metagRoot

F457022

General Info

Members	Datasets	Scaffolds	Average Seq Length
509	176	494	270

Family's Representative Sequence

Representative Sequence	3300044706\|Ga0466964_0010047\|Ga0466964_0010047_84_1010
Length	308
Sequence	LACARDAAPALANGTGTLLALRHVGCPRVRFPFPFQRQQMTKPFKRILFTGAAGNLGRRLRERLHEFADIVRLSDVADFGPAAPHEEIVLCDLGDRDAVMRMCEGVDAILHFGGISTEEEWAPIMQANILGMVNLYEAVHKLGIRRVVFASTNHTMGMYRTTDLVDATMPPRADGYYGVSKVFGETLSRYYWDRFGVETVCIRIGYCWPEATNYRQMVTWLSLDDLVQLLHRSLTTPRVGHTITFGISNNEGRWWDDRHASFLRYKPKDSSQQFADKLPQEVQYPPADDITTLYQGGVFLHNGPKYRP

Samples

	Sample ID	Description	Type	Environment
1	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
2	2524614857	Deinococcus ficus DSM 19119	Isolate	Rhizosphere
3	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
4	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
5	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
6	2643221556	Massilia sp. Root1485	Isolate	Unclassified
7	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
8	2643221684	Massilia sp. Root133	Isolate	Unclassified
9	2739367875	Deinococcus ficus CC-FR2-10	Isolate	Unclassified
10	2808606418	Herbaspirillum sp. SJZ107	Isolate	Rhizosphere
11	2818991435	Caulobacter henricii 536	Isolate	Unclassified
12	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
13	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
14	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
15	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
16	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
17	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
18	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
19	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
20	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
21	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
22	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
23	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
26	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
27	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
28	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
29	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
30	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
31	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
32	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
33	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
34	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
35	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
36	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
37	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
38	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
39	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
40	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
41	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
42	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
43	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
44	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
45	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
46	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
47	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
48	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
49	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
50	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
51	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
52	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
53	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
54	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
55	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
56	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
57	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
58	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
59	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
60	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
61	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
62	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
63	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
64	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
65	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
66	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
67	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
68	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
69	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
70	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
71	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
72	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
73	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
74	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
75	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
76	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
77	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
78	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
79	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
80	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
81	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
82	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
83	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
84	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
85	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
86	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
87	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
88	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
89	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
90	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
91	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
92	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
93	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
94	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
95	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
96	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
97	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
98	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
99	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
100	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
101	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
102	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
103	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
104	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
105	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
106	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
107	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
108	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
109	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
110	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
111	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
112	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
113	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
114	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
115	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
116	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
117	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
118	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
119	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
120	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
121	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
122	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
123	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
124	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
125	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
126	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
127	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
128	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
129	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
130	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
131	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
132	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
133	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
134	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
135	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
136	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
137	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
138	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
139	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
140	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
141	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
142	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
143	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
144	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
145	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
146	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
147	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
148	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
149	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
150	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
151	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
152	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
153	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
154	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
155	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
156	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
157	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
158	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
159	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
160	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
161	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
162	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
163	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
164	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
165	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
166	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
167	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
168	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
169	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
170	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
171	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
172	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
173	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
174	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
175	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
176	8047673197	Telluria mixta LMG 11547	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.05
Metatranscriptomes	0
Isolates	2.95

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.06
Nodule	0
Rhizoplane	2.36
Rhizosphere	84.87
Stem	0
Stem Tuber	0
Unclassified	4.72

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10015451	3300003215	Bacteria	3109
2	JGI25153J46596_10018536	3300003215	Bacteria	2700
3	rootL2_10081169	3300003322	Bacteria	8451
4	rootL2_10172962	3300003322	Bacteria	1423
5	rootL2_10187558	3300003322	Bacteria	5041
6	rootH1_10067297	3300003316	Bacteria	2390
7	rootH1_10067297	3300003323	Bacteria	4355
8	Ga0055525_1000136	3300003759	Bacteria	107751
9	Ga0055542_1013704	3300003762	Bacteria	1355
10	Ga0055526_1024879	3300003771	Bacteria	1940
11	Ga0055537_1001482	3300003773	Bacteria	9089
12	Ga0055531_10001617	3300003794	Bacteria	16338
13	Ga0065165_1001371	3300005262	Bacteria	26814
14	Ga0065165_1003249	3300005262	Bacteria	11770
15	Ga0070661_100055359	3300005344	Bacteria	2905
16	Ga0070659_100063613	3300005366	Bacteria	2919
17	Ga0070662_100220361	3300005457	Bacteria	1513
18	Ga0070664_100065647	3300005564	Bacteria	3097
19	Ga0068865_100119380	3300006881	Bacteria	1958
20	Ga0105240_10878175	3300009093	Bacteria	966
21	Ga0105243_10012137	3300009148	Bacteria	6514
22	Ga0105241_10018659	3300009174	Bacteria	5107
23	Ga0105242_10223515	3300009176	Bacteria	1684
24	Ga0105237_10519012	3300009545	Bacteria	1198
25	Ga0105238_10076080	3300009551	Bacteria	3348
26	Ga0157373_10148580	3300013100	Bacteria	1649
27	Ga0209563_100003	3300025230	Bacteria	1932942
28	Ga0209148_1000539	3300025254	Bacteria	36518
29	Ga0209565_1000466	3300025263	Bacteria	30502
30	Ga0209673_1001434	3300025273	Bacteria	22721
31	Ga0209675_1007505	3300025291	Bacteria	4170
32	Ga0209564_1001798	3300025295	Bacteria	19790
33	Ga0209758_1003486	3300025297	Bacteria	14246
34	Ga0209758_1005270	3300025297	Bacteria	10109
35	Ga0209256_1000666	3300025299	Bacteria	46480
36	Ga0209256_1027238	3300025299	Bacteria	1632
37	Ga0209257_1000373	3300025304	Bacteria	90001
38	Ga0207705_10001946	3300025909	Bacteria	16143
39	Ga0207705_10221489	3300025909	Bacteria	1437
40	Ga0207671_10395899	3300025914	Bacteria	1098
41	Ga0207649_10014955	3300025920	Bacteria	4355
42	Ga0207690_10020476	3300025932	Bacteria	4088
43	Ga0207667_10029588	3300025949	Bacteria	5938
44	Ga0307515_10037737	3300028794	Bacteria	7754
45	Ga0307515_10163547	3300028794	Bacteria	2256
46	Ga0265314_10009617	3300031711	Bacteria	8143
47	Ga0395899_0001277	3300037312	Bacteria	21884
48	Ga0395899_0005625	3300037312	Bacteria	9726
49	Ga0395899_0010780	3300037312	Bacteria	7005
50	Ga0395900_0000426	3300037418	Bacteria	60657
51	Ga0395900_0000525	3300037418	Bacteria	54176
52	Ga0395900_0032131	3300037418	Bacteria	5395
53	Ga0395900_0393425	3300037418	Bacteria	1351
54	Ga0395898_0003022	3300037466	Bacteria	19075
55	Ga0395898_0451953	3300037466	Bacteria	1223
56	Ga0395905_0014260	3300037471	Bacteria	7591
57	Ga0395905_0030065	3300037471	Bacteria	5120
58	Ga0395901_0000159	3300038443	Bacteria	87998
59	Ga0395901_0002917	3300038443	Bacteria	17262
60	Ga0436361_1027308	3300039447	Bacteria	1816
61	Ga0439435_0007514	3300042436	Bacteria	2496
62	Ga0466965_0009814	3300044683	Bacteria	4453
63	Ga0466965_0054126	3300044683	Bacteria	1995
64	Ga0466966_0029410	3300044684	Bacteria	3575
65	Ga0466966_0042849	3300044684	Bacteria	2903
66	Ga0466966_0060911	3300044684	Bacteria	2381
67	Ga0466964_0000040	3300044706	Bacteria	26586
68	Ga0466964_0010047	3300044706	Bacteria	3565
69	Ga0466964_0035617	3300044706	Bacteria	1991
70	Ga0466968_0000719	3300044735	Bacteria	11450
71	Ga0466970_0036799	3300044765	Bacteria	2594
72	Ga0466957_0007135	3300044842	Bacteria	6318
73	Ga0466957_0089374	3300044842	Bacteria	1928
74	Ga0466959_0056325	3300045049	Bacteria	2868
75	Ga0466959_0089505	3300045049	Bacteria	2211
76	Ga0466959_0100751	3300045049	Bacteria	2067
77	Ga0466959_0156765	3300045049	Bacteria	1602
78	Ga0466958_0080933	3300045836	Bacteria	1998
79	Ga0466967_0005003	3300045976	Bacteria	9079
80	Ga0466967_0012572	3300045976	Bacteria	6485
81	Ga0466967_0080691	3300045976	Bacteria	2936
82	Ga0495627_000185	3300046453	Bacteria	69533
83	Ga0495590_0000070	3300046457	Bacteria	71704
84	Ga0495590_0002810	3300046457	Bacteria	7190
85	Ga0495590_0015196	3300046457	Bacteria	2799
86	Ga0495591_000534	3300046458	Bacteria	29481
87	Ga0495591_012900	3300046458	Bacteria	3086
88	Ga0495638_0000055	3300046460	Bacteria	196038
89	Ga0495638_0001598	3300046460	Bacteria	20236
90	Ga0495638_0002910	3300046460	Bacteria	13682
91	Ga0495638_0014535	3300046460	Bacteria	5315
92	Ga0495638_0016677	3300046460	Bacteria	4915
93	Ga0495650_0000017	3300046471	Bacteria	542552
94	Ga0495650_0000085	3300046471	Bacteria	235655
95	Ga0495650_0000307	3300046471	Bacteria	88863
96	Ga0495650_0006327	3300046471	Bacteria	7403
97	Ga0495580_0090017	3300046472	Bacteria	2136
98	Ga0495582_0016873	3300046473	Bacteria	3998
99	Ga0495605_0000104	3300046474	Bacteria	105745
100	Ga0495605_0007836	3300046474	Bacteria	6050
101	Ga0495605_0028264	3300046474	Bacteria	2896
102	Ga0495605_0035168	3300046474	Bacteria	2533
103	Ga0495605_0038111	3300046474	Bacteria	2413
104	Ga0495605_0067496	3300046474	Bacteria	1696
105	Ga0495605_0119363	3300046474	Bacteria	1196
106	Ga0495584_0000313	3300046491	Bacteria	33905
107	Ga0495584_0000706	3300046491	Bacteria	21998
108	Ga0495584_0005434	3300046491	Bacteria	6751
109	Ga0495584_0019875	3300046491	Bacteria	3412
110	Ga0495584_0079584	3300046491	Bacteria	1648
111	Ga0495585_0000006	3300046492	Bacteria	320556
112	Ga0495585_0001803	3300046492	Bacteria	16276
113	Ga0495585_0009290	3300046492	Bacteria	5907
114	Ga0495585_0039500	3300046492	Bacteria	2652
115	Ga0495585_0058739	3300046492	Bacteria	2121
116	Ga0495585_0108867	3300046492	Bacteria	1475
117	Ga0495594_0026070	3300046499	Bacteria	3143
118	Ga0495594_0138546	3300046499	Bacteria	1379
119	Ga0495596_0000015	3300046500	Bacteria	121879
120	Ga0495596_0000329	3300046500	Bacteria	30887
121	Ga0495596_0000456	3300046500	Bacteria	26005
122	Ga0495596_0000517	3300046500	Bacteria	24429
123	Ga0495596_0000759	3300046500	Bacteria	19703
124	Ga0495596_0002170	3300046500	Bacteria	10698
125	Ga0495596_0002488	3300046500	Bacteria	9880
126	Ga0495596_0007778	3300046500	Bacteria	4810
127	Ga0495596_0008018	3300046500	Bacteria	4722
128	Ga0495596_0011549	3300046500	Bacteria	3803
129	Ga0495596_0013809	3300046500	Bacteria	3415
130	Ga0495596_0017112	3300046500	Bacteria	3005
131	Ga0495596_0029597	3300046500	Bacteria	2194
132	Ga0495607_0000407	3300046501	Bacteria	43562
133	Ga0495607_0001482	3300046501	Bacteria	20850
134	Ga0495607_0003076	3300046501	Bacteria	12972
135	Ga0495607_0003818	3300046501	Bacteria	11364
136	Ga0495607_0005181	3300046501	Bacteria	9397
137	Ga0495607_0011387	3300046501	Bacteria	5923
138	Ga0495607_0038720	3300046501	Bacteria	2854
139	Ga0495607_0045120	3300046501	Bacteria	2595
140	Ga0495607_0066137	3300046501	Bacteria	2035
141	Ga0495607_0110713	3300046501	Bacteria	1456
142	Ga0495607_0163208	3300046501	Bacteria	1130
143	Ga0495583_0000029	3300046506	Bacteria	255536
144	Ga0495583_0000195	3300046506	Bacteria	101598
145	Ga0495583_0000367	3300046506	Bacteria	70310
146	Ga0495583_0000685	3300046506	Bacteria	43784
147	Ga0495583_0002255	3300046506	Bacteria	16943
148	Ga0495583_0004871	3300046506	Bacteria	9370
149	Ga0495583_0007593	3300046506	Bacteria	6776
150	Ga0495583_0008801	3300046506	Bacteria	6118
151	Ga0495583_0011884	3300046506	Bacteria	4969
152	Ga0495583_0022816	3300046506	Bacteria	3182
153	Ga0495583_0030849	3300046506	Bacteria	2605
154	Ga0495583_0034106	3300046506	Bacteria	2441
155	Ga0495606_0001189	3300046507	Bacteria	36713
156	Ga0495606_0002394	3300046507	Bacteria	21959
157	Ga0495606_0004595	3300046507	Bacteria	13684
158	Ga0495606_0034916	3300046507	Bacteria	3444
159	Ga0495606_0034976	3300046507	Bacteria	3440
160	Ga0495606_0086676	3300046507	Bacteria	1934
161	Ga0495610_0000176	3300046512	Bacteria	71110
162	Ga0495610_0000274	3300046512	Bacteria	53842
163	Ga0495610_0004833	3300046512	Bacteria	9825
164	Ga0495610_0052973	3300046512	Bacteria	1968
165	Ga0495616_0000020	3300046513	Bacteria	162840
166	Ga0495616_0000319	3300046513	Bacteria	38478
167	Ga0495616_0009127	3300046513	Bacteria	5817
168	Ga0495616_0011138	3300046513	Bacteria	5163
169	Ga0495616_0013134	3300046513	Bacteria	4682
170	Ga0495616_0013520	3300046513	Bacteria	4601
171	Ga0495616_0013793	3300046513	Bacteria	4546
172	Ga0495616_0022412	3300046513	Bacteria	3411
173	Ga0495616_0034149	3300046513	Bacteria	2644
174	Ga0495616_0092643	3300046513	Bacteria	1428
175	Ga0495616_0100255	3300046513	Bacteria	1359
176	Ga0495620_0069351	3300046515	Bacteria	1446
177	Ga0495630_0017856	3300046517	Bacteria	5203
178	Ga0495631_0001188	3300046518	Bacteria	16063
179	Ga0495631_0002524	3300046518	Bacteria	10282
180	Ga0495631_0005372	3300046518	Bacteria	6715
181	Ga0495631_0012633	3300046518	Bacteria	4119
182	Ga0495631_0021512	3300046518	Bacteria	3003
183	Ga0495631_0036782	3300046518	Bacteria	2184
184	Ga0495631_0066256	3300046518	Bacteria	1562
185	Ga0495632_0000028	3300046519	Bacteria	171089
186	Ga0495632_0000029	3300046519	Bacteria	171022
187	Ga0495632_0000090	3300046519	Bacteria	93838
188	Ga0495632_0000107	3300046519	Bacteria	85396
189	Ga0495632_0000176	3300046519	Bacteria	65711
190	Ga0495632_0033954	3300046519	Bacteria	2615
191	Ga0495632_0046007	3300046519	Bacteria	2170
192	Ga0495632_0054064	3300046519	Bacteria	1969
193	Ga0495632_0072345	3300046519	Bacteria	1654
194	Ga0495637_0000286	3300046520	Bacteria	39443
195	Ga0495637_0013697	3300046520	Bacteria	3844
196	Ga0495637_0027385	3300046520	Bacteria	2551
197	Ga0495637_0048283	3300046520	Bacteria	1793
198	Ga0495637_0077414	3300046520	Bacteria	1331
199	Ga0495643_0002332	3300046522	Bacteria	15245
200	Ga0495643_0010350	3300046522	Bacteria	5743
201	Ga0495643_0012897	3300046522	Bacteria	5026
202	Ga0495643_0028872	3300046522	Bacteria	3106
203	Ga0495643_0095764	3300046522	Bacteria	1527
204	Ga0495644_0000778	3300046523	Bacteria	13126
205	Ga0495644_0006706	3300046523	Bacteria	4457
206	Ga0495644_0014763	3300046523	Bacteria	2991
207	Ga0495644_0039837	3300046523	Bacteria	1771
208	Ga0495644_0044359	3300046523	Bacteria	1672
209	Ga0495648_0000029	3300046524	Bacteria	223499
210	Ga0495648_0001197	3300046524	Bacteria	25984
211	Ga0495648_0001570	3300046524	Bacteria	22297
212	Ga0495648_0004876	3300046524	Bacteria	11303
213	Ga0495648_0005951	3300046524	Bacteria	10039
214	Ga0495648_0006323	3300046524	Bacteria	9688
215	Ga0495648_0025097	3300046524	Bacteria	4042
216	Ga0495648_0036852	3300046524	Bacteria	3148
217	Ga0495648_0106201	3300046524	Bacteria	1538
218	Ga0495648_0114128	3300046524	Bacteria	1464
219	Ga0495648_0118160	3300046524	Bacteria	1430
220	Ga0495648_0121897	3300046524	Bacteria	1400
221	Ga0495663_0007160	3300046525	Bacteria	3079
222	Ga0495663_0029823	3300046525	Bacteria	1613
223	Ga0495642_0000063	3300046528	Bacteria	64137
224	Ga0495642_0002702	3300046528	Bacteria	7127
225	Ga0495642_0002779	3300046528	Bacteria	7014
226	Ga0495642_0007364	3300046528	Bacteria	4221
227	Ga0495642_0016664	3300046528	Bacteria	2866
228	Ga0495642_0021724	3300046528	Bacteria	2525
229	Ga0495642_0094559	3300046528	Bacteria	1267
230	Ga0495652_0006812	3300046529	Bacteria	10591
231	Ga0495654_0000012	3300046530	Bacteria	328997
232	Ga0495654_0002538	3300046530	Bacteria	11728
233	Ga0495654_0006427	3300046530	Bacteria	6682
234	Ga0495654_0135275	3300046530	Bacteria	1103
235	Ga0495586_0016432	3300046535	Bacteria	3936
236	Ga0495587_0081062	3300046536	Bacteria	1880
237	Ga0495587_0151078	3300046536	Bacteria	1323
238	Ga0495609_0000095	3300046538	Bacteria	104807
239	Ga0495609_0001162	3300046538	Bacteria	18168
240	Ga0495609_0004032	3300046538	Bacteria	8187
241	Ga0495609_0007499	3300046538	Bacteria	5441
242	Ga0495609_0012307	3300046538	Bacteria	4058
243	Ga0495609_0013693	3300046538	Bacteria	3826
244	Ga0495609_0043519	3300046538	Bacteria	2016
245	Ga0495609_0047369	3300046538	Bacteria	1924
246	Ga0495609_0081667	3300046538	Bacteria	1412
247	Ga0495597_0000073	3300046542	Bacteria	87767
248	Ga0495597_0000108	3300046542	Bacteria	73202
249	Ga0495597_0000138	3300046542	Bacteria	65518
250	Ga0495597_0004741	3300046542	Bacteria	7365
251	Ga0495597_0017813	3300046542	Bacteria	3337
252	Ga0495597_0025785	3300046542	Bacteria	2705
253	Ga0495597_0031022	3300046542	Bacteria	2434
254	Ga0495622_0000675	3300046557	Bacteria	19349
255	Ga0495622_0049296	3300046557	Bacteria	1955
256	Ga0495633_0000970	3300046558	Bacteria	23545
257	Ga0495633_0018519	3300046558	Bacteria	3536
258	Ga0495633_0034833	3300046558	Bacteria	2419
259	Ga0495633_0038284	3300046558	Bacteria	2291
260	Ga0495656_0075492	3300046615	Bacteria	1508
261	Ga0495668_0000535	3300046616	Bacteria	47216
262	Ga0495668_0006504	3300046616	Bacteria	7644
263	Ga0495668_0024532	3300046616	Bacteria	3429
264	Ga0495668_0029793	3300046616	Bacteria	3083
265	Ga0495668_0044945	3300046616	Bacteria	2454
266	Ga0495668_0050363	3300046616	Bacteria	2308
267	Ga0495668_0054723	3300046616	Bacteria	2204
268	Ga0495668_0090717	3300046616	Bacteria	1674
269	Ga0495668_0163721	3300046616	Bacteria	1218
270	Ga0495634_0155554	3300046642	Bacteria	1443
271	Ga0495611_0000323	3300046648	Bacteria	31631
272	Ga0495611_0039656	3300046648	Bacteria	2097
273	Ga0495611_0085138	3300046648	Bacteria	1457
274	Ga0495625_0000011	3300046660	Bacteria	377120
275	Ga0495625_0000721	3300046660	Bacteria	46512
276	Ga0495625_0010962	3300046660	Bacteria	7440
277	Ga0495625_0017589	3300046660	Bacteria	5594
278	Ga0495625_0032818	3300046660	Bacteria	3845
279	Ga0495625_0042089	3300046660	Bacteria	3321
280	Ga0495625_0051902	3300046660	Bacteria	2937
281	Ga0495625_0116153	3300046660	Bacteria	1825
282	Ga0495625_0157223	3300046660	Bacteria	1525
283	Ga0495625_0162394	3300046660	Bacteria	1496
284	Ga0495625_0221131	3300046660	Bacteria	1241
285	Ga0495661_0000012	3300046665	Bacteria	276804
286	Ga0495661_0001832	3300046665	Bacteria	17023
287	Ga0495661_0008318	3300046665	Bacteria	7185
288	Ga0495661_0012567	3300046665	Bacteria	5715
289	Ga0495661_0023204	3300046665	Bacteria	4028
290	Ga0495661_0174519	3300046665	Bacteria	1143
291	Ga0495588_0000118	3300046674	Bacteria	134942
292	Ga0495588_0006728	3300046674	Bacteria	5195
293	Ga0495588_0007738	3300046674	Bacteria	4908
294	Ga0495588_0081825	3300046674	Bacteria	1686
295	Ga0495588_0133792	3300046674	Bacteria	1308
296	Ga0495623_0006937	3300046679	Bacteria	7363
297	Ga0495623_0235807	3300046679	Bacteria	1035
298	Ga0495669_0000546	3300046684	Bacteria	16837
299	Ga0495669_0001096	3300046684	Bacteria	11213
300	Ga0495669_0023605	3300046684	Bacteria	2678
301	Ga0495669_0069038	3300046684	Bacteria	1608
302	Ga0495669_0077885	3300046684	Bacteria	1518
303	Ga0495670_0000488	3300046691	Bacteria	18767
304	Ga0495670_0003844	3300046691	Bacteria	7378
305	Ga0495670_0021204	3300046691	Bacteria	3204
306	Ga0495670_0056564	3300046691	Bacteria	1968
307	Ga0495670_0064711	3300046691	Bacteria	1842
308	Ga0495670_0075189	3300046691	Bacteria	1714
309	Ga0495670_0144968	3300046691	Bacteria	1244
310	Ga0495671_0000547	3300046692	Bacteria	28201
311	Ga0495671_0002569	3300046692	Bacteria	11417
312	Ga0495671_0006779	3300046692	Bacteria	6585
313	Ga0495671_0010303	3300046692	Bacteria	5188
314	Ga0495671_0061897	3300046692	Bacteria	1845
315	Ga0495671_0110427	3300046692	Bacteria	1343
316	Ga0495649_0000093	3300046694	Bacteria	77036
317	Ga0495649_0007537	3300046694	Bacteria	6623
318	Ga0495649_0008030	3300046694	Bacteria	6375
319	Ga0495649_0018352	3300046694	Bacteria	3937
320	Ga0495649_0029482	3300046694	Bacteria	3034
321	Ga0495589_0000007	3300046794	Bacteria	276444
322	Ga0495589_0000082	3300046794	Bacteria	87068
323	Ga0495589_0003595	3300046794	Bacteria	8381
324	Ga0495589_0006830	3300046794	Bacteria	6001
325	Ga0495589_0013880	3300046794	Bacteria	4153
326	Ga0495589_0038144	3300046794	Bacteria	2406
327	Ga0495589_0042776	3300046794	Bacteria	2257
328	Ga0495589_0051889	3300046794	Bacteria	2026
329	Ga0495589_0101342	3300046794	Bacteria	1393
330	Ga0495589_0128756	3300046794	Bacteria	1216
331	Ga0495589_0185706	3300046794	Bacteria	985
332	Ga0495600_0187750	3300046809	Bacteria	1330
333	Ga0495660_0000297	3300046810	Bacteria	45575
334	Ga0495660_0005109	3300046810	Bacteria	7884
335	Ga0495660_0014411	3300046810	Bacteria	4575
336	Ga0495660_0014495	3300046810	Bacteria	4559
337	Ga0495660_0017183	3300046810	Bacteria	4166
338	Ga0495660_0018972	3300046810	Bacteria	3949
339	Ga0495660_0020034	3300046810	Bacteria	3836
340	Ga0495660_0022295	3300046810	Bacteria	3616
341	Ga0495660_0024810	3300046810	Bacteria	3413
342	Ga0495660_0028065	3300046810	Bacteria	3182
343	Ga0495660_0033040	3300046810	Bacteria	2903
344	Ga0495660_0057175	3300046810	Bacteria	2105
345	Ga0495581_0031425	3300047315	Bacteria	3077
346	Ga0495604_0195969	3300047317	Bacteria	1404
347	Ga0495672_0000217	3300047320	Bacteria	82349
348	Ga0495672_0000228	3300047320	Bacteria	80256
349	Ga0495672_0000665	3300047320	Bacteria	38253
350	Ga0495672_0000733	3300047320	Bacteria	36063
351	Ga0495672_0001502	3300047320	Bacteria	22882
352	Ga0495672_0003036	3300047320	Bacteria	14747
353	Ga0495672_0005175	3300047320	Bacteria	10414
354	Ga0495672_0009169	3300047320	Bacteria	7207
355	Ga0495672_0094847	3300047320	Bacteria	1630
356	Ga0495676_0357106	3300047321	Bacteria	976
357	Ga0495680_0116648	3300047322	Bacteria	1974
358	Ga0495683_0000257	3300047323	Bacteria	47846
359	Ga0495683_0008961	3300047323	Bacteria	5338
360	Ga0495683_0016237	3300047323	Bacteria	3867
361	Ga0495683_0016264	3300047323	Bacteria	3864
362	Ga0495683_0018327	3300047323	Bacteria	3621
363	Ga0495683_0078214	3300047323	Bacteria	1616
364	Ga0495687_000002	3300047443	Bacteria	1085770
365	Ga0495687_000003	3300047443	Bacteria	859509
366	Ga0495687_000016	3300047443	Bacteria	359237
367	Ga0495687_000530	3300047443	Bacteria	45616
368	Ga0495687_000559	3300047443	Bacteria	43900
369	Ga0495687_000661	3300047443	Bacteria	39602
370	Ga0495687_000835	3300047443	Bacteria	32864
371	Ga0495687_028448	3300047443	Bacteria	2600
372	Ga0495675_0009145	3300047444	Bacteria	6159
373	Ga0495675_0194073	3300047444	Bacteria	1238
374	Ga0495677_0000005	3300047445	Bacteria	243336
375	Ga0495677_0000211	3300047445	Bacteria	26799
376	Ga0495677_0001908	3300047445	Bacteria	8331
377	Ga0495677_0014437	3300047445	Bacteria	2875
378	Ga0495677_0045358	3300047445	Bacteria	1612
379	Ga0495677_0045925	3300047445	Bacteria	1603
380	Ga0495679_004031	3300047446	Bacteria	6901
381	Ga0495679_005885	3300047446	Bacteria	5377
382	Ga0495679_053524	3300047446	Bacteria	1205
383	Ga0495679_073128	3300047446	Bacteria	984
384	Ga0495685_000660	3300047447	Bacteria	10526
385	Ga0495685_002824	3300047447	Bacteria	5482
386	Ga0495673_0000056	3300047469	Bacteria	245918
387	Ga0495673_0000990	3300047469	Bacteria	25377
388	Ga0495673_0001625	3300047469	Bacteria	17407
389	Ga0495681_0000021	3300047470	Bacteria	166534
390	Ga0495681_0000175	3300047470	Bacteria	53913
391	Ga0495681_0002049	3300047470	Bacteria	14651
392	Ga0495681_0006729	3300047470	Bacteria	7498
393	Ga0495681_0008595	3300047470	Bacteria	6378
394	Ga0495681_0013412	3300047470	Bacteria	4753
395	Ga0495681_0014288	3300047470	Bacteria	4558
396	Ga0495681_0045137	3300047470	Bacteria	2111
397	Ga0495681_0049026	3300047470	Bacteria	1999
398	Ga0495681_0159552	3300047470	Bacteria	940
399	Ga0495686_0000015	3300047472	Bacteria	471703
400	Ga0495686_0000142	3300047472	Bacteria	143655
401	Ga0495686_0001667	3300047472	Bacteria	23087
402	Ga0495686_0012419	3300047472	Bacteria	5958
403	Ga0495686_0027226	3300047472	Bacteria	3734
404	Ga0495593_0151641	3300047673	Bacteria	1172
405	Ga0495602_0001954	3300048088	Bacteria	20668
406	Ga0495614_0058784	3300048089	Bacteria	1651
407	Ga0495615_0010468	3300048090	Bacteria	1855
408	Ga0495615_0012274	3300048090	Bacteria	1763
409	Ga0495626_0000026	3300048091	Bacteria	207698
410	Ga0495626_0001020	3300048091	Bacteria	24084
411	Ga0495626_0001127	3300048091	Bacteria	22366
412	Ga0495626_0003379	3300048091	Bacteria	10273
413	Ga0495626_0011431	3300048091	Bacteria	4695
414	Ga0495626_0016628	3300048091	Bacteria	3733
415	Ga0495626_0024236	3300048091	Bacteria	2977
416	Ga0495626_0026765	3300048091	Bacteria	2807
417	Ga0495626_0032303	3300048091	Bacteria	2514
418	Ga0495626_0033666	3300048091	Bacteria	2454
419	Ga0495626_0036896	3300048091	Bacteria	2326
420	Ga0495626_0038789	3300048091	Bacteria	2256
421	Ga0495626_0051100	3300048091	Bacteria	1907
422	Ga0495626_0064368	3300048091	Bacteria	1661
423	Ga0495626_0118553	3300048091	Bacteria	1140
424	Ga0496102_0004060	3300048905	Bacteria	12410
425	Ga0496103_0022642	3300048906	Bacteria	3783
426	Ga0496104_0170470	3300048907	Bacteria	2087
427	Ga0496104_0187068	3300048907	Bacteria	1982
428	Ga0496106_0005362	3300048909	Bacteria	9487
429	Ga0496106_0347265	3300048909	Bacteria	1192
430	Ga0496107_0000858	3300048910	Bacteria	17848
431	Ga0496107_0080058	3300048910	Bacteria	2382
432	Ga0496107_0110387	3300048910	Bacteria	2021
433	Ga0496109_0366481	3300048912	Bacteria	1361
434	Ga0496113_0005867	3300048916	Bacteria	7708
435	Ga0496115_0007535	3300048918	Bacteria	8017
436	Ga0496121_0000625	3300048924	Bacteria	65948
437	Ga0496121_0165990	3300048924	Bacteria	1609
438	Ga0496122_0001426	3300048925	Bacteria	38722
439	Ga0496122_0261160	3300048925	Bacteria	961
440	Ga0496123_0016530	3300048926	Bacteria	5984
441	Ga0496124_0016795	3300048927	Bacteria	6938
442	Ga0496124_0020402	3300048927	Bacteria	6124
443	Ga0496124_0038576	3300048927	Bacteria	4147
444	Ga0496124_0045209	3300048927	Bacteria	3776
445	Ga0496124_0164238	3300048927	Bacteria	1727
446	Ga0496124_0167151	3300048927	Bacteria	1708
447	Ga0496125_0015707	3300048928	Bacteria	7303
448	Ga0496126_0030714	3300048929	Bacteria	5087
449	Ga0495678_000061	3300049459	Bacteria	142649
450	Ga0495678_000163	3300049459	Bacteria	78292
451	Ga0495678_000191	3300049459	Bacteria	71862
452	Ga0495678_000349	3300049459	Bacteria	47682
453	Ga0495678_000641	3300049459	Bacteria	32197
454	Ga0495678_001131	3300049459	Bacteria	22164
455	Ga0495678_002907	3300049459	Bacteria	11020
456	Ga0495682_0000130	3300049460	Bacteria	65523
457	Ga0495682_0000137	3300049460	Bacteria	63454
458	Ga0495682_0000244	3300049460	Bacteria	43169
459	Ga0495682_0000623	3300049460	Bacteria	23787
460	Ga0495682_0001923	3300049460	Bacteria	10343
461	Ga0495682_0003214	3300049460	Bacteria	7341
462	Ga0495682_0007989	3300049460	Bacteria	4182
463	Ga0495682_0014367	3300049460	Bacteria	3004
464	Ga0495682_0038045	3300049460	Bacteria	1768
465	Ga0495682_0038377	3300049460	Bacteria	1760
466	Ga0501034_0135568	3300049571	Bacteria	2443
467	Ga0501034_0263720	3300049571	Bacteria	1665
468	Ga0501036_0276778	3300049572	Bacteria	1405
469	Ga0501047_0333961	3300049581	Bacteria	1354
470	Ga0501047_0338740	3300049581	Bacteria	1342
471	Ga0501035_0000507	3300049822	Bacteria	43979
472	Ga0501044_0405462	3300049823	Bacteria	1275
473	Ga0500578_0296888	3300053086	Bacteria	959
474	Ga0500643_014851	3300053087	Bacteria	2688
475	Ga0500644_0000028	3300053088	Bacteria	92405
476	Ga0500644_0009428	3300053088	Bacteria	2610
477	Ga0500650_0080466	3300053098	Bacteria	1524
478	Ga0500554_045677	3300053102	Bacteria	1361
479	Ga0500556_0001064	3300053104	Bacteria	14095
480	Ga0500562_000880	3300053108	Bacteria	7297
481	Ga0500608_000008	3300053122	Bacteria	97962
482	Ga0500614_006219	3300053123	Bacteria	2508
483	Ga0500618_000024	3300053125	Bacteria	152149
484	Ga0500658_0076450	3300053134	Bacteria	1423
485	Ga0500559_0019963	3300053136	Bacteria	2832
486	Ga0500564_000007	3300053138	Bacteria	84097
487	Ga0500577_0011086	3300053142	Bacteria	2677
488	Ga0500588_0000550	3300053146	Bacteria	6120
489	Ga0500616_0093084	3300053153	Bacteria	1488
490	Ga0500622_0000201	3300053156	Bacteria	63318
491	Ga0500622_0006868	3300053156	Bacteria	6536
492	Ga0500645_002784	3300053730	Bacteria	7543
493	Ga0500645_042773	3300053730	Bacteria	1335
494	Ga0466962_0075693	3300061719	Bacteria	1608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053088	Ga0500644_0009428	Ga0500644_0009428_1869_2600	242
2	3300046453	Ga0495627_000185	Ga0495627_000185_56777_57601	252
3	3300049459	Ga0495678_000191	Ga0495678_000191_11605_12423	255
4	3300003794	Ga0055531_10001617	Ga0055531_1000161715	256
5	3300025304	Ga0209257_1000373	Ga0209257_100037337	256
6	3300046471	Ga0495650_0000085	Ga0495650_0000085_219014_219823	257
7	3300046474	Ga0495605_0035168	Ga0495605_0035168_1503_2312	257
8	3300046474	Ga0495605_0067496	Ga0495605_0067496_410_1219	257
9	3300046491	Ga0495584_0005434	Ga0495584_0005434_4613_5422	257
10	3300046500	Ga0495596_0002170	Ga0495596_0002170_1478_2287	257
11	3300046501	Ga0495607_0011387	Ga0495607_0011387_578_1387	257
12	3300046506	Ga0495583_0011884	Ga0495583_0011884_1010_1819	257
13	3300046507	Ga0495606_0086676	Ga0495606_0086676_938_1747	257
14	3300046512	Ga0495610_0052973	Ga0495610_0052973_642_1451	257
15	3300046513	Ga0495616_0013520	Ga0495616_0013520_851_1660	257
16	3300046518	Ga0495631_0021512	Ga0495631_0021512_1540_2349	257
17	3300046519	Ga0495632_0054064	Ga0495632_0054064_647_1456	257
18	3300046520	Ga0495637_0013697	Ga0495637_0013697_2853_3662	257
19	3300046523	Ga0495644_0000778	Ga0495644_0000778_10133_10942	257
20	3300046524	Ga0495648_0001197	Ga0495648_0001197_25085_25894	257
21	3300046524	Ga0495648_0005951	Ga0495648_0005951_7817_8626	257
22	3300046530	Ga0495654_0135275	Ga0495654_0135275_88_897	257
23	3300046538	Ga0495609_0081667	Ga0495609_0081667_323_1132	257
24	3300046616	Ga0495668_0029793	Ga0495668_0029793_1993_2802	257
25	3300046648	Ga0495611_0085138	Ga0495611_0085138_616_1425	257
26	3300046684	Ga0495669_0069038	Ga0495669_0069038_419_1228	257
27	3300046691	Ga0495670_0144968	Ga0495670_0144968_59_868	257
28	3300046794	Ga0495589_0051889	Ga0495589_0051889_274_1083	257
29	3300046794	Ga0495589_0128756	Ga0495589_0128756_343_1152	257
30	3300046810	Ga0495660_0020034	Ga0495660_0020034_2943_3752	257
31	3300047320	Ga0495672_0009169	Ga0495672_0009169_255_1064	257
32	3300047320	Ga0495672_0094847	Ga0495672_0094847_65_874	257
33	3300047321	Ga0495676_0357106	Ga0495676_0357106_36_845	257
34	3300047323	Ga0495683_0008961	Ga0495683_0008961_4261_5070	257
35	3300047446	Ga0495679_073128	Ga0495679_073128_145_954	257
36	3300047447	Ga0495685_000660	Ga0495685_000660_8012_8821	257
37	3300047469	Ga0495673_0000056	Ga0495673_0000056_183793_184617	257
38	3300048091	Ga0495626_0038789	Ga0495626_0038789_828_1637	257
39	3300049460	Ga0495682_0003214	Ga0495682_0003214_752_1561	257
40	3300047470	Ga0495681_0000021	Ga0495681_0000021_116089_116898	259
41	iso_pu_bacteria	2524614857	2526061121	259
42	iso_pu_bacteria	2739367875	2740065033	259
43	3300046457	Ga0495590_0002810	Ga0495590_0002810_5311_6120	260
44	iso_pu_bacteria	2643221556	2643800743	262
45	iso_pu_bacteria	2643221684	2644470973	262
46	iso_pu_bacteria	2808606418	2809143640	262
47	iso_pu_bacteria	2808606418	2809143725	262
48	iso_pu_bacteria	8047673197	8047677376	262
49	3300049571	Ga0501034_0135568	Ga0501034_0135568_99_899	263
50	3300048928	Ga0496125_0015707	Ga0496125_0015707_4536_5333	264
51	3300048929	Ga0496126_0030714	Ga0496126_0030714_2147_2944	264
52	iso_pu_bacteria	2884960567	2884963348	264
53	3300046501	Ga0495607_0003076	Ga0495607_0003076_8964_9779	265
54	3300046507	Ga0495606_0001189	Ga0495606_0001189_17940_18755	265
55	3300003322	rootL2_10081169	rootL2_100811691	266
56	3300003322	rootL2_10187558	rootL2_101875585	266
57	3300003323	rootH1_10067297	rootH1_100672972	266
58	3300003759	Ga0055525_1000136	Ga0055525_100013612	266
59	3300003762	Ga0055542_1013704	Ga0055542_10137041	266
60	3300005262	Ga0065165_1001371	Ga0065165_10013712	266
61	3300005344	Ga0070661_100055359	Ga0070661_1000553592	266
62	3300005366	Ga0070659_100063613	Ga0070659_1000636132	266
63	3300005457	Ga0070662_100220361	Ga0070662_1002203611	266
64	3300005564	Ga0070664_100065647	Ga0070664_1000656473	266
65	3300006881	Ga0068865_100119380	Ga0068865_1001193802	266
66	3300009093	Ga0105240_10878175	Ga0105240_108781751	266
67	3300009148	Ga0105243_10012137	Ga0105243_100121374	266
68	3300009174	Ga0105241_10018659	Ga0105241_100186592	266
69	3300009176	Ga0105242_10223515	Ga0105242_102235152	266
70	3300009545	Ga0105237_10519012	Ga0105237_105190122	266
71	3300009551	Ga0105238_10076080	Ga0105238_100760803	266
72	3300013100	Ga0157373_10148580	Ga0157373_101485802	266
73	3300025230	Ga0209563_100003	Ga0209563_1000031678	266
74	3300025254	Ga0209148_1000539	Ga0209148_100053914	266
75	3300025909	Ga0207705_10001946	Ga0207705_100019468	266
76	3300025909	Ga0207705_10221489	Ga0207705_102214891	266
77	3300025914	Ga0207671_10395899	Ga0207671_103958991	266
78	3300025920	Ga0207649_10014955	Ga0207649_100149553	266
79	3300025932	Ga0207690_10020476	Ga0207690_100204763	266
80	3300025949	Ga0207667_10029588	Ga0207667_100295884	266
81	3300031711	Ga0265314_10009617	Ga0265314_100096174	266
82	3300037312	Ga0395899_0001277	Ga0395899_0001277_5743_6552	266
83	3300037312	Ga0395899_0005625	Ga0395899_0005625_5476_6285	266
84	3300037312	Ga0395899_0010780	Ga0395899_0010780_3751_4560	266
85	3300037418	Ga0395900_0000426	Ga0395900_0000426_1038_1859	266
86	3300037418	Ga0395900_0000525	Ga0395900_0000525_23281_24090	266
87	3300037418	Ga0395900_0032131	Ga0395900_0032131_4242_5051	266
88	3300037418	Ga0395900_0393425	Ga0395900_0393425_248_1057	266
89	3300037466	Ga0395898_0003022	Ga0395898_0003022_15777_16586	266
90	3300037466	Ga0395898_0451953	Ga0395898_0451953_248_1057	266
91	3300037471	Ga0395905_0014260	Ga0395905_0014260_810_1619	266
92	3300037471	Ga0395905_0030065	Ga0395905_0030065_2746_3555	266
93	3300038443	Ga0395901_0000159	Ga0395901_0000159_23490_24311	266
94	3300038443	Ga0395901_0002917	Ga0395901_0002917_650_1459	266
95	3300044683	Ga0466965_0009814	Ga0466965_0009814_2722_3531	266
96	3300044683	Ga0466965_0054126	Ga0466965_0054126_1135_1944	266
97	3300044684	Ga0466966_0029410	Ga0466966_0029410_92_901	266
98	3300044684	Ga0466966_0042849	Ga0466966_0042849_887_1696	266
99	3300044684	Ga0466966_0060911	Ga0466966_0060911_1135_1944	266
100	3300044706	Ga0466964_0000040	Ga0466964_0000040_24561_25370	266
101	3300044706	Ga0466964_0010047	Ga0466964_0010047_84_1010	266
102	3300044706	Ga0466964_0035617	Ga0466964_0035617_429_1238	266
103	3300044735	Ga0466968_0000719	Ga0466968_0000719_4771_5697	266
104	3300044765	Ga0466970_0036799	Ga0466970_0036799_756_1565	266
105	3300044842	Ga0466957_0007135	Ga0466957_0007135_4248_5057	266
106	3300044842	Ga0466957_0089374	Ga0466957_0089374_410_1219	266
107	3300045049	Ga0466959_0056325	Ga0466959_0056325_1598_2407	266
108	3300045049	Ga0466959_0089505	Ga0466959_0089505_1323_2132	266
109	3300045049	Ga0466959_0100751	Ga0466959_0100751_547_1356	266
110	3300045049	Ga0466959_0156765	Ga0466959_0156765_732_1541	266
111	3300045836	Ga0466958_0080933	Ga0466958_0080933_159_968	266
112	3300045976	Ga0466967_0005003	Ga0466967_0005003_5663_6472	266
113	3300045976	Ga0466967_0012572	Ga0466967_0012572_2159_2968	266
114	3300045976	Ga0466967_0080691	Ga0466967_0080691_1940_2749	266
115	3300046457	Ga0495590_0015196	Ga0495590_0015196_786_1595	266
116	3300046460	Ga0495638_0002910	Ga0495638_0002910_8236_9048	266
117	3300046471	Ga0495650_0000307	Ga0495650_0000307_82793_83602	266
118	3300046471	Ga0495650_0006327	Ga0495650_0006327_4683_5492	266
119	3300046472	Ga0495580_0090017	Ga0495580_0090017_424_1233	266
120	3300046473	Ga0495582_0016873	Ga0495582_0016873_2802_3611	266
121	3300046474	Ga0495605_0000104	Ga0495605_0000104_6522_7331	266
122	3300046474	Ga0495605_0007836	Ga0495605_0007836_1090_1899	266
123	3300046474	Ga0495605_0028264	Ga0495605_0028264_102_917	266
124	3300046491	Ga0495584_0000313	Ga0495584_0000313_14690_15499	266
125	3300046491	Ga0495584_0019875	Ga0495584_0019875_1949_2758	266
126	3300046491	Ga0495584_0079584	Ga0495584_0079584_493_1305	266
127	3300046492	Ga0495585_0000006	Ga0495585_0000006_274922_275731	266
128	3300046492	Ga0495585_0001803	Ga0495585_0001803_14770_15579	266
129	3300046492	Ga0495585_0009290	Ga0495585_0009290_1580_2389	266
130	3300046492	Ga0495585_0039500	Ga0495585_0039500_1776_2585	266
131	3300046492	Ga0495585_0108867	Ga0495585_0108867_362_1171	266
132	3300046499	Ga0495594_0026070	Ga0495594_0026070_264_1073	266
133	3300046499	Ga0495594_0138546	Ga0495594_0138546_335_1144	266
134	3300046500	Ga0495596_0000015	Ga0495596_0000015_28972_29781	266
135	3300046500	Ga0495596_0000329	Ga0495596_0000329_9225_10034	266
136	3300046500	Ga0495596_0000517	Ga0495596_0000517_3381_4190	266
137	3300046500	Ga0495596_0000759	Ga0495596_0000759_10369_11178	266
138	3300046500	Ga0495596_0002488	Ga0495596_0002488_9046_9861	266
139	3300046500	Ga0495596_0011549	Ga0495596_0011549_2469_3278	266
140	3300046500	Ga0495596_0017112	Ga0495596_0017112_318_1130	266
141	3300046501	Ga0495607_0000407	Ga0495607_0000407_14628_15437	266
142	3300046501	Ga0495607_0003818	Ga0495607_0003818_1676_2485	266
143	3300046501	Ga0495607_0005181	Ga0495607_0005181_6208_7017	266
144	3300046501	Ga0495607_0038720	Ga0495607_0038720_1218_2030	266
145	3300046501	Ga0495607_0163208	Ga0495607_0163208_49_858	266
146	3300046506	Ga0495583_0000195	Ga0495583_0000195_32207_33016	266
147	3300046506	Ga0495583_0000685	Ga0495583_0000685_29360_30169	266
148	3300046506	Ga0495583_0004871	Ga0495583_0004871_181_990	266
149	3300046506	Ga0495583_0007593	Ga0495583_0007593_4591_5400	266
150	3300046506	Ga0495583_0008801	Ga0495583_0008801_2851_3660	266
151	3300046506	Ga0495583_0022816	Ga0495583_0022816_63_872	266
152	3300046507	Ga0495606_0002394	Ga0495606_0002394_16360_17169	266
153	3300046507	Ga0495606_0034916	Ga0495606_0034916_2028_2837	266
154	3300046507	Ga0495606_0034976	Ga0495606_0034976_1351_2160	266
155	3300046513	Ga0495616_0000020	Ga0495616_0000020_85043_85852	266
156	3300046513	Ga0495616_0000319	Ga0495616_0000319_16985_17794	266
157	3300046513	Ga0495616_0011138	Ga0495616_0011138_4065_4874	266
158	3300046513	Ga0495616_0022412	Ga0495616_0022412_2057_2866	266
159	3300046513	Ga0495616_0034149	Ga0495616_0034149_912_1721	266
160	3300046517	Ga0495630_0017856	Ga0495630_0017856_3948_4757	266
161	3300046518	Ga0495631_0002524	Ga0495631_0002524_4109_4918	266
162	3300046518	Ga0495631_0012633	Ga0495631_0012633_390_1199	266
163	3300046518	Ga0495631_0036782	Ga0495631_0036782_432_1241	266
164	3300046519	Ga0495632_0000028	Ga0495632_0000028_132859_133737	266
165	3300046519	Ga0495632_0000029	Ga0495632_0000029_11328_12137	266
166	3300046519	Ga0495632_0000176	Ga0495632_0000176_51620_52429	266
167	3300046519	Ga0495632_0033954	Ga0495632_0033954_1525_2334	266
168	3300046519	Ga0495632_0072345	Ga0495632_0072345_334_1146	266
169	3300046522	Ga0495643_0002332	Ga0495643_0002332_12068_12877	266
170	3300046522	Ga0495643_0010350	Ga0495643_0010350_368_1177	266
171	3300046522	Ga0495643_0012897	Ga0495643_0012897_3966_4775	266
172	3300046523	Ga0495644_0006706	Ga0495644_0006706_3361_4170	266
173	3300046523	Ga0495644_0014763	Ga0495644_0014763_300_1109	266
174	3300046523	Ga0495644_0039837	Ga0495644_0039837_636_1448	266
175	3300046524	Ga0495648_0001570	Ga0495648_0001570_16951_17766	266
176	3300046524	Ga0495648_0004876	Ga0495648_0004876_2646_3455	266
177	3300046524	Ga0495648_0025097	Ga0495648_0025097_308_1117	266
178	3300046524	Ga0495648_0106201	Ga0495648_0106201_492_1301	266
179	3300046524	Ga0495648_0114128	Ga0495648_0114128_459_1268	266
180	3300046525	Ga0495663_0007160	Ga0495663_0007160_2089_2898	266
181	3300046525	Ga0495663_0029823	Ga0495663_0029823_490_1299	266
182	3300046528	Ga0495642_0000063	Ga0495642_0000063_57758_58567	266
183	3300046528	Ga0495642_0002702	Ga0495642_0002702_102_911	266
184	3300046528	Ga0495642_0016664	Ga0495642_0016664_288_1097	266
185	3300046528	Ga0495642_0021724	Ga0495642_0021724_1162_1971	266
186	3300046528	Ga0495642_0094559	Ga0495642_0094559_19_831	266
187	3300046529	Ga0495652_0006812	Ga0495652_0006812_501_1310	266
188	3300046530	Ga0495654_0002538	Ga0495654_0002538_1496_2305	266
189	3300046535	Ga0495586_0016432	Ga0495586_0016432_149_958	266
190	3300046536	Ga0495587_0081062	Ga0495587_0081062_881_1690	266
191	3300046536	Ga0495587_0151078	Ga0495587_0151078_242_1051	266
192	3300046538	Ga0495609_0000095	Ga0495609_0000095_4482_5291	266
193	3300046538	Ga0495609_0004032	Ga0495609_0004032_909_1721	266
194	3300046538	Ga0495609_0007499	Ga0495609_0007499_3962_4771	266
195	3300046538	Ga0495609_0012307	Ga0495609_0012307_985_1794	266
196	3300046538	Ga0495609_0043519	Ga0495609_0043519_211_1020	266
197	3300046542	Ga0495597_0000073	Ga0495597_0000073_70492_71301	266
198	3300046542	Ga0495597_0017813	Ga0495597_0017813_1723_2532	266
199	3300046542	Ga0495597_0031022	Ga0495597_0031022_125_934	266
200	3300046557	Ga0495622_0000675	Ga0495622_0000675_14121_14930	266
201	3300046557	Ga0495622_0049296	Ga0495622_0049296_926_1735	266
202	3300046558	Ga0495633_0018519	Ga0495633_0018519_1030_1839	266
203	3300046558	Ga0495633_0034833	Ga0495633_0034833_806_1615	266
204	3300046558	Ga0495633_0038284	Ga0495633_0038284_1311_2120	266
205	3300046615	Ga0495656_0075492	Ga0495656_0075492_313_1122	266
206	3300046616	Ga0495668_0006504	Ga0495668_0006504_2232_3044	266
207	3300046616	Ga0495668_0054723	Ga0495668_0054723_507_1316	266
208	3300046616	Ga0495668_0163721	Ga0495668_0163721_66_875	266
209	3300046642	Ga0495634_0155554	Ga0495634_0155554_162_971	266
210	3300046648	Ga0495611_0039656	Ga0495611_0039656_1153_1965	266
211	3300046660	Ga0495625_0032818	Ga0495625_0032818_2387_3196	266
212	3300046660	Ga0495625_0042089	Ga0495625_0042089_1890_2702	266
213	3300046660	Ga0495625_0116153	Ga0495625_0116153_786_1595	266
214	3300046660	Ga0495625_0157223	Ga0495625_0157223_645_1454	266
215	3300046665	Ga0495661_0000012	Ga0495661_0000012_176479_177288	266
216	3300046665	Ga0495661_0001832	Ga0495661_0001832_9991_10800	266
217	3300046665	Ga0495661_0012567	Ga0495661_0012567_3432_4310	266
218	3300046665	Ga0495661_0023204	Ga0495661_0023204_2423_3232	266
219	3300046665	Ga0495661_0174519	Ga0495661_0174519_48_857	266
220	3300046674	Ga0495588_0000118	Ga0495588_0000118_11194_12003	266
221	3300046674	Ga0495588_0006728	Ga0495588_0006728_4169_4978	266
222	3300046674	Ga0495588_0007738	Ga0495588_0007738_669_1478	266
223	3300046674	Ga0495588_0081825	Ga0495588_0081825_74_883	266
224	3300046679	Ga0495623_0006937	Ga0495623_0006937_1236_2045	266
225	3300046679	Ga0495623_0235807	Ga0495623_0235807_120_929	266
226	3300046684	Ga0495669_0000546	Ga0495669_0000546_2159_2968	266
227	3300046684	Ga0495669_0001096	Ga0495669_0001096_3326_4135	266
228	3300046691	Ga0495670_0000488	Ga0495670_0000488_7497_8306	266
229	3300046691	Ga0495670_0003844	Ga0495670_0003844_1628_2437	266
230	3300046691	Ga0495670_0056564	Ga0495670_0056564_145_954	266
231	3300046691	Ga0495670_0064711	Ga0495670_0064711_889_1698	266
232	3300046691	Ga0495670_0075189	Ga0495670_0075189_583_1392	266
233	3300046692	Ga0495671_0000547	Ga0495671_0000547_20198_21007	266
234	3300046692	Ga0495671_0006779	Ga0495671_0006779_1343_2152	266
235	3300046692	Ga0495671_0110427	Ga0495671_0110427_482_1291	266
236	3300046694	Ga0495649_0007537	Ga0495649_0007537_709_1518	266
237	3300046694	Ga0495649_0018352	Ga0495649_0018352_3091_3900	266
238	3300046794	Ga0495589_0000007	Ga0495589_0000007_176119_176928	266
239	3300046794	Ga0495589_0000082	Ga0495589_0000082_80036_80845	266
240	3300046794	Ga0495589_0003595	Ga0495589_0003595_7329_8138	266
241	3300046794	Ga0495589_0006830	Ga0495589_0006830_3492_4307	266
242	3300046794	Ga0495589_0042776	Ga0495589_0042776_1353_2162	266
243	3300046809	Ga0495600_0187750	Ga0495600_0187750_226_1035	266
244	3300046810	Ga0495660_0000297	Ga0495660_0000297_38543_39352	266
245	3300046810	Ga0495660_0018972	Ga0495660_0018972_459_1268	266
246	3300046810	Ga0495660_0024810	Ga0495660_0024810_44_856	266
247	3300046810	Ga0495660_0033040	Ga0495660_0033040_1326_2135	266
248	3300046810	Ga0495660_0057175	Ga0495660_0057175_518_1327	266
249	3300047315	Ga0495581_0031425	Ga0495581_0031425_1994_2803	266
250	3300047317	Ga0495604_0195969	Ga0495604_0195969_278_1087	266
251	3300047320	Ga0495672_0000228	Ga0495672_0000228_46716_47618	266
252	3300047320	Ga0495672_0001502	Ga0495672_0001502_19878_20693	266
253	3300047320	Ga0495672_0003036	Ga0495672_0003036_2809_3618	266
254	3300047322	Ga0495680_0116648	Ga0495680_0116648_771_1580	266
255	3300047323	Ga0495683_0016237	Ga0495683_0016237_2243_3055	266
256	3300047323	Ga0495683_0016264	Ga0495683_0016264_1112_1921	266
257	3300047323	Ga0495683_0018327	Ga0495683_0018327_33_848	266
258	3300047443	Ga0495687_000002	Ga0495687_000002_846635_847444	266
259	3300047443	Ga0495687_000003	Ga0495687_000003_302159_302968	266
260	3300047443	Ga0495687_000016	Ga0495687_000016_86693_87502	266
261	3300047443	Ga0495687_000559	Ga0495687_000559_20958_21767	266
262	3300047443	Ga0495687_000661	Ga0495687_000661_34835_35644	266
263	3300047443	Ga0495687_000835	Ga0495687_000835_16237_17046	266
264	3300047443	Ga0495687_028448	Ga0495687_028448_81_890	266
265	3300047444	Ga0495675_0009145	Ga0495675_0009145_170_979	266
266	3300047444	Ga0495675_0194073	Ga0495675_0194073_168_977	266
267	3300047445	Ga0495677_0000005	Ga0495677_0000005_99739_100548	266
268	3300047445	Ga0495677_0001908	Ga0495677_0001908_3508_4317	266
269	3300047445	Ga0495677_0014437	Ga0495677_0014437_1947_2756	266
270	3300047445	Ga0495677_0045358	Ga0495677_0045358_142_951	266
271	3300047445	Ga0495677_0045925	Ga0495677_0045925_285_1094	266
272	3300047446	Ga0495679_004031	Ga0495679_004031_158_967	266
273	3300047446	Ga0495679_053524	Ga0495679_053524_375_1184	266
274	3300047447	Ga0495685_002824	Ga0495685_002824_4446_5258	266
275	3300047470	Ga0495681_0000175	Ga0495681_0000175_16898_17707	266
276	3300047470	Ga0495681_0006729	Ga0495681_0006729_5295_6104	266
277	3300047470	Ga0495681_0014288	Ga0495681_0014288_1903_2712	266
278	3300047470	Ga0495681_0045137	Ga0495681_0045137_58_867	266
279	3300047470	Ga0495681_0049026	Ga0495681_0049026_1097_1906	266
280	3300047472	Ga0495686_0000015	Ga0495686_0000015_132656_133468	266
281	3300047673	Ga0495593_0151641	Ga0495593_0151641_103_912	266
282	3300048088	Ga0495602_0001954	Ga0495602_0001954_17460_18269	266
283	3300048089	Ga0495614_0058784	Ga0495614_0058784_760_1569	266
284	3300048090	Ga0495615_0010468	Ga0495615_0010468_251_1060	266
285	3300048090	Ga0495615_0012274	Ga0495615_0012274_144_953	266
286	3300048091	Ga0495626_0000026	Ga0495626_0000026_177780_178598	266
287	3300048091	Ga0495626_0001020	Ga0495626_0001020_210_1019	266
288	3300048091	Ga0495626_0003379	Ga0495626_0003379_7955_8764	266
289	3300048091	Ga0495626_0011431	Ga0495626_0011431_1613_2422	266
290	3300048091	Ga0495626_0024236	Ga0495626_0024236_790_1599	266
291	3300048091	Ga0495626_0026765	Ga0495626_0026765_791_1600	266
292	3300048091	Ga0495626_0032303	Ga0495626_0032303_248_1060	266
293	3300048091	Ga0495626_0036896	Ga0495626_0036896_226_1035	266
294	3300048091	Ga0495626_0051100	Ga0495626_0051100_357_1166	266
295	3300048091	Ga0495626_0118553	Ga0495626_0118553_239_1048	266
296	3300048905	Ga0496102_0004060	Ga0496102_0004060_2288_3097	266
297	3300048906	Ga0496103_0022642	Ga0496103_0022642_2106_2915	266
298	3300048907	Ga0496104_0170470	Ga0496104_0170470_256_1065	266
299	3300048907	Ga0496104_0187068	Ga0496104_0187068_658_1467	266
300	3300048909	Ga0496106_0005362	Ga0496106_0005362_3426_4235	266
301	3300048909	Ga0496106_0347265	Ga0496106_0347265_225_1103	266
302	3300048910	Ga0496107_0080058	Ga0496107_0080058_846_1655	266
303	3300048910	Ga0496107_0110387	Ga0496107_0110387_643_1452	266
304	3300048912	Ga0496109_0366481	Ga0496109_0366481_129_938	266
305	3300048916	Ga0496113_0005867	Ga0496113_0005867_2622_3431	266
306	3300048925	Ga0496122_0001426	Ga0496122_0001426_21313_22122	266
307	3300048925	Ga0496122_0261160	Ga0496122_0261160_105_914	266
308	3300048926	Ga0496123_0016530	Ga0496123_0016530_2829_3638	266
309	3300048927	Ga0496124_0016795	Ga0496124_0016795_4896_5705	266
310	3300048927	Ga0496124_0020402	Ga0496124_0020402_4528_5337	266
311	3300048927	Ga0496124_0164238	Ga0496124_0164238_494_1303	266
312	3300048927	Ga0496124_0167151	Ga0496124_0167151_302_1111	266
313	3300049459	Ga0495678_000061	Ga0495678_000061_62457_63266	266
314	3300049459	Ga0495678_000641	Ga0495678_000641_19602_20411	266
315	3300049459	Ga0495678_001131	Ga0495678_001131_9880_10689	266
316	3300049460	Ga0495682_0000130	Ga0495682_0000130_4627_5436	266
317	3300049460	Ga0495682_0000244	Ga0495682_0000244_16587_17396	266
318	3300049460	Ga0495682_0000623	Ga0495682_0000623_5011_5823	266
319	3300049460	Ga0495682_0001923	Ga0495682_0001923_4175_4987	266
320	3300049572	Ga0501036_0276778	Ga0501036_0276778_521_1330	266
321	3300049581	Ga0501047_0338740	Ga0501047_0338740_177_998	266
322	3300049822	Ga0501035_0000507	Ga0501035_0000507_3186_3995	266
323	3300049823	Ga0501044_0405462	Ga0501044_0405462_175_984	266
324	3300053086	Ga0500578_0296888	Ga0500578_0296888_100_906	266
325	3300061719	Ga0466962_0075693	Ga0466962_0075693_291_1100	266
326	3300005262	Ga0065165_1003249	Ga0065165_10032497	267
327	3300046457	Ga0495590_0000070	Ga0495590_0000070_32010_32822	267
328	3300046458	Ga0495591_000534	Ga0495591_000534_19153_19965	267
329	3300046458	Ga0495591_012900	Ga0495591_012900_268_1080	267
330	3300046460	Ga0495638_0001598	Ga0495638_0001598_13324_14127	267
331	3300046474	Ga0495605_0038111	Ga0495605_0038111_1570_2382	267
332	3300046474	Ga0495605_0119363	Ga0495605_0119363_268_1080	267
333	3300046491	Ga0495584_0000706	Ga0495584_0000706_11158_11970	267
334	3300046492	Ga0495585_0058739	Ga0495585_0058739_716_1528	267
335	3300046500	Ga0495596_0000456	Ga0495596_0000456_8927_9739	267
336	3300046500	Ga0495596_0007778	Ga0495596_0007778_1116_1928	267
337	3300046500	Ga0495596_0013809	Ga0495596_0013809_1543_2355	267
338	3300046500	Ga0495596_0029597	Ga0495596_0029597_863_1675	267
339	3300046501	Ga0495607_0001482	Ga0495607_0001482_10719_11531	267
340	3300046501	Ga0495607_0066137	Ga0495607_0066137_753_1565	267
341	3300046501	Ga0495607_0110713	Ga0495607_0110713_53_865	267
342	3300046506	Ga0495583_0000367	Ga0495583_0000367_15520_16332	267
343	3300046506	Ga0495583_0002255	Ga0495583_0002255_2819_3631	267
344	3300046506	Ga0495583_0030849	Ga0495583_0030849_1740_2552	267
345	3300046506	Ga0495583_0034106	Ga0495583_0034106_1584_2396	267
346	3300046512	Ga0495610_0000176	Ga0495610_0000176_50724_51527	267
347	3300046512	Ga0495610_0000274	Ga0495610_0000274_29663_30475	267
348	3300046513	Ga0495616_0009127	Ga0495616_0009127_2412_3224	267
349	3300046513	Ga0495616_0013134	Ga0495616_0013134_1177_1989	267
350	3300046513	Ga0495616_0013793	Ga0495616_0013793_3063_3875	267
351	3300046513	Ga0495616_0092643	Ga0495616_0092643_264_1067	267
352	3300046518	Ga0495631_0001188	Ga0495631_0001188_15011_15823	267
353	3300046518	Ga0495631_0005372	Ga0495631_0005372_104_916	267
354	3300046518	Ga0495631_0066256	Ga0495631_0066256_53_865	267
355	3300046519	Ga0495632_0000090	Ga0495632_0000090_44883_45695	267
356	3300046519	Ga0495632_0000107	Ga0495632_0000107_35556_36368	267
357	3300046519	Ga0495632_0046007	Ga0495632_0046007_524_1336	267
358	3300046520	Ga0495637_0000286	Ga0495637_0000286_32037_32849	267
359	3300046520	Ga0495637_0077414	Ga0495637_0077414_57_869	267
360	3300046522	Ga0495643_0028872	Ga0495643_0028872_146_958	267
361	3300046523	Ga0495644_0044359	Ga0495644_0044359_831_1643	267
362	3300046524	Ga0495648_0006323	Ga0495648_0006323_1332_2144	267
363	3300046524	Ga0495648_0036852	Ga0495648_0036852_75_887	267
364	3300046524	Ga0495648_0118160	Ga0495648_0118160_63_875	267
365	3300046528	Ga0495642_0002779	Ga0495642_0002779_2438_3250	267
366	3300046528	Ga0495642_0007364	Ga0495642_0007364_2366_3178	267
367	3300046530	Ga0495654_0006427	Ga0495654_0006427_2851_3663	267
368	3300046538	Ga0495609_0001162	Ga0495609_0001162_15388_16200	267
369	3300046538	Ga0495609_0013693	Ga0495609_0013693_1922_2734	267
370	3300046538	Ga0495609_0047369	Ga0495609_0047369_1085_1897	267
371	3300046542	Ga0495597_0000108	Ga0495597_0000108_45378_46190	267
372	3300046542	Ga0495597_0000138	Ga0495597_0000138_27610_28422	267
373	3300046542	Ga0495597_0004741	Ga0495597_0004741_1062_1874	267
374	3300046542	Ga0495597_0025785	Ga0495597_0025785_743_1555	267
375	3300046558	Ga0495633_0000970	Ga0495633_0000970_9651_10463	267
376	3300046616	Ga0495668_0000535	Ga0495668_0000535_34803_35615	267
377	3300046616	Ga0495668_0024532	Ga0495668_0024532_1304_2116	267
378	3300046616	Ga0495668_0044945	Ga0495668_0044945_968_1780	267
379	3300046616	Ga0495668_0050363	Ga0495668_0050363_1352_2164	267
380	3300046616	Ga0495668_0090717	Ga0495668_0090717_659_1471	267
381	3300046648	Ga0495611_0000323	Ga0495611_0000323_22557_23369	267
382	3300046660	Ga0495625_0051902	Ga0495625_0051902_1291_2094	267
383	3300046660	Ga0495625_0162394	Ga0495625_0162394_668_1480	267
384	3300046660	Ga0495625_0221131	Ga0495625_0221131_368_1180	267
385	3300046665	Ga0495661_0008318	Ga0495661_0008318_4142_4954	267
386	3300046674	Ga0495588_0133792	Ga0495588_0133792_133_945	267
387	3300046684	Ga0495669_0023605	Ga0495669_0023605_1296_2108	267
388	3300046684	Ga0495669_0077885	Ga0495669_0077885_176_988	267
389	3300046691	Ga0495670_0021204	Ga0495670_0021204_1615_2427	267
390	3300046692	Ga0495671_0002569	Ga0495671_0002569_6007_6819	267
391	3300046692	Ga0495671_0010303	Ga0495671_0010303_1646_2458	267
392	3300046692	Ga0495671_0061897	Ga0495671_0061897_689_1492	267
393	3300046694	Ga0495649_0000093	Ga0495649_0000093_27544_28356	267
394	3300046694	Ga0495649_0029482	Ga0495649_0029482_820_1632	267
395	3300046794	Ga0495589_0013880	Ga0495589_0013880_1941_2753	267
396	3300046794	Ga0495589_0101342	Ga0495589_0101342_497_1309	267
397	3300046810	Ga0495660_0005109	Ga0495660_0005109_6462_7274	267
398	3300046810	Ga0495660_0014411	Ga0495660_0014411_1720_2532	267
399	3300046810	Ga0495660_0014495	Ga0495660_0014495_3374_4186	267
400	3300046810	Ga0495660_0017183	Ga0495660_0017183_1936_2748	267
401	3300046810	Ga0495660_0022295	Ga0495660_0022295_1925_2737	267
402	3300047320	Ga0495672_0000217	Ga0495672_0000217_32037_32849	267
403	3300047320	Ga0495672_0000733	Ga0495672_0000733_27208_28020	267
404	3300047320	Ga0495672_0005175	Ga0495672_0005175_4747_5559	267
405	3300047323	Ga0495683_0000257	Ga0495683_0000257_32037_32849	267
406	3300047323	Ga0495683_0078214	Ga0495683_0078214_138_950	267
407	3300047443	Ga0495687_000530	Ga0495687_000530_42481_43293	267
408	3300047445	Ga0495677_0000211	Ga0495677_0000211_2609_3421	267
409	3300047470	Ga0495681_0002049	Ga0495681_0002049_8848_9660	267
410	3300047470	Ga0495681_0008595	Ga0495681_0008595_2079_2891	267
411	3300047470	Ga0495681_0013412	Ga0495681_0013412_534_1346	267
412	3300047472	Ga0495686_0000142	Ga0495686_0000142_52678_53490	267
413	3300048091	Ga0495626_0001127	Ga0495626_0001127_1843_2655	267
414	3300048091	Ga0495626_0016628	Ga0495626_0016628_805_1617	267
415	3300048091	Ga0495626_0033666	Ga0495626_0033666_500_1312	267
416	3300048091	Ga0495626_0064368	Ga0495626_0064368_71_883	267
417	3300048927	Ga0496124_0045209	Ga0496124_0045209_1370_2182	267
418	3300049459	Ga0495678_000163	Ga0495678_000163_31667_32479	267
419	3300049459	Ga0495678_000349	Ga0495678_000349_45645_46457	267
420	3300049459	Ga0495678_002907	Ga0495678_002907_1226_2038	267
421	3300049460	Ga0495682_0000137	Ga0495682_0000137_17026_17838	267
422	3300049460	Ga0495682_0007989	Ga0495682_0007989_1348_2160	267
423	3300049460	Ga0495682_0038045	Ga0495682_0038045_145_957	267
424	3300049460	Ga0495682_0038377	Ga0495682_0038377_930_1742	267
425	3300053134	Ga0500658_0076450	Ga0500658_0076450_109_912	267
426	3300003322	rootL2_10172962	rootL2_101729622	268
427	3300025299	Ga0209256_1000666	Ga0209256_100066639	268
428	3300028794	Ga0307515_10163547	Ga0307515_101635472	268
429	3300046506	Ga0495583_0000029	Ga0495583_0000029_105097_105903	268
430	3300046507	Ga0495606_0004595	Ga0495606_0004595_3045_3857	268
431	3300046520	Ga0495637_0048283	Ga0495637_0048283_673_1479	268
432	3300046660	Ga0495625_0010962	Ga0495625_0010962_6063_6881	268
433	3300047320	Ga0495672_0000665	Ga0495672_0000665_1095_1901	268
434	3300053122	Ga0500608_000008	Ga0500608_000008_71714_72523	268
435	3300053156	Ga0500622_0006868	Ga0500622_0006868_4796_5605	268
436	3300053730	Ga0500645_002784	Ga0500645_002784_1545_2351	268
437	3300053730	Ga0500645_042773	Ga0500645_042773_85_891	268
438	3300046660	Ga0495625_0000721	Ga0495625_0000721_44511_45326	269
439	3300047446	Ga0495679_005885	Ga0495679_005885_774_1583	269
440	3300048924	Ga0496121_0165990	Ga0496121_0165990_498_1307	269
441	3300048927	Ga0496124_0038576	Ga0496124_0038576_1819_2631	269
442	3300053104	Ga0500556_0001064	Ga0500556_0001064_6006_6815	269
443	3300053125	Ga0500618_000024	Ga0500618_000024_42102_42911	269
444	iso_pu_bacteria	2510917020	2511124413	269
445	iso_pu_bacteria	2582581279	2585148591	269
446	3300046460	Ga0495638_0014535	Ga0495638_0014535_2590_3411	270
447	3300046500	Ga0495596_0008018	Ga0495596_0008018_281_1102	270
448	3300046513	Ga0495616_0100255	Ga0495616_0100255_152_973	270
449	3300046694	Ga0495649_0008030	Ga0495649_0008030_3341_4162	270
450	3300046794	Ga0495589_0185706	Ga0495589_0185706_82_903	270
451	3300046810	Ga0495660_0028065	Ga0495660_0028065_2278_3099	270
452	3300047472	Ga0495686_0000015	Ga0495686_0000015_201710_202531	270
453	3300049460	Ga0495682_0014367	Ga0495682_0014367_1031_1852	270
454	3300049571	Ga0501034_0263720	Ga0501034_0263720_215_1036	270
455	3300049581	Ga0501047_0333961	Ga0501047_0333961_117_938	270
456	3300046524	Ga0495648_0000029	Ga0495648_0000029_102433_103251	272
457	3300047469	Ga0495673_0000990	Ga0495673_0000990_13806_14624	272
458	3300053087	Ga0500643_014851	Ga0500643_014851_1005_1823	272
459	3300053088	Ga0500644_0000028	Ga0500644_0000028_17709_18527	272
460	3300053142	Ga0500577_0011086	Ga0500577_0011086_90_908	272
461	iso_pu_bacteria	2643221583	2643926088	272
462	3300003215	JGI25153J46596_10018536	JGI25153J46596_100185363	273
463	3300003773	Ga0055537_1001482	Ga0055537_10014827	273
464	3300025263	Ga0209565_1000466	Ga0209565_10004662	273
465	3300025273	Ga0209673_1001434	Ga0209673_100143419	273
466	3300025291	Ga0209675_1007505	Ga0209675_10075053	273
467	3300025297	Ga0209758_1003486	Ga0209758_10034864	273
468	3300025299	Ga0209256_1027238	Ga0209256_10272381	273
469	3300039447	Ga0436361_1027308	Ga0436361_1027308_935_1762	273
470	3300046460	Ga0495638_0000055	Ga0495638_0000055_22109_22930	273
471	3300046471	Ga0495650_0000017	Ga0495650_0000017_492703_493524	273
472	3300046515	Ga0495620_0069351	Ga0495620_0069351_133_954	273
473	3300046520	Ga0495637_0027385	Ga0495637_0027385_1562_2386	273
474	3300046524	Ga0495648_0121897	Ga0495648_0121897_233_1054	273
475	3300046530	Ga0495654_0000012	Ga0495654_0000012_39864_40685	273
476	3300046660	Ga0495625_0017589	Ga0495625_0017589_1464_2285	273
477	3300047472	Ga0495686_0012419	Ga0495686_0012419_2898_3722	273
478	3300047472	Ga0495686_0027226	Ga0495686_0027226_1963_2784	273
479	3300048918	Ga0496115_0007535	Ga0496115_0007535_6829_7650	273
480	3300053098	Ga0500650_0080466	Ga0500650_0080466_420_1247	273
481	3300053102	Ga0500554_045677	Ga0500554_045677_485_1306	273
482	3300053108	Ga0500562_000880	Ga0500562_000880_1609_2433	273
483	3300053138	Ga0500564_000007	Ga0500564_000007_17811_18635	273
484	3300053146	Ga0500588_0000550	Ga0500588_0000550_4778_5605	273
485	3300053153	Ga0500616_0093084	Ga0500616_0093084_616_1437	273
486	3300053156	Ga0500622_0000201	Ga0500622_0000201_9117_9941	273
487	3300028794	Ga0307515_10037737	Ga0307515_100377374	274
488	3300046660	Ga0495625_0000011	Ga0495625_0000011_348357_349181	274
489	3300046794	Ga0495589_0038144	Ga0495589_0038144_1330_2160	274
490	3300047469	Ga0495673_0001625	Ga0495673_0001625_7207_8034	274
491	3300047472	Ga0495686_0001667	Ga0495686_0001667_4006_4830	274
492	3300048910	Ga0496107_0000858	Ga0496107_0000858_8780_9604	274
493	3300048924	Ga0496121_0000625	Ga0496121_0000625_27836_28660	274
494	3300053123	Ga0500614_006219	Ga0500614_006219_41_865	274
495	3300046512	Ga0495610_0004833	Ga0495610_0004833_602_1441	276
496	3300047470	Ga0495681_0159552	Ga0495681_0159552_81_920	279
497	iso_pu_bacteria	2582581280	2585153590	281
498	iso_pu_bacteria	2582581293	2585197394	281
499	iso_pu_bacteria	2818991435	2819536715	281
500	iso_pu_bacteria	2818991454	2819645876	281
501	3300053136	Ga0500559_0019963	Ga0500559_0019963_532_1401	282
502	3300003215	JGI25153J46596_10015451	JGI25153J46596_100154513	285
503	3300003771	Ga0055526_1024879	Ga0055526_10248792	285
504	3300025295	Ga0209564_1001798	Ga0209564_10017988	285
505	3300025297	Ga0209758_1005270	Ga0209758_10052702	285
506	3300042436	Ga0439435_0007514	Ga0439435_0007514_428_1285	285
507	3300046460	Ga0495638_0016677	Ga0495638_0016677_2492_3355	285
508	3300046501	Ga0495607_0045120	Ga0495607_0045120_951_1808	285
509	3300046522	Ga0495643_0095764	Ga0495643_0095764_120_977	285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

48

185

0.86 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

207

0.86 PF13460

NAD_binding_10

NAD(P)H-binding

51

178

0.82 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

48

243

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6mfh-assembly1.cif.gz_A	mutated uronate dehydrogenase	0.9092	6	271
3ay3-assembly2.cif.gz_D	crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens	0.9053	6	270
3rfx-assembly1.cif.gz_A	crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad	0.8976	6	262
3rft-assembly1.cif.gz_A	crystal structure of uronate dehydrogenase from agrobacterium tumefaciens	0.8959	6	262
3ay3-assembly2.cif.gz_D	crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens	0.889	6	270

ID	Description	Score	Start	End	Superfamily
3rftA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9114	6	233	3.40.50.720
3rftA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8961	6	233	3.40.50.720
6dntA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8557	5	208	3.40.50.720
af_Q4CM81_7_150_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8528	6	108	3.40.50.720
af_Q4CM81_8_135_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8528	6	108	3.40.50.720

ID	Description	Score	Start	End
AF-A0A1G3V4B8-F1-model_v4	Epimerase	0.958	6	240
AF-A0A7W9S4U6-F1-model_v4	Uncharacterized protein	0.9575	143	268
AF-A0A7Y3ACM3-F1-model_v4	NAD(P)-dependent oxidoreductase	0.9569	6	245
AF-A0A7Z9S3C0-F1-model_v4	NAD(P)-dependent oxidoreductase	0.9563	6	229
AF-A0A2T0KEM2-F1-model_v4	Uronate dehydrogenase	0.955	7	273

Feature Viewer

pLDDT	pTM	Quality
90.49	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F457022

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

48

185

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

207

0.86

PF13460

NAD_binding_10

NAD(P)H-binding

51

178

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

48

243

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map