metagRoot

F456255

General Info

Members	Datasets	Scaffolds	Average Seq Length
504	187	491	261

Family's Representative Sequence

Representative Sequence	3300048904\|Ga0496101_0369913\|Ga0496101_0369913_253_1107
Length	284
Sequence	MAPDAPCPRSEETELFIRKELTSMAWKDVFSYVKAVAANNGVTKGDVRADDAVPLGARIGSVVQLQCSPIIRAQASGSLIGMPDAGDTRILAVSQIRLVPDTELYRLYLDKGDDDAKEKFLQVFCGDDGKVAEVLYCTQLARVIPETADDQDAYTGAAGYGLGDAGYTLWREQLADMLDKETLATVFGTADRLDYTRDAGARDAAFVTPFKGREIRIDDAAGTHGLRQEMFFMPYVRTLPDGGREYLLITTEIVESVDGDANRRGIHVDFVVGIPIEQERIVIQ

Samples

	Sample ID	Description	Type	Environment
1	2643221554	Duganella sp. Root1480D1	Isolate	Unclassified
2	2643221556	Massilia sp. Root1485	Isolate	Unclassified
3	2643221638	Duganella sp. Root336D2	Isolate	Unclassified
4	2643221645	Massilia sp. Root351	Isolate	Unclassified
5	2643221664	Massilia sp. Root418	Isolate	Unclassified
6	2643221684	Massilia sp. Root133	Isolate	Unclassified
7	2738541280	Massilia sp. GV090	Isolate	Unclassified
8	2738541300	Massilia sp. GV016	Isolate	Unclassified
9	2738543018	Massilia sp. GV045	Isolate	Unclassified
10	2738543030	Massilia sp. GV097	Isolate	Unclassified
11	2808606418	Herbaspirillum sp. SJZ107	Isolate	Rhizosphere
12	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
13	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
14	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
15	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
16	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
17	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
18	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
19	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
20	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
21	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
22	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
23	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
24	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
25	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
26	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
27	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
28	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
29	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
30	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
31	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
32	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
33	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
34	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
35	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
36	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
39	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
40	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
41	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
42	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
43	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
44	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
45	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
46	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
47	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
48	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
49	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
50	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
51	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
52	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
53	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
54	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
55	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
56	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
57	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
58	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
59	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
60	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
61	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
62	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
63	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
64	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
65	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
66	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
67	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
68	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
69	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
75	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
76	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
77	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
78	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
79	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
80	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
81	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
82	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
83	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
84	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
85	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
86	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
87	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
88	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
89	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
90	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
91	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
92	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
93	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
94	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
95	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
96	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
97	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
98	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
99	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
100	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
101	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
102	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
103	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
104	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
105	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
106	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
107	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
108	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
109	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
110	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
111	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
112	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
113	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
114	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
115	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
116	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
117	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
118	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
119	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
120	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
121	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
122	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
123	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
124	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
125	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
126	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
127	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
128	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
129	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
130	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
131	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
132	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
133	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
134	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
135	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
136	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
137	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
138	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
139	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
140	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
141	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
142	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
143	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
144	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
145	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
146	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
147	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
148	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
149	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
150	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
151	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
152	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
153	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
154	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
155	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
156	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
157	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
158	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
159	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
160	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
161	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
162	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
163	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
164	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
165	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
166	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
167	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
168	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
169	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
170	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
171	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
172	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
173	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
174	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
175	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
176	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
177	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
178	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
179	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
180	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
181	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
182	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
183	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
184	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
185	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
186	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
187	8047673197	Telluria mixta LMG 11547	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.63
Metatranscriptomes	0.79
Isolates	2.58

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.31
Nodule	0
Rhizoplane	4.17
Rhizosphere	79.76
Stem	0
Stem Tuber	0
Unclassified	4.76

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25154J39366_1006334	3300002738	Bacteria	1748
2	JGI25158J39367_1018553	3300002739	Bacteria	860
3	JGI25152J39213_1000723	3300002773	Bacteria	16987
4	JGI25152J39213_1013050	3300002773	Bacteria	1749
5	JGI25150J39212_1000767	3300002774	Bacteria	11091
6	JGI25150J39212_1013558	3300002774	Bacteria	1407
7	JGI25159J45721_1007183	3300002987	Bacteria	3228
8	JGI25153J46596_10005346	3300003215	Bacteria	6744
9	rootH2_10325251	3300003320	Bacteria	1175
10	rootL2_10010637	3300003322	Bacteria	7774
11	rootL2_10028855	3300003322	Bacteria	14866
12	JGI25160J50197_1007343	3300003354	Bacteria	4327
13	JGI25161J50226_1003893	3300003374	Bacteria	3255
14	JGI25161J50226_1006769	3300003374	Bacteria	2019
15	Ga0055529_1000015	3300003763	Bacteria	366950
16	Ga0055526_1000007	3300003771	Bacteria	321998
17	Ga0055537_1011898	3300003773	Bacteria	1731
18	Ga0055524_1005870	3300003775	Bacteria	5416
19	Ga0055524_1007246	3300003775	Bacteria	4736
20	Ga0055524_1007679	3300003775	Bacteria	4556
21	Ga0055534_1010752	3300003784	Bacteria	1895
22	Ga0055534_1013871	3300003784	Bacteria	1531
23	Ga0055528_1008085	3300003790	Bacteria	4562
24	Ga0055530_10003208	3300003791	Bacteria	9581
25	Ga0055530_10021760	3300003791	Bacteria	1881
26	Ga0055531_10028731	3300003794	Bacteria	1910
27	Ga0055531_10037971	3300003794	Bacteria	1454
28	Ga0055543_1003159	3300004625	Bacteria	5027
29	Ga0065165_1008059	3300005262	Bacteria	5027
30	Ga0070658_10081373	3300005327	Bacteria	2660
31	Ga0070658_10204379	3300005327	Bacteria	1667
32	Ga0070658_10411989	3300005327	Bacteria	1161
33	Ga0070660_100025765	3300005339	Bacteria	4373
34	Ga0070660_100064279	3300005339	Bacteria	2854
35	Ga0070661_100066485	3300005344	Bacteria	2648
36	Ga0070659_100189372	3300005366	Bacteria	1690
37	Ga0068853_100934244	3300005539	Bacteria	834
38	Ga0068855_100219731	3300005563	Bacteria	2131
39	Ga0068855_100334363	3300005563	Bacteria	1671
40	Ga0068857_100312540	3300005577	Bacteria	1450
41	Ga0068852_100413956	3300005616	Bacteria	1328
42	Ga0075362_10164043	3300006177	Bacteria	1071
43	Ga0105244_10000345	3300009036	Bacteria	43661
44	Ga0105246_10323594	3300011119	Bacteria	1254
45	Ga0157373_10242932	3300013100	Bacteria	1273
46	Ga0206356_11371903	3300020070	Bacteria	2679
47	Ga0206351_10402272	3300020077	Bacteria	1980
48	Ga0213872_10002282	3300021361	Bacteria	11420
49	Ga0213872_10008151	3300021361	Bacteria	5084
50	Ga0209436_100505	3300025208	Bacteria	17076
51	Ga0209563_100003	3300025230	Bacteria	1932942
52	Ga0209437_103153	3300025233	Bacteria	3027
53	Ga0207425_1000009	3300025245	Bacteria	593135
54	Ga0207425_1000036	3300025245	Bacteria	225783
55	Ga0207425_1000441	3300025245	Bacteria	27232
56	Ga0209646_1000042	3300025246	Bacteria	343923
57	Ga0209129_1000051	3300025258	Bacteria	267104
58	Ga0209129_1006078	3300025258	Bacteria	4036
59	Ga0209565_1000662	3300025263	Bacteria	21980
60	Ga0209565_1009395	3300025263	Bacteria	2485
61	Ga0209455_1000031	3300025272	Bacteria	519952
62	Ga0209673_1015785	3300025273	Bacteria	2851
63	Ga0209130_1000827	3300025284	Bacteria	26056
64	Ga0209130_1002733	3300025284	Bacteria	8355
65	Ga0209675_1000839	3300025291	Bacteria	20131
66	Ga0209675_1006241	3300025291	Bacteria	4822
67	Ga0209025_1007424	3300025294	Bacteria	8180
68	Ga0209564_1000010	3300025295	Bacteria	885399
69	Ga0209564_1000172	3300025295	Bacteria	155715
70	Ga0209564_1002005	3300025295	Bacteria	17786
71	Ga0209564_1040763	3300025295	Bacteria	1256
72	Ga0209758_1000054	3300025297	Bacteria	337655
73	Ga0209758_1002821	3300025297	Bacteria	16907
74	Ga0209050_1000309	3300025298	Bacteria	99432
75	Ga0209050_1025928	3300025298	Bacteria	1977
76	Ga0209256_1000307	3300025299	Bacteria	85852
77	Ga0209256_1000553	3300025299	Bacteria	53682
78	Ga0209256_1001318	3300025299	Bacteria	26552
79	Ga0207426_1001267	3300025302	Bacteria	22033
80	Ga0209257_1000054	3300025304	Bacteria	416957
81	Ga0209257_1008490	3300025304	Bacteria	5820
82	Ga0207705_10011290	3300025909	Bacteria	6472
83	Ga0207705_10092341	3300025909	Bacteria	2218
84	Ga0207654_10021315	3300025911	Bacteria	3444
85	Ga0207657_10005662	3300025919	Bacteria	13036
86	Ga0207657_10091202	3300025919	Bacteria	2542
87	Ga0207649_10102021	3300025920	Bacteria	1901
88	Ga0207706_10219431	3300025933	Bacteria	1665
89	Ga0207679_10024733	3300025945	Bacteria	4120
90	Ga0207679_10582952	3300025945	Bacteria	1006
91	Ga0207667_10046955	3300025949	Bacteria	4572
92	Ga0207667_10263416	3300025949	Bacteria	1763
93	Ga0207674_10253410	3300026116	Bacteria	1707
94	Ga0316177_1141274	3300030731	Bacteria	3332
95	Ga0316178_1165775	3300030735	Bacteria	1432
96	Ga0316180_1004149	3300030736	Bacteria	3946
97	Ga0316181_1039056	3300030744	Bacteria	1600
98	Ga0316182_1044098	3300030745	Bacteria	912
99	Ga0307408_100001520	3300031548	Bacteria	17258
100	Ga0307408_100010579	3300031548	Bacteria	6083
101	Ga0307408_100089106	3300031548	Bacteria	2325
102	Ga0307408_100139637	3300031548	Unclassified	1900
103	Ga0265314_10036878	3300031711	Bacteria	3548
104	Ga0307416_100004603	3300032002	Bacteria	8342
105	Ga0395899_0000449	3300037312	Bacteria	47070
106	Ga0395899_0001277	3300037312	Bacteria	21884
107	Ga0395899_0002494	3300037312	Bacteria	14939
108	Ga0395899_0008439	3300037312	Bacteria	7935
109	Ga0395899_0026777	3300037312	Bacteria	4350
110	Ga0395899_0046408	3300037312	Bacteria	3236
111	Ga0395899_0243626	3300037312	Bacteria	1236
112	Ga0395900_0000426	3300037418	Bacteria	60657
113	Ga0395900_0000525	3300037418	Bacteria	54176
114	Ga0395900_0006981	3300037418	Bacteria	11701
115	Ga0395900_0037040	3300037418	Bacteria	5029
116	Ga0395900_0039245	3300037418	Bacteria	4878
117	Ga0395900_0171228	3300037418	Bacteria	2210
118	Ga0395900_0218055	3300037418	Bacteria	1924
119	Ga0395900_0486781	3300037418	Bacteria	1185
120	Ga0395900_0546488	3300037418	Bacteria	1103
121	Ga0395898_0002552	3300037466	Bacteria	21364
122	Ga0395898_0082359	3300037466	Bacteria	3102
123	Ga0395898_0094190	3300037466	Bacteria	2878
124	Ga0395898_0144218	3300037466	Bacteria	2279
125	Ga0395898_0223169	3300037466	Bacteria	1797
126	Ga0395898_0507679	3300037466	Bacteria	1146
127	Ga0395905_0025529	3300037471	Bacteria	5572
128	Ga0395905_0038879	3300037471	Bacteria	4463
129	Ga0395905_0063561	3300037471	Bacteria	3453
130	Ga0395905_0114201	3300037471	Bacteria	2537
131	Ga0395905_0411513	3300037471	Bacteria	1248
132	Ga0395905_0485168	3300037471	Bacteria	1135
133	Ga0395901_0000159	3300038443	Bacteria	87998
134	Ga0395901_0001862	3300038443	Bacteria	21812
135	Ga0395901_0050607	3300038443	Bacteria	4315
136	Ga0395901_0090770	3300038443	Bacteria	3197
137	Ga0395901_0243182	3300038443	Bacteria	1876
138	Ga0395901_0279285	3300038443	Bacteria	1735
139	Ga0395901_0421150	3300038443	Bacteria	1369
140	Ga0436361_0302074	3300039447	Bacteria	152020
141	Ga0436361_0888604	3300039447	Bacteria	23958
142	Ga0439448_0000513	3300042005	Bacteria	8957
143	Ga0439449_0008382	3300042007	Bacteria	3930
144	Ga0439450_038336	3300042008	Bacteria	1104
145	Ga0439458_0011339	3300042157	Bacteria	1992
146	Ga0466969_0029508	3300044656	Bacteria	2800
147	Ga0466969_0132298	3300044656	Bacteria	1156
148	Ga0466969_0165726	3300044656	Bacteria	1014
149	Ga0466972_0001092	3300044658	Bacteria	12998
150	Ga0466965_0003998	3300044683	Bacteria	6536
151	Ga0466965_0023265	3300044683	Bacteria	2991
152	Ga0466965_0051023	3300044683	Bacteria	2052
153	Ga0466965_0094780	3300044683	Bacteria	1521
154	Ga0466966_0064839	3300044684	Bacteria	2298
155	Ga0466966_0200199	3300044684	Bacteria	1208
156	Ga0466961_0013281	3300044693	Bacteria	5270
157	Ga0466964_0000040	3300044706	Bacteria	26586
158	Ga0466964_0000537	3300044706	Bacteria	11882
159	Ga0466971_0070912	3300044719	Bacteria	1582
160	Ga0466968_0002280	3300044735	Bacteria	7015
161	Ga0466957_0001161	3300044842	Bacteria	13638
162	Ga0466957_0007135	3300044842	Bacteria	6318
163	Ga0466957_0007500	3300044842	Bacteria	6164
164	Ga0466957_0304829	3300044842	Bacteria	1071
165	Ga0466960_0087210	3300044901	Bacteria	1584
166	Ga0466959_0022467	3300045049	Bacteria	4664
167	Ga0466959_0053243	3300045049	Bacteria	2959
168	Ga0466959_0155592	3300045049	Bacteria	1609
169	Ga0466958_0008286	3300045836	Bacteria	5755
170	Ga0466958_0027946	3300045836	Bacteria	3341
171	Ga0466967_0005003	3300045976	Bacteria	9079
172	Ga0466967_0021524	3300045976	Bacteria	5241
173	Ga0466967_0057516	3300045976	Bacteria	3433
174	Ga0495617_055512	3300046452	Bacteria	1314
175	Ga0495627_006427	3300046453	Bacteria	4608
176	Ga0495590_0000012	3300046457	Bacteria	303377
177	Ga0495590_0000070	3300046457	Bacteria	71704
178	Ga0495590_0066370	3300046457	Bacteria	1263
179	Ga0495591_001252	3300046458	Bacteria	16261
180	Ga0495591_002786	3300046458	Bacteria	9425
181	Ga0495638_0000047	3300046460	Bacteria	216004
182	Ga0495638_0005663	3300046460	Bacteria	9206
183	Ga0495638_0143065	3300046460	Bacteria	1394
184	Ga0495650_0000062	3300046471	Bacteria	277977
185	Ga0495650_0000128	3300046471	Bacteria	177256
186	Ga0495650_0000239	3300046471	Bacteria	109891
187	Ga0495650_0000868	3300046471	Bacteria	35989
188	Ga0495650_0003364	3300046471	Bacteria	11726
189	Ga0495650_0022287	3300046471	Bacteria	3042
190	Ga0495605_0000021	3300046474	Bacteria	248512
191	Ga0495605_0000104	3300046474	Bacteria	105745
192	Ga0495605_0015610	3300046474	Bacteria	4126
193	Ga0495605_0015999	3300046474	Bacteria	4070
194	Ga0495605_0019701	3300046474	Bacteria	3598
195	Ga0495605_0022186	3300046474	Bacteria	3355
196	Ga0495605_0089956	3300046474	Bacteria	1424
197	Ga0495639_0006284	3300046475	Bacteria	5102
198	Ga0495584_0000223	3300046491	Bacteria	40932
199	Ga0495584_0002877	3300046491	Bacteria	9610
200	Ga0495584_0005861	3300046491	Bacteria	6475
201	Ga0495584_0006551	3300046491	Bacteria	6086
202	Ga0495584_0011518	3300046491	Bacteria	4530
203	Ga0495584_0034795	3300046491	Bacteria	2546
204	Ga0495584_0048038	3300046491	Bacteria	2152
205	Ga0495584_0227771	3300046491	Bacteria	947
206	Ga0495585_0009484	3300046492	Bacteria	5835
207	Ga0495585_0027879	3300046492	Bacteria	3223
208	Ga0495585_0051720	3300046492	Bacteria	2275
209	Ga0495585_0111580	3300046492	Bacteria	1453
210	Ga0495585_0114473	3300046492	Bacteria	1431
211	Ga0495594_0004872	3300046499	Bacteria	6910
212	Ga0495596_0001875	3300046500	Bacteria	11669
213	Ga0495596_0010908	3300046500	Bacteria	3938
214	Ga0495596_0012630	3300046500	Bacteria	3609
215	Ga0495596_0012795	3300046500	Bacteria	3579
216	Ga0495596_0019299	3300046500	Bacteria	2802
217	Ga0495596_0019856	3300046500	Bacteria	2755
218	Ga0495596_0020889	3300046500	Bacteria	2676
219	Ga0495596_0029098	3300046500	Bacteria	2216
220	Ga0495596_0037403	3300046500	Bacteria	1919
221	Ga0495607_0000407	3300046501	Bacteria	43562
222	Ga0495607_0000602	3300046501	Bacteria	35012
223	Ga0495607_0006073	3300046501	Bacteria	8545
224	Ga0495607_0007097	3300046501	Bacteria	7790
225	Ga0495607_0010265	3300046501	Bacteria	6300
226	Ga0495607_0031486	3300046501	Bacteria	3247
227	Ga0495607_0075657	3300046501	Bacteria	1865
228	Ga0495607_0147357	3300046501	Bacteria	1208
229	Ga0495583_0000092	3300046506	Bacteria	158865
230	Ga0495583_0000367	3300046506	Bacteria	70310
231	Ga0495583_0001306	3300046506	Bacteria	25929
232	Ga0495583_0002950	3300046506	Bacteria	13674
233	Ga0495583_0007390	3300046506	Bacteria	6920
234	Ga0495583_0014951	3300046506	Bacteria	4248
235	Ga0495583_0083531	3300046506	Bacteria	1384
236	Ga0495606_0000716	3300046507	Bacteria	51314
237	Ga0495606_0000826	3300046507	Bacteria	47010
238	Ga0495606_0001490	3300046507	Bacteria	31125
239	Ga0495606_0023208	3300046507	Bacteria	4502
240	Ga0495606_0036456	3300046507	Bacteria	3349
241	Ga0495606_0037170	3300046507	Bacteria	3308
242	Ga0495606_0091324	3300046507	Bacteria	1872
243	Ga0495610_0005983	3300046512	Bacteria	8506
244	Ga0495616_0000319	3300046513	Bacteria	38478
245	Ga0495616_0005159	3300046513	Bacteria	8099
246	Ga0495616_0017171	3300046513	Bacteria	3993
247	Ga0495616_0021842	3300046513	Bacteria	3460
248	Ga0495616_0024236	3300046513	Bacteria	3256
249	Ga0495616_0035770	3300046513	Bacteria	2567
250	Ga0495616_0036439	3300046513	Bacteria	2538
251	Ga0495616_0064016	3300046513	Bacteria	1795
252	Ga0495620_0068084	3300046515	Bacteria	1463
253	Ga0495631_0001413	3300046518	Bacteria	14588
254	Ga0495631_0003885	3300046518	Bacteria	8080
255	Ga0495631_0008491	3300046518	Bacteria	5177
256	Ga0495631_0012323	3300046518	Bacteria	4181
257	Ga0495631_0018016	3300046518	Bacteria	3331
258	Ga0495631_0028569	3300046518	Bacteria	2543
259	Ga0495631_0052304	3300046518	Bacteria	1784
260	Ga0495631_0073992	3300046518	Bacteria	1471
261	Ga0495631_0151957	3300046518	Bacteria	993
262	Ga0495632_0000090	3300046519	Bacteria	93838
263	Ga0495632_0000107	3300046519	Bacteria	85396
264	Ga0495632_0000184	3300046519	Bacteria	63861
265	Ga0495632_0006534	3300046519	Bacteria	7481
266	Ga0495632_0031986	3300046519	Bacteria	2714
267	Ga0495637_0000286	3300046520	Bacteria	39443
268	Ga0495637_0074003	3300046520	Bacteria	1369
269	Ga0495637_0153620	3300046520	Bacteria	867
270	Ga0495643_0000237	3300046522	Bacteria	82853
271	Ga0495643_0001506	3300046522	Bacteria	21094
272	Ga0495643_0006236	3300046522	Bacteria	7904
273	Ga0495643_0041752	3300046522	Bacteria	2500
274	Ga0495643_0067181	3300046522	Bacteria	1890
275	Ga0495643_0067325	3300046522	Bacteria	1887
276	Ga0495644_0011537	3300046523	Bacteria	3401
277	Ga0495644_0049533	3300046523	Bacteria	1576
278	Ga0495648_0000019	3300046524	Bacteria	276407
279	Ga0495648_0005028	3300046524	Bacteria	11110
280	Ga0495648_0007162	3300046524	Bacteria	8961
281	Ga0495648_0009371	3300046524	Bacteria	7598
282	Ga0495648_0036125	3300046524	Bacteria	3193
283	Ga0495648_0126301	3300046524	Bacteria	1366
284	Ga0495642_0000046	3300046528	Bacteria	74298
285	Ga0495642_0000227	3300046528	Bacteria	32156
286	Ga0495642_0002402	3300046528	Bacteria	7623
287	Ga0495642_0007934	3300046528	Bacteria	4065
288	Ga0495642_0010286	3300046528	Bacteria	3583
289	Ga0495642_0015098	3300046528	Bacteria	2998
290	Ga0495642_0019998	3300046528	Bacteria	2626
291	Ga0495642_0050144	3300046528	Bacteria	1716
292	Ga0495642_0063945	3300046528	Bacteria	1530
293	Ga0495654_0003066	3300046530	Bacteria	10405
294	Ga0495654_0005476	3300046530	Bacteria	7362
295	Ga0495654_0038490	3300046530	Bacteria	2391
296	Ga0495609_0000095	3300046538	Bacteria	104807
297	Ga0495609_0000269	3300046538	Bacteria	48750
298	Ga0495609_0003600	3300046538	Bacteria	8808
299	Ga0495609_0005109	3300046538	Bacteria	6993
300	Ga0495609_0007187	3300046538	Bacteria	5591
301	Ga0495609_0012457	3300046538	Bacteria	4035
302	Ga0495609_0038855	3300046538	Bacteria	2144
303	Ga0495609_0096113	3300046538	Bacteria	1285
304	Ga0495609_0120619	3300046538	Bacteria	1127
305	Ga0495597_0000075	3300046542	Bacteria	86570
306	Ga0495597_0000108	3300046542	Bacteria	73202
307	Ga0495597_0000138	3300046542	Bacteria	65518
308	Ga0495597_0000224	3300046542	Bacteria	51403
309	Ga0495597_0008980	3300046542	Bacteria	4980
310	Ga0495645_0034590	3300046543	Bacteria	3685
311	Ga0495622_0000019	3300046557	Bacteria	169931
312	Ga0495622_0000037	3300046557	Bacteria	119690
313	Ga0495622_0011509	3300046557	Bacteria	4088
314	Ga0495633_0000086	3300046558	Bacteria	124357
315	Ga0495633_0005365	3300046558	Bacteria	7861
316	Ga0495633_0007642	3300046558	Bacteria	6189
317	Ga0495633_0025625	3300046558	Bacteria	2902
318	Ga0495656_0021582	3300046615	Bacteria	2509
319	Ga0495656_0075574	3300046615	Bacteria	1507
320	Ga0495656_0227211	3300046615	Bacteria	935
321	Ga0495668_0000066	3300046616	Bacteria	178533
322	Ga0495668_0000535	3300046616	Bacteria	47216
323	Ga0495668_0000884	3300046616	Bacteria	33758
324	Ga0495668_0001041	3300046616	Bacteria	29392
325	Ga0495668_0002397	3300046616	Bacteria	15531
326	Ga0495668_0009255	3300046616	Bacteria	6059
327	Ga0495668_0018587	3300046616	Bacteria	4016
328	Ga0495668_0060384	3300046616	Bacteria	2092
329	Ga0495668_0094512	3300046616	Bacteria	1636
330	Ga0495611_0001433	3300046648	Bacteria	11872
331	Ga0495611_0003158	3300046648	Bacteria	7305
332	Ga0495611_0017450	3300046648	Bacteria	3070
333	Ga0495611_0074133	3300046648	Bacteria	1558
334	Ga0495611_0122090	3300046648	Bacteria	1215
335	Ga0495625_0000208	3300046660	Bacteria	93861
336	Ga0495625_0003971	3300046660	Bacteria	14184
337	Ga0495625_0022128	3300046660	Bacteria	4879
338	Ga0495625_0065858	3300046660	Bacteria	2553
339	Ga0495625_0076601	3300046660	Bacteria	2338
340	Ga0495625_0241632	3300046660	Bacteria	1175
341	Ga0495625_0438558	3300046660	Bacteria	809
342	Ga0495659_0000277	3300046664	Bacteria	20966
343	Ga0495659_0001072	3300046664	Bacteria	9522
344	Ga0495661_0000012	3300046665	Bacteria	276804
345	Ga0495661_0000623	3300046665	Bacteria	36079
346	Ga0495661_0000848	3300046665	Bacteria	28480
347	Ga0495661_0001245	3300046665	Bacteria	21981
348	Ga0495661_0006957	3300046665	Bacteria	7906
349	Ga0495661_0019717	3300046665	Bacteria	4414
350	Ga0495661_0035986	3300046665	Bacteria	3103
351	Ga0495661_0046490	3300046665	Bacteria	2649
352	Ga0495661_0050090	3300046665	Bacteria	2530
353	Ga0495661_0097679	3300046665	Bacteria	1658
354	Ga0495661_0101027	3300046665	Bacteria	1623
355	Ga0495588_0000118	3300046674	Bacteria	134942
356	Ga0495588_0052610	3300046674	Bacteria	2099
357	Ga0495588_0053583	3300046674	Bacteria	2080
358	Ga0495669_0000125	3300046684	Bacteria	48968
359	Ga0495669_0001362	3300046684	Bacteria	10082
360	Ga0495669_0017440	3300046684	Bacteria	3082
361	Ga0495669_0027682	3300046684	Bacteria	2480
362	Ga0495669_0047797	3300046684	Bacteria	1912
363	Ga0495669_0139742	3300046684	Bacteria	1143
364	Ga0495613_0152529	3300046689	Bacteria	1647
365	Ga0495670_0006222	3300046691	Bacteria	5859
366	Ga0495670_0037021	3300046691	Bacteria	2431
367	Ga0495670_0073615	3300046691	Bacteria	1731
368	Ga0495671_0000245	3300046692	Bacteria	46833
369	Ga0495671_0000924	3300046692	Bacteria	20803
370	Ga0495671_0001464	3300046692	Bacteria	15839
371	Ga0495671_0006267	3300046692	Bacteria	6892
372	Ga0495671_0060307	3300046692	Bacteria	1873
373	Ga0495649_0000093	3300046694	Bacteria	77036
374	Ga0495649_0005345	3300046694	Bacteria	8191
375	Ga0495649_0037236	3300046694	Bacteria	2671
376	Ga0495589_0000007	3300046794	Bacteria	276444
377	Ga0495589_0000082	3300046794	Bacteria	87068
378	Ga0495589_0000182	3300046794	Bacteria	55624
379	Ga0495589_0019087	3300046794	Bacteria	3517
380	Ga0495589_0022250	3300046794	Bacteria	3235
381	Ga0495589_0031817	3300046794	Bacteria	2655
382	Ga0495589_0147217	3300046794	Bacteria	1125
383	Ga0495660_0000297	3300046810	Bacteria	45575
384	Ga0495660_0000419	3300046810	Bacteria	35881
385	Ga0495660_0005291	3300046810	Bacteria	7732
386	Ga0495660_0039205	3300046810	Bacteria	2631
387	Ga0495660_0067509	3300046810	Bacteria	1904
388	Ga0495660_0073862	3300046810	Bacteria	1802
389	Ga0495660_0174505	3300046810	Bacteria	1044
390	Ga0495581_0154968	3300047315	Bacteria	1339
391	Ga0495636_0005611	3300047318	Bacteria	4921
392	Ga0495672_0000026	3300047320	Bacteria	340319
393	Ga0495672_0000217	3300047320	Bacteria	82349
394	Ga0495672_0000978	3300047320	Bacteria	29595
395	Ga0495672_0001203	3300047320	Bacteria	26107
396	Ga0495672_0002190	3300047320	Bacteria	18196
397	Ga0495672_0006396	3300047320	Bacteria	9145
398	Ga0495672_0079930	3300047320	Bacteria	1825
399	Ga0495676_0000082	3300047321	Bacteria	68690
400	Ga0495683_0000257	3300047323	Bacteria	47846
401	Ga0495683_0007369	3300047323	Bacteria	5961
402	Ga0495683_0044200	3300047323	Bacteria	2240
403	Ga0495683_0049515	3300047323	Bacteria	2104
404	Ga0495683_0051172	3300047323	Bacteria	2066
405	Ga0495683_0053365	3300047323	Bacteria	2016
406	Ga0495683_0053374	3300047323	Bacteria	2016
407	Ga0495687_000003	3300047443	Bacteria	859509
408	Ga0495687_000016	3300047443	Bacteria	359237
409	Ga0495687_000108	3300047443	Bacteria	126739
410	Ga0495687_000661	3300047443	Bacteria	39602
411	Ga0495687_000962	3300047443	Bacteria	29464
412	Ga0495687_044421	3300047443	Bacteria	1931
413	Ga0495677_0000005	3300047445	Bacteria	243336
414	Ga0495677_0000303	3300047445	Bacteria	21414
415	Ga0495677_0001334	3300047445	Bacteria	9868
416	Ga0495677_0001356	3300047445	Bacteria	9776
417	Ga0495677_0006615	3300047445	Bacteria	4373
418	Ga0495677_0009804	3300047445	Bacteria	3529
419	Ga0495677_0122043	3300047445	Bacteria	994
420	Ga0495679_005414	3300047446	Bacteria	5656
421	Ga0495679_015878	3300047446	Bacteria	2738
422	Ga0495679_031713	3300047446	Bacteria	1702
423	Ga0495685_011141	3300047447	Bacteria	3028
424	Ga0495685_015180	3300047447	Bacteria	2625
425	Ga0495681_0000407	3300047470	Bacteria	33294
426	Ga0495681_0000868	3300047470	Bacteria	23284
427	Ga0495681_0002292	3300047470	Bacteria	13757
428	Ga0495681_0006289	3300047470	Bacteria	7825
429	Ga0495681_0006765	3300047470	Bacteria	7461
430	Ga0495681_0024929	3300047470	Bacteria	3136
431	Ga0495686_0000142	3300047472	Bacteria	143655
432	Ga0495686_0002019	3300047472	Bacteria	20049
433	Ga0495686_0005828	3300047472	Bacteria	9610
434	Ga0495626_0000081	3300048091	Bacteria	128894
435	Ga0495626_0001760	3300048091	Bacteria	16482
436	Ga0495626_0004920	3300048091	Bacteria	8022
437	Ga0495626_0012763	3300048091	Bacteria	4390
438	Ga0495626_0013403	3300048091	Bacteria	4259
439	Ga0495626_0034689	3300048091	Bacteria	2412
440	Ga0495626_0065628	3300048091	Bacteria	1642
441	Ga0495626_0083020	3300048091	Bacteria	1420
442	Ga0496101_0369913	3300048904	Bacteria	1127
443	Ga0496102_0000312	3300048905	Bacteria	61195
444	Ga0496102_0031161	3300048905	Bacteria	4781
445	Ga0496102_0231056	3300048905	Bacteria	1744
446	Ga0496102_0263346	3300048905	Bacteria	1625
447	Ga0496102_0283523	3300048905	Bacteria	1561
448	Ga0496102_0518457	3300048905	Bacteria	1114
449	Ga0496102_0635191	3300048905	Bacteria	991
450	Ga0496102_0705956	3300048905	Bacteria	931
451	Ga0496103_0001949	3300048906	Bacteria	13341
452	Ga0496103_0292100	3300048906	Bacteria	1048
453	Ga0496104_0151624	3300048907	Bacteria	2225
454	Ga0496106_0624179	3300048909	Bacteria	862
455	Ga0496107_0271857	3300048910	Bacteria	1261
456	Ga0496110_0000083	3300048913	Bacteria	49307
457	Ga0496110_0133677	3300048913	Bacteria	2241
458	Ga0496111_0031790	3300048914	Bacteria	3761
459	Ga0496111_0167539	3300048914	Bacteria	1632
460	Ga0496112_0197841	3300048915	Bacteria	1970
461	Ga0496113_0002631	3300048916	Bacteria	10509
462	Ga0496113_0034390	3300048916	Bacteria	3698
463	Ga0496122_0001305	3300048925	Bacteria	41082
464	Ga0496122_0001426	3300048925	Bacteria	38722
465	Ga0496122_0181190	3300048925	Bacteria	1256
466	Ga0496123_0075176	3300048926	Bacteria	2086
467	Ga0496123_0232735	3300048926	Bacteria	920
468	Ga0496124_0002290	3300048927	Bacteria	25312
469	Ga0496124_0031593	3300048927	Bacteria	4686
470	Ga0496124_0114175	3300048927	Bacteria	2169
471	Ga0496125_0129685	3300048928	Bacteria	1778
472	Ga0495678_000163	3300049459	Bacteria	78292
473	Ga0495678_000349	3300049459	Bacteria	47682
474	Ga0495678_000611	3300049459	Bacteria	33515
475	Ga0495678_001409	3300049459	Bacteria	19049
476	Ga0495678_011945	3300049459	Bacteria	4136
477	Ga0495678_019485	3300049459	Bacteria	3026
478	Ga0495682_0000137	3300049460	Bacteria	63454
479	Ga0495682_0008292	3300049460	Bacteria	4102
480	Ga0495682_0008707	3300049460	Bacteria	3994
481	Ga0495682_0047251	3300049460	Bacteria	1570
482	Ga0501315_014880	3300049531	Unclassified	991
483	Ga0501034_0266458	3300049571	Bacteria	1655
484	Ga0501047_0268987	3300049581	Bacteria	1551
485	Ga0501269_000427	3300049766	Bacteria	9482
486	Ga0501279_000689	3300049775	Bacteria	4428
487	Ga0501035_0000507	3300049822	Bacteria	43979
488	Ga0501044_0132401	3300049823	Bacteria	2487
489	Ga0587083_0004196	3300059505	Bacteria	1981
490	Ga0466962_0076080	3300061719	Bacteria	1604
491	Ga0466962_0155861	3300061719	Bacteria	1109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047447	Ga0495685_015180	Ga0495685_015180_1966_2613	215
2	3300046660	Ga0495625_0438558	Ga0495625_0438558_16_726	236
3	3300046660	Ga0495625_0076601	Ga0495625_0076601_591_1376	247
4	3300046665	Ga0495661_0097679	Ga0495661_0097679_560_1345	247
5	3300044842	Ga0466957_0001161	Ga0466957_0001161_3515_4297	251
6	iso_pu_bacteria	2808606418	2809142843	254
7	3300003322	rootL2_10010637	rootL2_100106379	255
8	3300003763	Ga0055529_1000015	Ga0055529_1000015173	255
9	3300021361	Ga0213872_10008151	Ga0213872_100081511	255
10	3300025272	Ga0209455_1000031	Ga0209455_1000031174	255
11	3300039447	Ga0436361_0888604	Ga0436361_0888604_1382_2152	255
12	iso_pu_bacteria	2643221556	2643800753	255
13	iso_pu_bacteria	2643221684	2644470983	255
14	iso_pu_bacteria	8047673197	8047677365	255
15	3300046616	Ga0495668_0000066	Ga0495668_0000066_87444_88217	256
16	3300047472	Ga0495686_0002019	Ga0495686_0002019_11360_12133	256
17	3300049459	Ga0495678_011945	Ga0495678_011945_1005_1778	256
18	iso_pu_bacteria	2643221645	2644250631	256
19	iso_pu_bacteria	2643221664	2644358943	256
20	iso_pu_bacteria	2738541280	2738738609	256
21	iso_pu_bacteria	2738541300	2738842581	256
22	iso_pu_bacteria	2738543018	2739273328	256
23	iso_pu_bacteria	2738543030	2739342372	256
24	iso_pu_bacteria	2904424332	2904428256	256
25	3300046507	Ga0495606_0000716	Ga0495606_0000716_14874_15647	257
26	3300047470	Ga0495681_0000868	Ga0495681_0000868_4096_4875	257
27	3300048905	Ga0496102_0283523	Ga0496102_0283523_599_1378	257
28	3300048905	Ga0496102_0518457	Ga0496102_0518457_189_968	257
29	3300049459	Ga0495678_001409	Ga0495678_001409_6558_7337	257
30	iso_pu_bacteria	2643221554	2643792468	257
31	iso_pu_bacteria	2643221638	2644217015	257
32	3300025245	Ga0207425_1000441	Ga0207425_100044120	258
33	3300025294	Ga0209025_1007424	Ga0209025_10074244	258
34	3300025297	Ga0209758_1002821	Ga0209758_10028218	258
35	3300030731	Ga0316177_1141274	Ga0316177_11412742	258
36	3300030735	Ga0316178_1165775	Ga0316178_11657752	258
37	3300030736	Ga0316180_1004149	Ga0316180_10041493	258
38	3300030745	Ga0316182_1044098	Ga0316182_10440982	258
39	3300037312	Ga0395899_0000449	Ga0395899_0000449_33178_33960	258
40	3300046452	Ga0495617_055512	Ga0495617_055512_258_1040	258
41	3300046457	Ga0495590_0000070	Ga0495590_0000070_4750_5532	258
42	3300046458	Ga0495591_001252	Ga0495591_001252_47_829	258
43	3300046458	Ga0495591_002786	Ga0495591_002786_4739_5521	258
44	3300046471	Ga0495650_0000062	Ga0495650_0000062_33484_34266	258
45	3300046471	Ga0495650_0000239	Ga0495650_0000239_2865_3647	258
46	3300046471	Ga0495650_0003364	Ga0495650_0003364_1825_2622	258
47	3300046471	Ga0495650_0022287	Ga0495650_0022287_2205_2987	258
48	3300046474	Ga0495605_0015610	Ga0495605_0015610_50_832	258
49	3300046474	Ga0495605_0015999	Ga0495605_0015999_2305_3087	258
50	3300046474	Ga0495605_0019701	Ga0495605_0019701_782_1564	258
51	3300046491	Ga0495584_0000223	Ga0495584_0000223_16174_16956	258
52	3300046491	Ga0495584_0011518	Ga0495584_0011518_1622_2404	258
53	3300046491	Ga0495584_0048038	Ga0495584_0048038_1324_2106	258
54	3300046492	Ga0495585_0027879	Ga0495585_0027879_947_1729	258
55	3300046492	Ga0495585_0114473	Ga0495585_0114473_220_1002	258
56	3300046500	Ga0495596_0010908	Ga0495596_0010908_2623_3405	258
57	3300046500	Ga0495596_0012630	Ga0495596_0012630_1913_2695	258
58	3300046500	Ga0495596_0019299	Ga0495596_0019299_1880_2662	258
59	3300046500	Ga0495596_0037403	Ga0495596_0037403_761_1558	258
60	3300046501	Ga0495607_0007097	Ga0495607_0007097_2390_3172	258
61	3300046501	Ga0495607_0031486	Ga0495607_0031486_777_1559	258
62	3300046501	Ga0495607_0147357	Ga0495607_0147357_71_853	258
63	3300046506	Ga0495583_0000367	Ga0495583_0000367_45495_46277	258
64	3300046506	Ga0495583_0007390	Ga0495583_0007390_1058_1855	258
65	3300046506	Ga0495583_0014951	Ga0495583_0014951_1609_2391	258
66	3300046507	Ga0495606_0091324	Ga0495606_0091324_921_1703	258
67	3300046512	Ga0495610_0005983	Ga0495610_0005983_2971_3753	258
68	3300046513	Ga0495616_0024236	Ga0495616_0024236_877_1659	258
69	3300046513	Ga0495616_0035770	Ga0495616_0035770_1010_1807	258
70	3300046513	Ga0495616_0036439	Ga0495616_0036439_1727_2509	258
71	3300046515	Ga0495620_0068084	Ga0495620_0068084_261_1043	258
72	3300046518	Ga0495631_0008491	Ga0495631_0008491_3774_4556	258
73	3300046518	Ga0495631_0018016	Ga0495631_0018016_2373_3170	258
74	3300046518	Ga0495631_0073992	Ga0495631_0073992_94_876	258
75	3300046518	Ga0495631_0151957	Ga0495631_0151957_85_867	258
76	3300046519	Ga0495632_0006534	Ga0495632_0006534_309_1091	258
77	3300046519	Ga0495632_0031986	Ga0495632_0031986_783_1565	258
78	3300046520	Ga0495637_0000286	Ga0495637_0000286_4754_5536	258
79	3300046520	Ga0495637_0074003	Ga0495637_0074003_423_1205	258
80	3300046520	Ga0495637_0153620	Ga0495637_0153620_55_837	258
81	3300046522	Ga0495643_0006236	Ga0495643_0006236_6255_7037	258
82	3300046522	Ga0495643_0067325	Ga0495643_0067325_1050_1832	258
83	3300046523	Ga0495644_0011537	Ga0495644_0011537_1177_1959	258
84	3300046523	Ga0495644_0049533	Ga0495644_0049533_726_1508	258
85	3300046524	Ga0495648_0005028	Ga0495648_0005028_1071_1853	258
86	3300046524	Ga0495648_0009371	Ga0495648_0009371_3951_4733	258
87	3300046528	Ga0495642_0007934	Ga0495642_0007934_3244_4026	258
88	3300046528	Ga0495642_0050144	Ga0495642_0050144_741_1523	258
89	3300046530	Ga0495654_0005476	Ga0495654_0005476_2747_3529	258
90	3300046538	Ga0495609_0000269	Ga0495609_0000269_2846_3628	258
91	3300046538	Ga0495609_0005109	Ga0495609_0005109_4943_5725	258
92	3300046538	Ga0495609_0012457	Ga0495609_0012457_706_1503	258
93	3300046538	Ga0495609_0038855	Ga0495609_0038855_248_1030	258
94	3300046542	Ga0495597_0000108	Ga0495597_0000108_19235_20017	258
95	3300046558	Ga0495633_0007642	Ga0495633_0007642_658_1440	258
96	3300046616	Ga0495668_0018587	Ga0495668_0018587_1479_2276	258
97	3300046648	Ga0495611_0003158	Ga0495611_0003158_918_1700	258
98	3300046648	Ga0495611_0017450	Ga0495611_0017450_1186_1968	258
99	3300046648	Ga0495611_0122090	Ga0495611_0122090_33_815	258
100	3300046665	Ga0495661_0046490	Ga0495661_0046490_1022_1804	258
101	3300046674	Ga0495588_0053583	Ga0495588_0053583_359_1156	258
102	3300046684	Ga0495669_0027682	Ga0495669_0027682_58_840	258
103	3300046691	Ga0495670_0073615	Ga0495670_0073615_600_1382	258
104	3300046694	Ga0495649_0000093	Ga0495649_0000093_652_1434	258
105	3300046694	Ga0495649_0037236	Ga0495649_0037236_1085_1882	258
106	3300046794	Ga0495589_0019087	Ga0495589_0019087_2306_3088	258
107	3300046794	Ga0495589_0031817	Ga0495589_0031817_1267_2049	258
108	3300046794	Ga0495589_0147217	Ga0495589_0147217_295_1092	258
109	3300046810	Ga0495660_0005291	Ga0495660_0005291_4547_5329	258
110	3300046810	Ga0495660_0174505	Ga0495660_0174505_177_959	258
111	3300047320	Ga0495672_0000217	Ga0495672_0000217_4754_5536	258
112	3300047320	Ga0495672_0002190	Ga0495672_0002190_2829_3611	258
113	3300047320	Ga0495672_0079930	Ga0495672_0079930_85_882	258
114	3300047323	Ga0495683_0000257	Ga0495683_0000257_4754_5536	258
115	3300047323	Ga0495683_0044200	Ga0495683_0044200_782_1579	258
116	3300047323	Ga0495683_0049515	Ga0495683_0049515_305_1087	258
117	3300047323	Ga0495683_0053374	Ga0495683_0053374_517_1299	258
118	3300047445	Ga0495677_0001356	Ga0495677_0001356_1254_2036	258
119	3300047445	Ga0495677_0122043	Ga0495677_0122043_112_894	258
120	3300047446	Ga0495679_005414	Ga0495679_005414_4487_5269	258
121	3300047447	Ga0495685_011141	Ga0495685_011141_1816_2598	258
122	3300047470	Ga0495681_0024929	Ga0495681_0024929_117_899	258
123	3300047472	Ga0495686_0000142	Ga0495686_0000142_84409_85191	258
124	3300048091	Ga0495626_0013403	Ga0495626_0013403_1489_2271	258
125	3300048091	Ga0495626_0083020	Ga0495626_0083020_506_1288	258
126	3300048905	Ga0496102_0000312	Ga0496102_0000312_41085_41867	258
127	3300048905	Ga0496102_0231056	Ga0496102_0231056_774_1556	258
128	3300048906	Ga0496103_0292100	Ga0496103_0292100_89_871	258
129	3300048913	Ga0496110_0000083	Ga0496110_0000083_18682_19464	258
130	3300048914	Ga0496111_0031790	Ga0496111_0031790_2223_3020	258
131	3300049459	Ga0495678_000163	Ga0495678_000163_4779_5561	258
132	3300049459	Ga0495678_019485	Ga0495678_019485_32_814	258
133	3300049460	Ga0495682_0008292	Ga0495682_0008292_3210_3992	258
134	3300049460	Ga0495682_0008707	Ga0495682_0008707_1001_1783	258
135	3300049460	Ga0495682_0047251	Ga0495682_0047251_56_838	258
136	3300003320	rootH2_10325251	rootH2_103252512	259
137	3300003322	rootL2_10028855	rootL2_100288552	259
138	3300005327	Ga0070658_10081373	Ga0070658_100813732	259
139	3300005327	Ga0070658_10204379	Ga0070658_102043792	259
140	3300005327	Ga0070658_10411989	Ga0070658_104119892	259
141	3300005339	Ga0070660_100025765	Ga0070660_1000257652	259
142	3300005339	Ga0070660_100064279	Ga0070660_1000642793	259
143	3300005344	Ga0070661_100066485	Ga0070661_1000664852	259
144	3300005366	Ga0070659_100189372	Ga0070659_1001893722	259
145	3300005539	Ga0068853_100934244	Ga0068853_1009342441	259
146	3300005563	Ga0068855_100219731	Ga0068855_1002197311	259
147	3300005563	Ga0068855_100334363	Ga0068855_1003343632	259
148	3300005577	Ga0068857_100312540	Ga0068857_1003125402	259
149	3300005616	Ga0068852_100413956	Ga0068852_1004139562	259
150	3300011119	Ga0105246_10323594	Ga0105246_103235942	259
151	3300013100	Ga0157373_10242932	Ga0157373_102429322	259
152	3300020070	Ga0206356_11371903	Ga0206356_113719033	259
153	3300020077	Ga0206351_10402272	Ga0206351_104022722	259
154	3300021361	Ga0213872_10002282	Ga0213872_100022824	259
155	3300025230	Ga0209563_100003	Ga0209563_1000031668	259
156	3300025909	Ga0207705_10011290	Ga0207705_100112907	259
157	3300025909	Ga0207705_10092341	Ga0207705_100923412	259
158	3300025911	Ga0207654_10021315	Ga0207654_100213154	259
159	3300025919	Ga0207657_10005662	Ga0207657_100056627	259
160	3300025919	Ga0207657_10091202	Ga0207657_100912022	259
161	3300025920	Ga0207649_10102021	Ga0207649_101020213	259
162	3300025933	Ga0207706_10219431	Ga0207706_102194312	259
163	3300025945	Ga0207679_10024733	Ga0207679_100247335	259
164	3300025945	Ga0207679_10582952	Ga0207679_105829522	259
165	3300025949	Ga0207667_10046955	Ga0207667_100469552	259
166	3300025949	Ga0207667_10263416	Ga0207667_102634162	259
167	3300026116	Ga0207674_10253410	Ga0207674_102534102	259
168	3300032002	Ga0307416_100004603	Ga0307416_1000046038	259
169	3300037312	Ga0395899_0001277	Ga0395899_0001277_761_1546	259
170	3300037312	Ga0395899_0002494	Ga0395899_0002494_13600_14385	259
171	3300037312	Ga0395899_0008439	Ga0395899_0008439_2012_2797	259
172	3300037312	Ga0395899_0026777	Ga0395899_0026777_3116_3901	259
173	3300037312	Ga0395899_0046408	Ga0395899_0046408_1113_1898	259
174	3300037312	Ga0395899_0243626	Ga0395899_0243626_155_940	259
175	3300037418	Ga0395900_0000426	Ga0395900_0000426_18785_19570	259
176	3300037418	Ga0395900_0000525	Ga0395900_0000525_40081_40866	259
177	3300037418	Ga0395900_0006981	Ga0395900_0006981_2519_3304	259
178	3300037418	Ga0395900_0037040	Ga0395900_0037040_4159_4944	259
179	3300037418	Ga0395900_0039245	Ga0395900_0039245_349_1134	259
180	3300037418	Ga0395900_0171228	Ga0395900_0171228_812_1597	259
181	3300037418	Ga0395900_0218055	Ga0395900_0218055_717_1502	259
182	3300037418	Ga0395900_0486781	Ga0395900_0486781_95_880	259
183	3300037418	Ga0395900_0546488	Ga0395900_0546488_156_941	259
184	3300037466	Ga0395898_0002552	Ga0395898_0002552_496_1281	259
185	3300037466	Ga0395898_0082359	Ga0395898_0082359_2208_2993	259
186	3300037466	Ga0395898_0094190	Ga0395898_0094190_904_1689	259
187	3300037466	Ga0395898_0144218	Ga0395898_0144218_196_981	259
188	3300037466	Ga0395898_0223169	Ga0395898_0223169_110_895	259
189	3300037466	Ga0395898_0507679	Ga0395898_0507679_66_851	259
190	3300037471	Ga0395905_0025529	Ga0395905_0025529_4604_5389	259
191	3300037471	Ga0395905_0038879	Ga0395905_0038879_1929_2714	259
192	3300037471	Ga0395905_0063561	Ga0395905_0063561_132_917	259
193	3300037471	Ga0395905_0114201	Ga0395905_0114201_1037_1822	259
194	3300037471	Ga0395905_0411513	Ga0395905_0411513_328_1128	259
195	3300037471	Ga0395905_0485168	Ga0395905_0485168_31_816	259
196	3300038443	Ga0395901_0000159	Ga0395901_0000159_5764_6549	259
197	3300038443	Ga0395901_0001862	Ga0395901_0001862_17353_18138	259
198	3300038443	Ga0395901_0050607	Ga0395901_0050607_3158_3943	259
199	3300038443	Ga0395901_0090770	Ga0395901_0090770_1981_2766	259
200	3300038443	Ga0395901_0243182	Ga0395901_0243182_630_1415	259
201	3300038443	Ga0395901_0279285	Ga0395901_0279285_747_1532	259
202	3300038443	Ga0395901_0421150	Ga0395901_0421150_373_1158	259
203	3300039447	Ga0436361_0302074	Ga0436361_0302074_96459_97256	259
204	3300042005	Ga0439448_0000513	Ga0439448_0000513_4682_5467	259
205	3300042007	Ga0439449_0008382	Ga0439449_0008382_2200_2985	259
206	3300042008	Ga0439450_038336	Ga0439450_038336_94_879	259
207	3300042157	Ga0439458_0011339	Ga0439458_0011339_1022_1807	259
208	3300044656	Ga0466969_0029508	Ga0466969_0029508_1695_2480	259
209	3300044656	Ga0466969_0132298	Ga0466969_0132298_86_871	259
210	3300044656	Ga0466969_0165726	Ga0466969_0165726_170_955	259
211	3300044658	Ga0466972_0001092	Ga0466972_0001092_2124_2909	259
212	3300044683	Ga0466965_0003998	Ga0466965_0003998_5098_5883	259
213	3300044683	Ga0466965_0023265	Ga0466965_0023265_382_1167	259
214	3300044683	Ga0466965_0051023	Ga0466965_0051023_1139_1924	259
215	3300044683	Ga0466965_0094780	Ga0466965_0094780_199_984	259
216	3300044684	Ga0466966_0064839	Ga0466966_0064839_795_1580	259
217	3300044684	Ga0466966_0200199	Ga0466966_0200199_83_868	259
218	3300044693	Ga0466961_0013281	Ga0466961_0013281_1173_1958	259
219	3300044706	Ga0466964_0000040	Ga0466964_0000040_19529_20314	259
220	3300044706	Ga0466964_0000537	Ga0466964_0000537_9478_10263	259
221	3300044719	Ga0466971_0070912	Ga0466971_0070912_483_1268	259
222	3300044735	Ga0466968_0002280	Ga0466968_0002280_4064_4849	259
223	3300044842	Ga0466957_0007135	Ga0466957_0007135_315_1100	259
224	3300044842	Ga0466957_0007500	Ga0466957_0007500_4062_4847	259
225	3300044842	Ga0466957_0304829	Ga0466957_0304829_112_897	259
226	3300044901	Ga0466960_0087210	Ga0466960_0087210_45_830	259
227	3300045049	Ga0466959_0022467	Ga0466959_0022467_3058_3843	259
228	3300045049	Ga0466959_0053243	Ga0466959_0053243_1112_1897	259
229	3300045049	Ga0466959_0155592	Ga0466959_0155592_95_880	259
230	3300045836	Ga0466958_0008286	Ga0466958_0008286_446_1231	259
231	3300045836	Ga0466958_0027946	Ga0466958_0027946_1154_1939	259
232	3300045976	Ga0466967_0005003	Ga0466967_0005003_631_1416	259
233	3300045976	Ga0466967_0021524	Ga0466967_0021524_2283_3068	259
234	3300045976	Ga0466967_0057516	Ga0466967_0057516_2419_3204	259
235	3300046453	Ga0495627_006427	Ga0495627_006427_2990_3775	259
236	3300046457	Ga0495590_0066370	Ga0495590_0066370_156_938	259
237	3300046460	Ga0495638_0005663	Ga0495638_0005663_3852_4634	259
238	3300046460	Ga0495638_0143065	Ga0495638_0143065_379_1164	259
239	3300046474	Ga0495605_0000021	Ga0495605_0000021_45578_46375	259
240	3300046474	Ga0495605_0000104	Ga0495605_0000104_25944_26729	259
241	3300046474	Ga0495605_0022186	Ga0495605_0022186_972_1772	259
242	3300046474	Ga0495605_0089956	Ga0495605_0089956_588_1370	259
243	3300046491	Ga0495584_0002877	Ga0495584_0002877_954_1754	259
244	3300046491	Ga0495584_0005861	Ga0495584_0005861_246_1028	259
245	3300046491	Ga0495584_0006551	Ga0495584_0006551_3766_4551	259
246	3300046491	Ga0495584_0034795	Ga0495584_0034795_492_1277	259
247	3300046491	Ga0495584_0227771	Ga0495584_0227771_63_848	259
248	3300046492	Ga0495585_0009484	Ga0495585_0009484_3810_4610	259
249	3300046492	Ga0495585_0051720	Ga0495585_0051720_478_1278	259
250	3300046492	Ga0495585_0111580	Ga0495585_0111580_589_1386	259
251	3300046499	Ga0495594_0004872	Ga0495594_0004872_3757_4557	259
252	3300046500	Ga0495596_0001875	Ga0495596_0001875_9903_10688	259
253	3300046500	Ga0495596_0012795	Ga0495596_0012795_1029_1814	259
254	3300046500	Ga0495596_0019856	Ga0495596_0019856_1907_2692	259
255	3300046500	Ga0495596_0020889	Ga0495596_0020889_1300_2097	259
256	3300046500	Ga0495596_0029098	Ga0495596_0029098_80_865	259
257	3300046501	Ga0495607_0000407	Ga0495607_0000407_30283_31068	259
258	3300046501	Ga0495607_0000602	Ga0495607_0000602_17868_18653	259
259	3300046501	Ga0495607_0006073	Ga0495607_0006073_2012_2809	259
260	3300046501	Ga0495607_0010265	Ga0495607_0010265_818_1618	259
261	3300046506	Ga0495583_0001306	Ga0495583_0001306_23977_24762	259
262	3300046506	Ga0495583_0002950	Ga0495583_0002950_8782_9567	259
263	3300046506	Ga0495583_0083531	Ga0495583_0083531_486_1268	259
264	3300046507	Ga0495606_0001490	Ga0495606_0001490_19780_20565	259
265	3300046507	Ga0495606_0036456	Ga0495606_0036456_455_1240	259
266	3300046513	Ga0495616_0000319	Ga0495616_0000319_1354_2139	259
267	3300046513	Ga0495616_0005159	Ga0495616_0005159_7019_7801	259
268	3300046513	Ga0495616_0017171	Ga0495616_0017171_1111_1896	259
269	3300046513	Ga0495616_0021842	Ga0495616_0021842_1883_2668	259
270	3300046513	Ga0495616_0064016	Ga0495616_0064016_34_819	259
271	3300046518	Ga0495631_0001413	Ga0495631_0001413_3916_4713	259
272	3300046518	Ga0495631_0003885	Ga0495631_0003885_3581_4381	259
273	3300046518	Ga0495631_0012323	Ga0495631_0012323_2458_3243	259
274	3300046518	Ga0495631_0028569	Ga0495631_0028569_946_1731	259
275	3300046518	Ga0495631_0052304	Ga0495631_0052304_45_845	259
276	3300046519	Ga0495632_0000090	Ga0495632_0000090_19393_20178	259
277	3300046519	Ga0495632_0000107	Ga0495632_0000107_68591_69391	259
278	3300046519	Ga0495632_0000184	Ga0495632_0000184_43813_44610	259
279	3300046522	Ga0495643_0001506	Ga0495643_0001506_865_1650	259
280	3300046522	Ga0495643_0041752	Ga0495643_0041752_953_1753	259
281	3300046522	Ga0495643_0067181	Ga0495643_0067181_740_1540	259
282	3300046524	Ga0495648_0007162	Ga0495648_0007162_717_1514	259
283	3300046524	Ga0495648_0036125	Ga0495648_0036125_231_1016	259
284	3300046524	Ga0495648_0126301	Ga0495648_0126301_353_1153	259
285	3300046528	Ga0495642_0000046	Ga0495642_0000046_46435_47232	259
286	3300046528	Ga0495642_0000227	Ga0495642_0000227_20377_21162	259
287	3300046528	Ga0495642_0010286	Ga0495642_0010286_1153_1953	259
288	3300046528	Ga0495642_0015098	Ga0495642_0015098_673_1470	259
289	3300046528	Ga0495642_0019998	Ga0495642_0019998_1689_2471	259
290	3300046530	Ga0495654_0038490	Ga0495654_0038490_1138_1923	259
291	3300046538	Ga0495609_0000095	Ga0495609_0000095_20137_20922	259
292	3300046538	Ga0495609_0003600	Ga0495609_0003600_5291_6088	259
293	3300046538	Ga0495609_0096113	Ga0495609_0096113_341_1123	259
294	3300046538	Ga0495609_0120619	Ga0495609_0120619_295_1080	259
295	3300046542	Ga0495597_0000138	Ga0495597_0000138_54750_55535	259
296	3300046542	Ga0495597_0000224	Ga0495597_0000224_23596_24381	259
297	3300046542	Ga0495597_0008980	Ga0495597_0008980_1947_2747	259
298	3300046543	Ga0495645_0034590	Ga0495645_0034590_2778_3563	259
299	3300046557	Ga0495622_0011509	Ga0495622_0011509_1980_2765	259
300	3300046558	Ga0495633_0005365	Ga0495633_0005365_3582_4382	259
301	3300046558	Ga0495633_0025625	Ga0495633_0025625_411_1196	259
302	3300046615	Ga0495656_0021582	Ga0495656_0021582_680_1465	259
303	3300046615	Ga0495656_0075574	Ga0495656_0075574_378_1175	259
304	3300046615	Ga0495656_0227211	Ga0495656_0227211_42_827	259
305	3300046616	Ga0495668_0000535	Ga0495668_0000535_5711_6511	259
306	3300046616	Ga0495668_0000884	Ga0495668_0000884_5226_6023	259
307	3300046616	Ga0495668_0002397	Ga0495668_0002397_7487_8287	259
308	3300046616	Ga0495668_0009255	Ga0495668_0009255_130_930	259
309	3300046616	Ga0495668_0060384	Ga0495668_0060384_389_1174	259
310	3300046616	Ga0495668_0094512	Ga0495668_0094512_482_1264	259
311	3300046648	Ga0495611_0001433	Ga0495611_0001433_5597_6397	259
312	3300046648	Ga0495611_0074133	Ga0495611_0074133_266_1063	259
313	3300046660	Ga0495625_0003971	Ga0495625_0003971_8920_9702	259
314	3300046660	Ga0495625_0065858	Ga0495625_0065858_341_1126	259
315	3300046664	Ga0495659_0001072	Ga0495659_0001072_6491_7273	259
316	3300046665	Ga0495661_0000012	Ga0495661_0000012_192134_192919	259
317	3300046665	Ga0495661_0000623	Ga0495661_0000623_18881_19681	259
318	3300046665	Ga0495661_0000848	Ga0495661_0000848_3877_4677	259
319	3300046665	Ga0495661_0001245	Ga0495661_0001245_13069_13851	259
320	3300046665	Ga0495661_0006957	Ga0495661_0006957_6825_7622	259
321	3300046665	Ga0495661_0019717	Ga0495661_0019717_2765_3550	259
322	3300046665	Ga0495661_0035986	Ga0495661_0035986_955_1755	259
323	3300046665	Ga0495661_0050090	Ga0495661_0050090_1510_2295	259
324	3300046665	Ga0495661_0101027	Ga0495661_0101027_609_1394	259
325	3300046674	Ga0495588_0000118	Ga0495588_0000118_32015_32800	259
326	3300046674	Ga0495588_0052610	Ga0495588_0052610_1255_2040	259
327	3300046684	Ga0495669_0000125	Ga0495669_0000125_23023_23808	259
328	3300046684	Ga0495669_0001362	Ga0495669_0001362_7801_8583	259
329	3300046684	Ga0495669_0017440	Ga0495669_0017440_1540_2337	259
330	3300046684	Ga0495669_0047797	Ga0495669_0047797_955_1752	259
331	3300046684	Ga0495669_0139742	Ga0495669_0139742_41_826	259
332	3300046689	Ga0495613_0152529	Ga0495613_0152529_387_1172	259
333	3300046691	Ga0495670_0006222	Ga0495670_0006222_1278_2078	259
334	3300046691	Ga0495670_0037021	Ga0495670_0037021_727_1512	259
335	3300046692	Ga0495671_0000245	Ga0495671_0000245_1489_2286	259
336	3300046692	Ga0495671_0001464	Ga0495671_0001464_13592_14377	259
337	3300046692	Ga0495671_0006267	Ga0495671_0006267_5147_5932	259
338	3300046692	Ga0495671_0060307	Ga0495671_0060307_822_1604	259
339	3300046694	Ga0495649_0005345	Ga0495649_0005345_327_1109	259
340	3300046794	Ga0495589_0000007	Ga0495589_0000007_191774_192559	259
341	3300046794	Ga0495589_0000082	Ga0495589_0000082_60638_61423	259
342	3300046794	Ga0495589_0000182	Ga0495589_0000182_18722_19507	259
343	3300046794	Ga0495589_0022250	Ga0495589_0022250_351_1148	259
344	3300046810	Ga0495660_0000297	Ga0495660_0000297_19145_19930	259
345	3300046810	Ga0495660_0039205	Ga0495660_0039205_1259_2041	259
346	3300046810	Ga0495660_0067509	Ga0495660_0067509_386_1171	259
347	3300047315	Ga0495581_0154968	Ga0495581_0154968_334_1131	259
348	3300047318	Ga0495636_0005611	Ga0495636_0005611_713_1495	259
349	3300047320	Ga0495672_0000978	Ga0495672_0000978_22757_23542	259
350	3300047320	Ga0495672_0001203	Ga0495672_0001203_13061_13861	259
351	3300047320	Ga0495672_0006396	Ga0495672_0006396_7376_8161	259
352	3300047321	Ga0495676_0000082	Ga0495676_0000082_30254_31039	259
353	3300047323	Ga0495683_0007369	Ga0495683_0007369_516_1301	259
354	3300047323	Ga0495683_0051172	Ga0495683_0051172_966_1751	259
355	3300047323	Ga0495683_0053365	Ga0495683_0053365_693_1478	259
356	3300047443	Ga0495687_000003	Ga0495687_000003_317814_318599	259
357	3300047443	Ga0495687_000016	Ga0495687_000016_65648_66433	259
358	3300047443	Ga0495687_000108	Ga0495687_000108_122404_123204	259
359	3300047443	Ga0495687_000661	Ga0495687_000661_15437_16222	259
360	3300047443	Ga0495687_000962	Ga0495687_000962_18955_19740	259
361	3300047443	Ga0495687_044421	Ga0495687_044421_883_1665	259
362	3300047445	Ga0495677_0000005	Ga0495677_0000005_84108_84893	259
363	3300047445	Ga0495677_0000303	Ga0495677_0000303_8203_8988	259
364	3300047445	Ga0495677_0001334	Ga0495677_0001334_6863_7645	259
365	3300047445	Ga0495677_0006615	Ga0495677_0006615_36_833	259
366	3300047445	Ga0495677_0009804	Ga0495677_0009804_1412_2212	259
367	3300047446	Ga0495679_015878	Ga0495679_015878_991_1773	259
368	3300047446	Ga0495679_031713	Ga0495679_031713_524_1324	259
369	3300047470	Ga0495681_0000407	Ga0495681_0000407_16377_17162	259
370	3300047470	Ga0495681_0002292	Ga0495681_0002292_1830_2630	259
371	3300047470	Ga0495681_0006289	Ga0495681_0006289_3156_3938	259
372	3300047470	Ga0495681_0006765	Ga0495681_0006765_6003_6788	259
373	3300048091	Ga0495626_0000081	Ga0495626_0000081_19353_20138	259
374	3300048091	Ga0495626_0001760	Ga0495626_0001760_3531_4316	259
375	3300048091	Ga0495626_0004920	Ga0495626_0004920_6443_7228	259
376	3300048091	Ga0495626_0012763	Ga0495626_0012763_3432_4232	259
377	3300048091	Ga0495626_0034689	Ga0495626_0034689_782_1567	259
378	3300048091	Ga0495626_0065628	Ga0495626_0065628_807_1592	259
379	3300048904	Ga0496101_0369913	Ga0496101_0369913_253_1107	259
380	3300048905	Ga0496102_0031161	Ga0496102_0031161_1741_2526	259
381	3300048905	Ga0496102_0263346	Ga0496102_0263346_622_1407	259
382	3300048905	Ga0496102_0635191	Ga0496102_0635191_73_927	259
383	3300048905	Ga0496102_0705956	Ga0496102_0705956_136_921	259
384	3300048907	Ga0496104_0151624	Ga0496104_0151624_1414_2199	259
385	3300048909	Ga0496106_0624179	Ga0496106_0624179_49_834	259
386	3300048910	Ga0496107_0271857	Ga0496107_0271857_414_1199	259
387	3300048913	Ga0496110_0133677	Ga0496110_0133677_1321_2175	259
388	3300048914	Ga0496111_0167539	Ga0496111_0167539_131_916	259
389	3300048915	Ga0496112_0197841	Ga0496112_0197841_402_1187	259
390	3300048916	Ga0496113_0002631	Ga0496113_0002631_4121_4906	259
391	3300048916	Ga0496113_0034390	Ga0496113_0034390_1610_2395	259
392	3300048925	Ga0496122_0001305	Ga0496122_0001305_23516_24301	259
393	3300048925	Ga0496122_0001426	Ga0496122_0001426_4516_5301	259
394	3300048925	Ga0496122_0181190	Ga0496122_0181190_393_1178	259
395	3300048926	Ga0496123_0075176	Ga0496123_0075176_1120_1905	259
396	3300048926	Ga0496123_0232735	Ga0496123_0232735_77_862	259
397	3300048927	Ga0496124_0002290	Ga0496124_0002290_4716_5501	259
398	3300048927	Ga0496124_0031593	Ga0496124_0031593_2786_3571	259
399	3300048927	Ga0496124_0114175	Ga0496124_0114175_1321_2106	259
400	3300048928	Ga0496125_0129685	Ga0496125_0129685_55_840	259
401	3300049459	Ga0495678_000349	Ga0495678_000349_19240_20025	259
402	3300049459	Ga0495678_000611	Ga0495678_000611_15403_16188	259
403	3300049460	Ga0495682_0000137	Ga0495682_0000137_43458_44243	259
404	3300049571	Ga0501034_0266458	Ga0501034_0266458_315_1100	259
405	3300049581	Ga0501047_0268987	Ga0501047_0268987_634_1419	259
406	3300049822	Ga0501035_0000507	Ga0501035_0000507_19232_20017	259
407	3300049823	Ga0501044_0132401	Ga0501044_0132401_971_1756	259
408	3300059505	Ga0587083_0004196	Ga0587083_0004196_1007_1792	259
409	3300061719	Ga0466962_0076080	Ga0466962_0076080_538_1323	259
410	3300061719	Ga0466962_0155861	Ga0466962_0155861_309_1094	259
411	3300046501	Ga0495607_0075657	Ga0495607_0075657_77_859	260
412	3300046507	Ga0495606_0023208	Ga0495606_0023208_635_1417	260
413	3300046507	Ga0495606_0037170	Ga0495606_0037170_724_1506	260
414	3300046530	Ga0495654_0003066	Ga0495654_0003066_582_1364	260
415	3300046538	Ga0495609_0007187	Ga0495609_0007187_2306_3088	260
416	3300046660	Ga0495625_0241632	Ga0495625_0241632_245_1027	260
417	3300046664	Ga0495659_0000277	Ga0495659_0000277_16807_17589	260
418	3300046692	Ga0495671_0000924	Ga0495671_0000924_16631_17413	260
419	3300046810	Ga0495660_0000419	Ga0495660_0000419_21909_22691	260
420	3300047320	Ga0495672_0000026	Ga0495672_0000026_138441_139223	260
421	3300047472	Ga0495686_0005828	Ga0495686_0005828_3486_4268	260
422	3300048906	Ga0496103_0001949	Ga0496103_0001949_3445_4227	260
423	3300002738	JGI25154J39366_1006334	JGI25154J39366_10063342	261
424	3300002739	JGI25158J39367_1018553	JGI25158J39367_10185531	261
425	3300002773	JGI25152J39213_1000723	JGI25152J39213_100072313	261
426	3300002773	JGI25152J39213_1013050	JGI25152J39213_10130502	261
427	3300002774	JGI25150J39212_1000767	JGI25150J39212_10007672	261
428	3300002774	JGI25150J39212_1013558	JGI25150J39212_10135582	261
429	3300002987	JGI25159J45721_1007183	JGI25159J45721_10071832	261
430	3300003215	JGI25153J46596_10005346	JGI25153J46596_100053468	261
431	3300003354	JGI25160J50197_1007343	JGI25160J50197_10073434	261
432	3300003374	JGI25161J50226_1003893	JGI25161J50226_10038932	261
433	3300003374	JGI25161J50226_1006769	JGI25161J50226_10067692	261
434	3300003771	Ga0055526_1000007	Ga0055526_1000007205	261
435	3300003773	Ga0055537_1011898	Ga0055537_10118982	261
436	3300003775	Ga0055524_1005870	Ga0055524_10058702	261
437	3300003775	Ga0055524_1007246	Ga0055524_10072466	261
438	3300003775	Ga0055524_1007679	Ga0055524_10076794	261
439	3300003784	Ga0055534_1010752	Ga0055534_10107522	261
440	3300003784	Ga0055534_1013871	Ga0055534_10138712	261
441	3300003790	Ga0055528_1008085	Ga0055528_10080854	261
442	3300003791	Ga0055530_10003208	Ga0055530_100032087	261
443	3300003791	Ga0055530_10021760	Ga0055530_100217602	261
444	3300003794	Ga0055531_10028731	Ga0055531_100287312	261
445	3300003794	Ga0055531_10037971	Ga0055531_100379711	261
446	3300004625	Ga0055543_1003159	Ga0055543_10031596	261
447	3300005262	Ga0065165_1008059	Ga0065165_10080596	261
448	3300006177	Ga0075362_10164043	Ga0075362_101640432	261
449	3300009036	Ga0105244_10000345	Ga0105244_1000034511	261
450	3300025208	Ga0209436_100505	Ga0209436_1005056	261
451	3300025233	Ga0209437_103153	Ga0209437_1031534	261
452	3300025245	Ga0207425_1000009	Ga0207425_1000009173	261
453	3300025245	Ga0207425_1000036	Ga0207425_1000036135	261
454	3300025246	Ga0209646_1000042	Ga0209646_1000042293	261
455	3300025258	Ga0209129_1000051	Ga0209129_100005196	261
456	3300025258	Ga0209129_1006078	Ga0209129_10060782	261
457	3300025263	Ga0209565_1000662	Ga0209565_10006627	261
458	3300025263	Ga0209565_1009395	Ga0209565_10093953	261
459	3300025273	Ga0209673_1015785	Ga0209673_10157854	261
460	3300025284	Ga0209130_1000827	Ga0209130_100082717	261
461	3300025284	Ga0209130_1002733	Ga0209130_10027332	261
462	3300025291	Ga0209675_1000839	Ga0209675_10008397	261
463	3300025291	Ga0209675_1006241	Ga0209675_10062414	261
464	3300025295	Ga0209564_1000010	Ga0209564_1000010470	261
465	3300025295	Ga0209564_1000172	Ga0209564_100017298	261
466	3300025295	Ga0209564_1002005	Ga0209564_10020058	261
467	3300025295	Ga0209564_1040763	Ga0209564_10407632	261
468	3300025297	Ga0209758_1000054	Ga0209758_1000054173	261
469	3300025298	Ga0209050_1000309	Ga0209050_10003093	261
470	3300025298	Ga0209050_1025928	Ga0209050_10259282	261
471	3300025299	Ga0209256_1000307	Ga0209256_10003077	261
472	3300025299	Ga0209256_1000553	Ga0209256_10005538	261
473	3300025299	Ga0209256_1001318	Ga0209256_100131825	261
474	3300025302	Ga0207426_1001267	Ga0207426_100126710	261
475	3300025304	Ga0209257_1000054	Ga0209257_1000054398	261
476	3300025304	Ga0209257_1008490	Ga0209257_10084902	261
477	3300030744	Ga0316181_1039056	Ga0316181_10390562	261
478	3300031548	Ga0307408_100001520	Ga0307408_1000015208	261
479	3300031548	Ga0307408_100010579	Ga0307408_1000105792	261
480	3300031548	Ga0307408_100089106	Ga0307408_1000891063	261
481	3300031548	Ga0307408_100139637	Ga0307408_1001396372	261
482	3300031711	Ga0265314_10036878	Ga0265314_100368784	261
483	3300046457	Ga0495590_0000012	Ga0495590_0000012_183367_184152	261
484	3300046460	Ga0495638_0000047	Ga0495638_0000047_134014_134799	261
485	3300046471	Ga0495650_0000128	Ga0495650_0000128_160599_161387	261
486	3300046471	Ga0495650_0000868	Ga0495650_0000868_20409_21194	261
487	3300046475	Ga0495639_0006284	Ga0495639_0006284_3956_4741	261
488	3300046506	Ga0495583_0000092	Ga0495583_0000092_78813_79598	261
489	3300046507	Ga0495606_0000826	Ga0495606_0000826_1603_2391	261
490	3300046522	Ga0495643_0000237	Ga0495643_0000237_67146_67931	261
491	3300046524	Ga0495648_0000019	Ga0495648_0000019_192179_192964	261
492	3300046528	Ga0495642_0002402	Ga0495642_0002402_4024_4809	261
493	3300046528	Ga0495642_0063945	Ga0495642_0063945_443_1231	261
494	3300046542	Ga0495597_0000075	Ga0495597_0000075_66983_67768	261
495	3300046557	Ga0495622_0000019	Ga0495622_0000019_105016_105804	261
496	3300046557	Ga0495622_0000037	Ga0495622_0000037_84055_84840	261
497	3300046558	Ga0495633_0000086	Ga0495633_0000086_25073_25858	261
498	3300046616	Ga0495668_0001041	Ga0495668_0001041_13615_14400	261
499	3300046660	Ga0495625_0000208	Ga0495625_0000208_14938_15723	261
500	3300046660	Ga0495625_0022128	Ga0495625_0022128_252_1037	261
501	3300046810	Ga0495660_0073862	Ga0495660_0073862_779_1564	261
502	3300049531	Ga0501315_014880	Ga0501315_014880_102_893	261
503	3300049766	Ga0501269_000427	Ga0501269_000427_7734_8519	261
504	3300049775	Ga0501279_000689	Ga0501279_000689_2786_3577	261

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5hz4-assembly1.cif.gz_D	the structural and biochemical characterization of acyl-coa hydrolase mutant thr60ala from staphylococcus aureus.	0.6051	201	257
1ozb-assembly2.cif.gz_G	crystal structure of secb complexed with seca c-terminus	0.5946	207	255
1qyn-assembly1.cif.gz_C	crystal structure of secb from escherichia coli	0.5845	205	256
1ozb-assembly1.cif.gz_A	crystal structure of secb complexed with seca c-terminus	0.579	207	257
5egl-assembly1.cif.gz_A	the structural and biochemical characterization of acyl-coa hydrolase from staphylococcus aureus in complex with butyryl coenzyme a, coenzyme a, and coenzyme a disulfide	0.4951	201	257

ID	Description	Score	Start	End	Superfamily
1qynD00	Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like	0.562	205	257	3.10.420.10
af_Q2FXN7_206_320_3.30.450.20	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain	0.5484	207	247	3.30.450.20
af_P32074_820_932_3.30.310.10	Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein	0.5458	207	256	3.30.310.10
af_Q98TW1_253_374_3.30.450.20	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain	0.5243	207	253	3.30.450.20
af_Q551X9_170_281_3.30.450.20	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain	0.5172	207	247	3.30.450.20

ID	Description	Score	Start	End
AF-A0A0X8GQ59-F1-model_v4	DUF2491 domain-containing protein	0.8704	1	261
AF-A0A0X8GQ59-F1-model_v4	DUF2491 domain-containing protein	0.8671	1	261
AF-A0A124WS69-F1-model_v4	deleted	0.8472	3	261
AF-A0A0F6L6J1-F1-model_v4	deleted	0.8432	1	261
AF-A0A1Y2ZZS6-F1-model_v4	DUF2491 domain-containing protein	0.8432	9	261

Feature Viewer

pLDDT	pTM	Quality
84.99	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F456255

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map