW5-F1-model_v4 Probable membrane transporter protein 0.9841 5 221 GO:0005886
AF-F7QGW6-F1-model_v4 Probable membrane transporter protein 0.9838 1 256 GO:0005886
AF-A0A4Y3U0P3-F1-model_v4 Probable membrane transporter protein 0.9832 3 256 GO:0005886

Feature Viewer

pLDDT pTM Quality
89.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map