F456121

General Info

Members Datasets Scaffolds Average Seq Length
504 460 188 327

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10003819|JGI24740J21852_100038194
Length 362
Sequence VSVWLAAPDIFLRRDNPSEAVEIAARSKPCRGFPVENHSLVQRLIARPEFGPFVLLIVEIGVFWGFNHDFLSPQNISNTLAFTVELGLIALAMTLLMTSGEFDLSVGSLFGFSPVLMWTLFNSGVTSLEMGFVAALVVAALIGLVNGWFVTQLKIPSFLVTLGMLLVVRGSALFITDGFPQRTWSAEGSWLAEALVGDFFIGPFRIYMSLFWFIAAAIALGYVLTQSRTGNWIQAAGGNPNAARARGVNVNRVKIGLFVLSSLMASLAGVISSLRTSAANPNSGTGYELEVIAMVVIGGTALTGGRGTIIGTVLGILILRVMRNGIVLIGVPGLAYNIFIGAIILGMMALHSWLERRHQAGT

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
14 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
15 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
16 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
17 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
18 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
19 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
20 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
21 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
22 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
23 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
24 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
25 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
26 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
27 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
28 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
29 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
30 2791355262 Rhizobium sp. M1 Isolate Nodule
31 2791355264 Rhizobium sp. S9 Isolate Nodule
32 2791355265 Rhizobium sp. H4 Isolate Nodule
33 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
34 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
35 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
36 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
37 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
38 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
39 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
40 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
41 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
42 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
43 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
44 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
45 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
46 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
47 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
48 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
49 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
50 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
51 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
52 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
53 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
54 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
55 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
56 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
57 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
58 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
59 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
60 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
61 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
62 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
63 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
64 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
65 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
66 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
67 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
68 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
69 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
70 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
71 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
72 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
73 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
74 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
75 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
76 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
77 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
78 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
79 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
80 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
81 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
82 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
83 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
84 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
85 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
86 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
87 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
88 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
89 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
90 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
91 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
92 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
93 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
94 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
95 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
96 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
97 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
98 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
99 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
100 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
101 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
102 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
103 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
104 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
105 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
106 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
107 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
108 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
109 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
110 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
111 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
112 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
113 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
114 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
115 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
116 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
117 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
118 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
119 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
120 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
121 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
122 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
123 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
124 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
125 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
126 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
127 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
128 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
129 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
130 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
131 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
132 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
133 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
134 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
135 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
136 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
137 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
138 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
139 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
140 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
141 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
142 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
143 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
144 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
145 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
146 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
147 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
148 2909042592 Labrys sp. LIt4 Isolate Nodule
149 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
150 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
151 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
152 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
153 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
154 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
155 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
156 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
157 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
158 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
159 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
160 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
161 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
162 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
163 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
164 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
165 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
166 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
167 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
168 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
169 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
170 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
171 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
172 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
173 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
174 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
175 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
176 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
177 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
178 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
179 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
180 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
181 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
182 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
183 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
184 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
185 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
186 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
187 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
188 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
189 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
190 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
191 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
192 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
193 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
194 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
195 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
196 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
197 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
198 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
199 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
200 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
201 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
202 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
203 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
204 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
205 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
206 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
207 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
208 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
209 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
210 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
211 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
212 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
213 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
214 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
215 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
216 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
217 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
218 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
219 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
220 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
221 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
222 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
223 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
224 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
225 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
226 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
227 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
228 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
229 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
230 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
231 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
232 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
233 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
234 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
235 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
236 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
237 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
238 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
239 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
240 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
241 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
242 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
243 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
244 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
245 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
246 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
247 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
248 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
249 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
250 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
251 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
252 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
253 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
254 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
255 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
256 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
257 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
258 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
259 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
260 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
261 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
262 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
263 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
264 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
265 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
266 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
267 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
268 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
269 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
270 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
271 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
272 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
273 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
274 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
275 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
276 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
277 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
278 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
279 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
280 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
281 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
282 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
283 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
284 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
285 3004167301 Mesorhizobium loti 582 Isolate Unclassified
286 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
287 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
288 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
289 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
290 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
291 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
292 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
293 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
294 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
295 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
296 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
297 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
298 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
299 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
300 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
301 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
302 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
303 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
304 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
305 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
306 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
307 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
308 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
309 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
310 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
311 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
312 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
313 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
314 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
315 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
316 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
317 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
318 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
319 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
320 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
321 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
322 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
323 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
324 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
325 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
326 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
327 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
328 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
329 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
330 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
331 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
332 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
333 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
334 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
335 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
336 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
337 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
338 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
339 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
340 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
341 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
342 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
343 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
344 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
345 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
346 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
347 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
348 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
350 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
351 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
353 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
355 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
356 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
369 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
370 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
373 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
376 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
377 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
378 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
379 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
380 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
381 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
382 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
383 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
384 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
385 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
386 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
387 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
388 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
389 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
390 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
391 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
392 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
393 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
394 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
407 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
408 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
409 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
423 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
424 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
425 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
429 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
430 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
431 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
432 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
433 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
434 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
435 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
436 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
437 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
438 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
439 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
442 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
443 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
444 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
445 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
446 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
447 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
448 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
449 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
450 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
451 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
452 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
453 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
454 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
455 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
456 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
457 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
458 8024501048 Rhizobium sp. H4 Isolate Nodule
459 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
460 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.3
Metatranscriptomes 0
Isolates 62.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 57.34
Rhizoplane 1.39
Rhizosphere 23.61
Stem 0
Stem Tuber 0
Unclassified 9.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003819 3300001979 Bacteria 6552
2 JGI24739J22299_10009320 3300001989 Bacteria 3662
3 JGI24735J21928_10033067 3300002067 Bacteria 1529
4 JGI25156J39149_1004951 3300002705 Bacteria 3943
5 JGI25157J39369_1000658 3300002741 Bacteria 19133
6 JGI25151J46595_10000143 3300003187 Bacteria 95160
7 JGI25165J46597_1000016 3300003214 Bacteria 377866
8 JGI25160J50197_1002298 3300003354 Bacteria 8960
9 JGI25161J50226_1000060 3300003374 Bacteria 101859
10 Ga0055542_1000172 3300003762 Bacteria 80034
11 Ga0055543_1000557 3300004625 Bacteria 20786
12 Ga0065165_1000208 3300005262 Bacteria 101897
13 Ga0070658_10073660 3300005327 Bacteria 2801
14 Ga0070668_100009387 3300005347 Bacteria 7257
15 Ga0070709_10064111 3300005434 Bacteria 2349
16 Ga0070709_10198926 3300005434 Bacteria 1418
17 Ga0068867_100166434 3300005459 Bacteria 1742
18 Ga0070706_100000903 3300005467 Bacteria 32487
19 Ga0068853_100044126 3300005539 Bacteria 3816
20 Ga0070665_100062647 3300005548 Bacteria 3729
21 Ga0070665_100108725 3300005548 Bacteria 2775
22 Ga0068855_100129294 3300005563 Bacteria 2886
23 Ga0068857_100297866 3300005577 Bacteria 1486
24 Ga0081538_10016270 3300005981 Bacteria 5713
25 Ga0081540_1028353 3300005983 Bacteria 3146
26 Ga0081539_10019710 3300005985 Bacteria 4600
27 Ga0075364_10079837 3300006051 Bacteria 2162
28 Ga0070716_100088043 3300006173 Bacteria 1872
29 Ga0070712_100199156 3300006175 Bacteria 1572
30 Ga0075367_10047009 3300006178 Bacteria 2537
31 Ga0075428_100523798 3300006844 Bacteria 1268
32 Ga0075434_100058742 3300006871 Bacteria 3823
33 Ga0079104_1018646 3300006946 Bacteria 1961
34 Ga0105240_10073191 3300009093 Bacteria 4231
35 Ga0105240_10331822 3300009093 Bacteria 1730
36 Ga0111539_10003929 3300009094 Bacteria 19536
37 Ga0114129_10465832 3300009147 Bacteria 1656
38 Ga0105241_10196136 3300009174 Bacteria 1684
39 Ga0105237_10211012 3300009545 Bacteria 1942
40 Ga0105237_10237502 3300009545 Bacteria 1824
41 Ga0105238_10260864 3300009551 Bacteria 1712
42 Ga0105239_10070690 3300010375 Bacteria 3834
43 Ga0105239_10117386 3300010375 Bacteria 2953
44 Ga0105239_10187282 3300010375 Bacteria 2316
45 Ga0105239_10296984 3300010375 Bacteria 1819
46 Ga0157370_10153385 3300013104 Bacteria 2143
47 Ga0157369_10234017 3300013105 Bacteria 1920
48 Ga0157372_10261599 3300013307 Bacteria 2009
49 Ga0182008_10121941 3300014497 Bacteria 1296
50 Ga0157376_10308387 3300014969 Bacteria 1501
51 Ga0182005_1003743 3300015265 Bacteria 5067
52 Ga0213872_10034793 3300021361 Unclassified 2305
53 Ga0213872_10124400 3300021361 Bacteria 1139
54 Ga0213871_10030989 3300021441 Bacteria 1394
55 Ga0228711_1000008 3300022739 Bacteria 169893
56 Ga0228710_1000009 3300022740 Bacteria 169770
57 Ga0209646_1004988 3300025246 Bacteria 2361
58 Ga0209026_1000005 3300025250 Bacteria 731387
59 Ga0209148_1000057 3300025254 Bacteria 360463
60 Ga0209759_1000265 3300025256 Bacteria 75472
61 Ga0209233_1000068 3300025261 Bacteria 377969
62 Ga0209233_1009315 3300025261 Bacteria 2994
63 Ga0209455_1000240 3300025272 Bacteria 68476
64 Ga0209130_1000152 3300025284 Bacteria 105768
65 Ga0209130_1000160 3300025284 Bacteria 100965
66 Ga0209025_1002435 3300025294 Bacteria 19728
67 Ga0209758_1035647 3300025297 Bacteria 1957
68 Ga0207426_1000017 3300025302 Bacteria 577913
69 Ga0207426_1000098 3300025302 Bacteria 264264
70 Ga0207645_10044841 3300025907 Bacteria 2828
71 Ga0207684_10001498 3300025910 Bacteria 25082
72 Ga0207695_10056106 3300025913 Bacteria 4101
73 Ga0207695_10117916 3300025913 Bacteria 2626
74 Ga0207671_10151364 3300025914 Bacteria 1792
75 Ga0207671_10201639 3300025914 Bacteria 1554
76 Ga0207693_10304197 3300025915 Bacteria 1249
77 Ga0207694_10029700 3300025924 Bacteria 4172
78 Ga0207709_10037823 3300025935 Bacteria 2869
79 Ga0207639_10027120 3300026041 Bacteria 4169
80 Ga0207639_10031501 3300026041 Bacteria 3898
81 Ga0207641_10428716 3300026088 Bacteria 1275
82 Ga0207648_10171058 3300026089 Bacteria 1920
83 Ga0207674_10188055 3300026116 Bacteria 2015
84 Ga0207698_10179643 3300026142 Bacteria 1873
85 Ga0209281_1000106 3300027111 Bacteria 219666
86 Ga0209282_1000024 3300027666 Bacteria 170348
87 Ga0207428_10000040 3300027907 Bacteria 210887
88 Ga0268266_10013730 3300028379 Bacteria 6975
89 Ga0268266_10157381 3300028379 Bacteria 2053
90 Ga0307515_10000556 3300028794 Bacteria 88174
91 Ga0307515_10165450 3300028794 Bacteria 2232
92 Ga0265338_10284936 3300028800 Bacteria 1206
93 Ga0307513_10023165 3300031456 Bacteria 7263
94 Ga0307408_100085324 3300031548 Bacteria 2371
95 Ga0307508_10064901 3300031616 Bacteria 3218
96 Ga0307508_10195706 3300031616 Bacteria 1623
97 Ga0315914_1000012 3300031967 Bacteria 169896
98 Ga0315913_1000006 3300033430 Bacteria 169893
99 Ga0315915_1000010 3300033464 Bacteria 240214
100 Ga0395900_0041285 3300037418 Bacteria 4756
101 Ga0395900_0294625 3300037418 Bacteria 1610
102 Ga0395905_0001657 3300037471 Bacteria 26314
103 Ga0395905_0039764 3300037471 Bacteria 4413
104 Ga0395905_0109274 3300037471 Bacteria 2596
105 Ga0395905_0227588 3300037471 Bacteria 1744
106 Ga0395901_0099852 3300038443 Bacteria 3044
107 Ga0395901_0136281 3300038443 Bacteria 2580
108 Ga0436365_1359767 3300039437 Bacteria 3151
109 Ga0436360_0574478 3300039438 Bacteria 3821
110 Ga0436360_1172893 3300039438 Bacteria 3136
111 Ga0436360_1357309 3300039438 Bacteria 2476
112 Ga0436361_0377086 3300039447 Bacteria 1221
113 Ga0436361_0636144 3300039447 Bacteria 4151
114 Ga0436363_0512178 3300039450 Bacteria 10117
115 Ga0436363_1029093 3300039450 Bacteria 1764
116 Ga0436363_1691131 3300039450 Bacteria 3518
117 Ga0436362_0314543 3300039453 Bacteria 2179
118 Ga0436362_0729508 3300039453 Bacteria 1460
119 Ga0439465_0006350 3300041413 Bacteria 3755
120 Ga0439431_0007564 3300041997 Bacteria 2425
121 Ga0439458_0018743 3300042157 Bacteria 1588
122 Ga0466966_0113315 3300044684 Bacteria 1670
123 Ga0466971_0019499 3300044719 Bacteria 3013
124 Ga0466959_0094007 3300045049 Bacteria 2151
125 Ga0495638_0061834 3300046460 Bacteria 2312
126 Ga0495638_0109809 3300046460 Bacteria 1639
127 Ga0495610_0020112 3300046512 Bacteria 3714
128 Ga0495643_0058570 3300046522 Bacteria 2050
129 Ga0495625_0060810 3300046660 Bacteria 2675
130 Ga0495625_0083532 3300046660 Bacteria 2220
131 Ga0495660_0134509 3300046810 Bacteria 1237
132 Ga0495687_028676 3300047443 Bacteria 2586
133 Ga0495681_0113457 3300047470 Bacteria 1171
134 Ga0496102_0402704 3300048905 Bacteria 1286
135 Ga0496104_0070718 3300048907 Bacteria 3318
136 Ga0496110_0447524 3300048913 Bacteria 1177
137 Ga0496112_0066442 3300048915 Bacteria 3558
138 Ga0496113_0125996 3300048916 Bacteria 2006
139 Ga0496113_0183134 3300048916 Bacteria 1661
140 Ga0496118_0130278 3300048921 Bacteria 1617
141 Ga0496119_0041366 3300048922 Bacteria 2936
142 Ga0496120_0002038 3300048923 Bacteria 21901
143 Ga0496121_0069235 3300048924 Bacteria 2849
144 Ga0496121_0162894 3300048924 Bacteria 1629
145 Ga0496125_0111253 3300048928 Bacteria 1982
146 Ga0496126_0221959 3300048929 Bacteria 1587
147 Ga0501031_0107966 3300049568 Bacteria 1817
148 Ga0501033_0021328 3300049570 Bacteria 4886
149 Ga0501034_0026740 3300049571 Bacteria 5871
150 Ga0501034_0217782 3300049571 Bacteria 1862
151 Ga0501034_0361612 3300049571 Bacteria 1378
152 Ga0501036_0090149 3300049572 Bacteria 2590
153 Ga0501038_0125339 3300049574 Bacteria 2114
154 Ga0501043_0088329 3300049579 Bacteria 2436
155 Ga0501046_0277355 3300049580 Bacteria 1229
156 Ga0501047_0036407 3300049581 Bacteria 4756
157 Ga0501047_0141117 3300049581 Bacteria 2288
158 Ga0501069_0049661 3300049585 Bacteria 2332
159 Ga0501070_0142149 3300049586 Bacteria 1981
160 Ga0501073_0028413 3300049589 Bacteria 3997
161 Ga0501077_0276945 3300049593 Bacteria 1068
162 Ga0501080_0032210 3300049742 Bacteria 4887
163 Ga0501080_0165415 3300049742 Bacteria 2041
164 Ga0501080_0168456 3300049742 Bacteria 2021
165 Ga0501083_0014024 3300049744 Bacteria 5601
166 Ga0501044_0144377 3300049823 Bacteria 2366
167 nmdc:mga00v17_24641_c1 3300050491 Bacteria 3491
168 nmdc:mga0yw44_33592_c1 3300050492 Bacteria 2998
169 nmdc:mga0yw44_9520_c1 3300050492 Bacteria 4920
170 nmdc:mga06z11_51985_c1 3300050494 Bacteria 2100
171 nmdc:mga07m45_40309_c1 3300050496 Bacteria 2613
172 nmdc:mga08y16_233_c1 3300050511 Bacteria 49640
173 nmdc:mga0n895_127893_c1 3300050512 Bacteria 2564
174 nmdc:mga0sz30_3658_c1 3300050516 Bacteria 5537
175 Ga0500643_043361 3300053087 Bacteria 1312
176 Ga0500644_0033871 3300053088 Bacteria 1644
177 Ga0500595_047688 3300053119 Bacteria 1341
178 Ga0500559_0010226 3300053136 Bacteria 4032
179 Ga0500568_0000057 3300053139 Bacteria 109287
180 Ga0500568_0049158 3300053139 Bacteria 1665
181 Ga0500588_0001462 3300053146 Bacteria 4490
182 Ga0500616_0020381 3300053153 Bacteria 3725
183 Ga0500616_0052088 3300053153 Bacteria 2154
184 Ga0500616_0062479 3300053153 Bacteria 1924
185 Ga0500620_000189 3300053155 Bacteria 12693
186 Ga0500620_004010 3300053155 Bacteria 3229
187 Ga0500627_0042517 3300053158 Bacteria 1956
188 Ga0500627_0093529 3300053158 Bacteria 1346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10153385 Ga0157370_101533852 297
2 3300031616 Ga0307508_10064901 Ga0307508_100649012 297
3 3300039438 Ga0436360_1172893 Ga0436360_1172893_1063_2031 298
4 3300039453 Ga0436362_0314543 Ga0436362_0314543_640_1608 298
5 3300039437 Ga0436365_1359767 Ga0436365_1359767_605_1582 300
6 3300044719 Ga0466971_0019499 Ga0466971_0019499_1195_2199 300
7 3300006175 Ga0070712_100199156 Ga0070712_1001991562 302
8 3300026041 Ga0207639_10027120 Ga0207639_100271204 302
9 3300039447 Ga0436361_0377086 Ga0436361_0377086_171_1154 302
10 3300046512 Ga0495610_0020112 Ga0495610_0020112_312_1298 302
11 3300048924 Ga0496121_0162894 Ga0496121_0162894_324_1310 302
12 3300005985 Ga0081539_10019710 Ga0081539_100197102 303
13 3300049589 Ga0501073_0028413 Ga0501073_0028413_2238_3149 303
14 3300005548 Ga0070665_100062647 Ga0070665_1000626474 304
15 3300028379 Ga0268266_10157381 Ga0268266_101573812 304
16 iso_pu_bacteria 2874123672 2874126590 305
17 3300006173 Ga0070716_100088043 Ga0070716_1000880432 308
18 3300021361 Ga0213872_10034793 Ga0213872_100347932 308
19 3300021361 Ga0213872_10124400 Ga0213872_101244001 308
20 3300005327 Ga0070658_10073660 Ga0070658_100736602 309
21 3300005434 Ga0070709_10198926 Ga0070709_101989262 309
22 3300025913 Ga0207695_10056106 Ga0207695_100561061 309
23 3300039450 Ga0436363_1691131 Ga0436363_1691131_63_1106 309
24 3300053139 Ga0500568_0049158 Ga0500568_0049158_665_1651 309
25 3300053155 Ga0500620_000189 Ga0500620_000189_8896_9825 309
26 3300053158 Ga0500627_0093529 Ga0500627_0093529_11_943 310
27 3300046460 Ga0495638_0109809 Ga0495638_0109809_287_1273 311
28 3300028794 Ga0307515_10000556 Ga0307515_1000055625 312
29 3300049580 Ga0501046_0277355 Ga0501046_0277355_129_1118 312
30 iso_pu_bacteria 2513237351 2514588017 312
31 iso_pu_bacteria 2889790730 2889792427 312
32 3300005983 Ga0081540_1028353 Ga0081540_10283532 313
33 3300049593 Ga0501077_0276945 Ga0501077_0276945_32_1021 313
34 3300049742 Ga0501080_0165415 Ga0501080_0165415_274_1263 313
35 3300049744 Ga0501083_0014024 Ga0501083_0014024_277_1266 313
36 3300025915 Ga0207693_10304197 Ga0207693_103041971 315
37 3300039438 Ga0436360_1357309 Ga0436360_1357309_1309_2340 315
38 3300049571 Ga0501034_0361612 Ga0501034_0361612_81_1031 316
39 3300053136 Ga0500559_0010226 Ga0500559_0010226_3010_3996 317
40 3300053153 Ga0500616_0052088 Ga0500616_0052088_1171_2124 317
41 iso_pu_bacteria 2979742915 2979743083 318
42 3300050512 nmdc:mga0n895_127893_c1 nmdc:mga0n895_127893_c1_203_1162 319
43 iso_pu_bacteria 2939669807 2939672839 319
44 iso_pu_bacteria 2958041894 2958044503 319
45 3300053158 Ga0500627_0042517 Ga0500627_0042517_95_1063 320
46 3300005347 Ga0070668_100009387 Ga0070668_1000093874 321
47 3300028800 Ga0265338_10284936 Ga0265338_102849362 321
48 3300053146 Ga0500588_0001462 Ga0500588_0001462_747_1712 321
49 iso_pu_bacteria 2996310559 2996315017 321
50 3300014497 Ga0182008_10121941 Ga0182008_101219412 322
51 3300046810 Ga0495660_0134509 Ga0495660_0134509_11_979 322
52 3300005467 Ga0070706_100000903 Ga0070706_10000090312 323
53 3300006844 Ga0075428_100523798 Ga0075428_1005237981 323
54 3300009094 Ga0111539_10003929 Ga0111539_1000392918 323
55 3300015265 Ga0182005_1003743 Ga0182005_10037432 323
56 3300025284 Ga0209130_1000160 Ga0209130_100016076 323
57 3300025302 Ga0207426_1000098 Ga0207426_100009880 323
58 3300025910 Ga0207684_10001498 Ga0207684_1000149812 323
59 3300026088 Ga0207641_10428716 Ga0207641_104287162 323
60 3300027907 Ga0207428_10000040 Ga0207428_100000404 323
61 3300046460 Ga0495638_0061834 Ga0495638_0061834_165_1136 323
62 3300050511 nmdc:mga08y16_233_c1 nmdc:mga08y16_233_c1_45009_45980 323
63 3300005981 Ga0081538_10016270 Ga0081538_100162702 324
64 iso_pu_bacteria 2503198000 2503203761 324
65 iso_pu_bacteria 2508501123 2509113881 324
66 iso_pu_bacteria 2508501127 2509140986 324
67 iso_pu_bacteria 2509276018 2509369392 324
68 iso_pu_bacteria 2509276022 2509398120 324
69 iso_pu_bacteria 2510065059 2510316703 324
70 iso_pu_bacteria 2512875016 2512929419 324
71 iso_pu_bacteria 2512875024 2512964214 324
72 iso_pu_bacteria 2512875026 2512970740 324
73 iso_pu_bacteria 2513237089 2513604216 324
74 iso_pu_bacteria 2513237090 2513608010 324
75 iso_pu_bacteria 2513237156 2513989075 324
76 iso_pu_bacteria 2513237160 2514006435 324
77 iso_pu_bacteria 2513237164 2514034042 324
78 iso_pu_bacteria 2513237305 2514417652 324
79 iso_pu_bacteria 2517487022 2517570289 324
80 iso_pu_bacteria 2588253730 2588514992 324
81 iso_pu_bacteria 2597489875 2597815693 324
82 iso_pu_bacteria 2643221623 2644133420 324
83 iso_pu_bacteria 2687453392 2688600522 324
84 iso_pu_bacteria 2693429783 2694632714 324
85 iso_pu_bacteria 2693429784 2694639557 324
86 iso_pu_bacteria 2721755686 2723577815 324
87 iso_pu_bacteria 2756170246 2756672906 324
88 iso_pu_bacteria 2791355123 2792753029 324
89 iso_pu_bacteria 2802428858 2802719984 324
90 iso_pu_bacteria 2802428859 2802727083 324
91 iso_pu_bacteria 2802428860 2802731914 324
92 iso_pu_bacteria 2802428861 2802739245 324
93 iso_pu_bacteria 2802428862 2802745774 324
94 iso_pu_bacteria 2802428863 2802752376 324
95 iso_pu_bacteria 2821443989 2821450883 324
96 iso_pu_bacteria 2841734538 2841735194 324
97 iso_pu_bacteria 2844002411 2844005365 324
98 iso_pu_bacteria 2844009547 2844015853 324
99 iso_pu_bacteria 2847670302 2847672188 324
100 iso_pu_bacteria 2847686936 2847688535 324
101 iso_pu_bacteria 2856314179 2856316878 324
102 iso_pu_bacteria 2856320880 2856326530 324
103 iso_pu_bacteria 2856328259 2856330350 324
104 iso_pu_bacteria 2856334872 2856337811 324
105 iso_pu_bacteria 2856342000 2856349357 324
106 iso_pu_bacteria 2856349417 2856354841 324
107 iso_pu_bacteria 2856364286 2856365264 324
108 iso_pu_bacteria 2857349434 2857354687 324
109 iso_pu_bacteria 2857367948 2857368627 324
110 iso_pu_bacteria 2869169390 2869175627 324
111 iso_pu_bacteria 2869234852 2869235211 324
112 iso_pu_bacteria 2869242130 2869248404 324
113 iso_pu_bacteria 2869249662 2869251810 324
114 iso_pu_bacteria 2869256925 2869261390 324
115 iso_pu_bacteria 2869264136 2869271020 324
116 iso_pu_bacteria 2869271264 2869273482 324
117 iso_pu_bacteria 2869278585 2869280356 324
118 iso_pu_bacteria 2869285874 2869290002 324
119 iso_pu_bacteria 2871429161 2871431243 324
120 iso_pu_bacteria 2871435913 2871441385 324
121 iso_pu_bacteria 2871444079 2871445711 324
122 iso_pu_bacteria 2871451962 2871456197 324
123 iso_pu_bacteria 2871459585 2871466467 324
124 iso_pu_bacteria 2871466892 2871468184 324
125 iso_pu_bacteria 2871474448 2871481398 324
126 iso_pu_bacteria 2871481445 2871483337 324
127 iso_pu_bacteria 2871495908 2871499187 324
128 iso_pu_bacteria 2874102143 2874103040 324
129 iso_pu_bacteria 2874109183 2874109277 324
130 iso_pu_bacteria 2874116593 2874121602 324
131 iso_pu_bacteria 2874131515 2874135869 324
132 iso_pu_bacteria 2874139085 2874144465 324
133 iso_pu_bacteria 2874146452 2874150637 324
134 iso_pu_bacteria 2874155637 2874156186 324
135 iso_pu_bacteria 2874162495 2874163211 324
136 iso_pu_bacteria 2874168670 2874173773 324
137 iso_pu_bacteria 2876363079 2876367021 324
138 iso_pu_bacteria 2876369609 2876373299 324
139 iso_pu_bacteria 2876377896 2876382616 324
140 iso_pu_bacteria 2876386047 2876392260 324
141 iso_pu_bacteria 2876399893 2876406852 324
142 iso_pu_bacteria 2876406927 2876410093 324
143 iso_pu_bacteria 2876413966 2876416677 324
144 iso_pu_bacteria 2876420981 2876421656 324
145 iso_pu_bacteria 2878035449 2878037127 324
146 iso_pu_bacteria 2878738818 2878744160 324
147 iso_pu_bacteria 2878745973 2878747847 324
148 iso_pu_bacteria 2878760144 2878763377 324
149 iso_pu_bacteria 2878767105 2878770375 324
150 iso_pu_bacteria 2878774303 2878775175 324
151 iso_pu_bacteria 2878781027 2878784070 324
152 iso_pu_bacteria 2878788777 2878789247 324
153 iso_pu_bacteria 2881147464 2881154148 324
154 iso_pu_bacteria 2881155292 2881157885 324
155 iso_pu_bacteria 2881161766 2881163220 324
156 iso_pu_bacteria 2881853255 2881855951 324
157 iso_pu_bacteria 2882632389 2882639916 324
158 iso_pu_bacteria 2885305155 2885312178 324
159 iso_pu_bacteria 2885312484 2885315746 324
160 iso_pu_bacteria 2885326080 2885327223 324
161 iso_pu_bacteria 2885334103 2885342286 324
162 iso_pu_bacteria 2885342637 2885348108 324
163 iso_pu_bacteria 2885350715 2885355136 324
164 iso_pu_bacteria 2888337043 2888341907 324
165 iso_pu_bacteria 2888343758 2888349212 324
166 iso_pu_bacteria 2888350351 2888351146 324
167 iso_pu_bacteria 2889010040 2889013537 324
168 iso_pu_bacteria 2889016732 2889021745 324
169 iso_pu_bacteria 2903448605 2903453511 324
170 iso_pu_bacteria 2903492973 2903505847 324
171 iso_pu_bacteria 2903513507 2903520994 324
172 iso_pu_bacteria 2903521522 2903524888 324
173 iso_pu_bacteria 2903528002 2903530869 324
174 iso_pu_bacteria 2903540706 2903543992 324
175 iso_pu_bacteria 2906308376 2906311465 324
176 iso_pu_bacteria 2906321335 2906323205 324
177 iso_pu_bacteria 2906328253 2906331696 324
178 iso_pu_bacteria 2906363423 2906364076 324
179 iso_pu_bacteria 2906370794 2906372283 324
180 iso_pu_bacteria 2906386501 2906393261 324
181 iso_pu_bacteria 2906393657 2906398283 324
182 iso_pu_bacteria 2906401398 2906404567 324
183 iso_pu_bacteria 2906408224 2906412620 324
184 iso_pu_bacteria 2906414383 2906416933 324
185 iso_pu_bacteria 2906427513 2906429120 324
186 iso_pu_bacteria 2909042592 2909047268 324
187 iso_pu_bacteria 2915980308 2915981396 324
188 iso_pu_bacteria 2916061851 2916064210 324
189 iso_pu_bacteria 2921250672 2921252043 324
190 iso_pu_bacteria 2922130491 2922134031 324
191 iso_pu_bacteria 2922151315 2922155381 324
192 iso_pu_bacteria 2922158528 2922158532 324
193 iso_pu_bacteria 2922172374 2922177775 324
194 iso_pu_bacteria 2922178524 2922179125 324
195 iso_pu_bacteria 2922185730 2922190018 324
196 iso_pu_bacteria 2924718760 2924726114 324
197 iso_pu_bacteria 2924726620 2924731313 324
198 iso_pu_bacteria 2924733363 2924738698 324
199 iso_pu_bacteria 2924741084 2924744207 324
200 iso_pu_bacteria 2924748358 2924752553 324
201 iso_pu_bacteria 2924754689 2924754758 324
202 iso_pu_bacteria 2924762789 2924766202 324
203 iso_pu_bacteria 2924776078 2924782077 324
204 iso_pu_bacteria 2937029754 2937030242 324
205 iso_pu_bacteria 2937036028 2937042623 324
206 iso_pu_bacteria 2937078374 2937080320 324
207 iso_pu_bacteria 2937084907 2937088154 324
208 iso_pu_bacteria 2937813078 2937818714 324
209 iso_pu_bacteria 2937822353 2937828591 324
210 iso_pu_bacteria 2937836603 2937840409 324
211 iso_pu_bacteria 2937848649 2937850463 324
212 iso_pu_bacteria 2937861824 2937863200 324
213 iso_pu_bacteria 2937868953 2937876419 324
214 iso_pu_bacteria 2937877337 2937877795 324
215 iso_pu_bacteria 2937891427 2937898014 324
216 iso_pu_bacteria 2937972304 2937977865 324
217 iso_pu_bacteria 2937980651 2937984839 324
218 iso_pu_bacteria 2937994558 2937997839 324
219 iso_pu_bacteria 2938014810 2938022466 324
220 iso_pu_bacteria 2957375807 2957376429 324
221 iso_pu_bacteria 2957437181 2957439137 324
222 iso_pu_bacteria 2958034702 2958036225 324
223 iso_pu_bacteria 2958041894 2958047649 324
224 iso_pu_bacteria 2958064165 2958066319 324
225 iso_pu_bacteria 2958084443 2958084903 324
226 iso_pu_bacteria 2958092219 2958092939 324
227 iso_pu_bacteria 2958108152 2958108975 324
228 iso_pu_bacteria 2958115193 2958115862 324
229 iso_pu_bacteria 2958122699 2958124425 324
230 iso_pu_bacteria 2958130278 2958134406 324
231 iso_pu_bacteria 2958137437 2958141573 324
232 iso_pu_bacteria 2958144490 2958146878 324
233 iso_pu_bacteria 2958158011 2958161043 324
234 iso_pu_bacteria 2958165035 2958168313 324
235 iso_pu_bacteria 2958179912 2958183195 324
236 iso_pu_bacteria 2960591022 2960592041 324
237 iso_pu_bacteria 2960631154 2960632002 324
238 iso_pu_bacteria 2960680706 2960681577 324
239 iso_pu_bacteria 2960693952 2960694848 324
240 iso_pu_bacteria 2961077736 2961081162 324
241 iso_pu_bacteria 2961127735 2961132602 324
242 iso_pu_bacteria 2961136820 2961143941 324
243 iso_pu_bacteria 2961163497 2961166777 324
244 iso_pu_bacteria 2961183825 2961189672 324
245 iso_pu_bacteria 2963644680 2963649814 324
246 iso_pu_bacteria 2965018300 2965021601 324
247 iso_pu_bacteria 2965025482 2965026913 324
248 iso_pu_bacteria 2965032056 2965033177 324
249 iso_pu_bacteria 2965040258 2965046011 324
250 iso_pu_bacteria 2965047637 2965048336 324
251 iso_pu_bacteria 2965062239 2965067444 324
252 iso_pu_bacteria 2965089291 2965089523 324
253 iso_pu_bacteria 2965102966 2965103609 324
254 iso_pu_bacteria 2965110997 2965116190 324
255 iso_pu_bacteria 2967686174 2967688924 324
256 iso_pu_bacteria 2967728569 2967729040 324
257 iso_pu_bacteria 2968016561 2968022137 324
258 iso_pu_bacteria 2968083720 2968086875 324
259 iso_pu_bacteria 2968091066 2968095507 324
260 iso_pu_bacteria 2968097103 2968103305 324
261 iso_pu_bacteria 2968117919 2968118721 324
262 iso_pu_bacteria 2968128360 2968128379 324
263 iso_pu_bacteria 2968171901 2968175183 324
264 iso_pu_bacteria 2970026789 2970028389 324
265 iso_pu_bacteria 2970122695 2970127404 324
266 iso_pu_bacteria 2970143518 2970146147 324
267 iso_pu_bacteria 2970469710 2970474727 324
268 iso_pu_bacteria 2970489779 2970494417 324
269 iso_pu_bacteria 2970510686 2970510781 324
270 iso_pu_bacteria 2970524798 2970531195 324
271 iso_pu_bacteria 2970532167 2970536519 324
272 iso_pu_bacteria 2970540015 2970541459 324
273 iso_pu_bacteria 2970547951 2970549845 324
274 iso_pu_bacteria 2970554993 2970558221 324
275 iso_pu_bacteria 2970593180 2970594954 324
276 iso_pu_bacteria 2970619444 2970621567 324
277 iso_pu_bacteria 2970627176 2970628238 324
278 iso_pu_bacteria 2977530762 2977534390 324
279 iso_pu_bacteria 2977544691 2977546314 324
280 iso_pu_bacteria 2977843712 2977844489 324
281 iso_pu_bacteria 2977851361 2977857502 324
282 iso_pu_bacteria 2977858184 2977859739 324
283 iso_pu_bacteria 2977872689 2977875451 324
284 iso_pu_bacteria 2977907340 2977913151 324
285 iso_pu_bacteria 2977915119 2977919582 324
286 iso_pu_bacteria 2977922695 2977927849 324
287 iso_pu_bacteria 2977935797 2977938845 324
288 iso_pu_bacteria 2977942078 2977946468 324
289 iso_pu_bacteria 2977950692 2977957535 324
290 iso_pu_bacteria 2977957713 2977961222 324
291 iso_pu_bacteria 2977986579 2977993255 324
292 iso_pu_bacteria 2979764755 2979766140 324
293 iso_pu_bacteria 2979772303 2979775426 324
294 iso_pu_bacteria 2979779861 2979781648 324
295 iso_pu_bacteria 2979793036 2979795877 324
296 iso_pu_bacteria 2987636660 2987643289 324
297 iso_pu_bacteria 2987645492 2987647591 324
298 iso_pu_bacteria 2987652177 2987654095 324
299 iso_pu_bacteria 2987659509 2987662789 324
300 iso_pu_bacteria 2987666974 2987670718 324
301 iso_pu_bacteria 2987673487 2987677567 324
302 iso_pu_bacteria 2996336353 2996340234 324
303 iso_pu_bacteria 2996341866 2996345902 324
304 iso_pu_bacteria 2996348954 2996354137 324
305 iso_pu_bacteria 2996386984 2996387442 324
306 iso_pu_bacteria 3000135777 3000141210 324
307 iso_pu_bacteria 3004167301 3004171356 324
308 iso_pu_bacteria 3004188549 3004191841 324
309 iso_pu_bacteria 3004195979 3004197923 324
310 iso_pu_bacteria 3004203850 3004206836 324
311 iso_pu_bacteria 3004211236 3004213768 324
312 iso_pu_bacteria 3004218560 3004223359 324
313 iso_pu_bacteria 3004232784 3004237283 324
314 iso_pu_bacteria 3004239961 3004243788 324
315 iso_pu_bacteria 3004248173 3004253195 324
316 iso_pu_bacteria 3004268573 3004270388 324
317 iso_pu_bacteria 3004275668 3004280805 324
318 iso_pu_bacteria 3004289098 3004293809 324
319 iso_pu_bacteria 3004334049 3004338956 324
320 iso_pu_bacteria 649633066 649874975 324
321 iso_pu_bacteria 8003999396 8004001752 324
322 iso_pu_bacteria 8004300914 8004301649 324
323 iso_pu_bacteria 8004312739 8004313471 324
324 iso_pu_bacteria 8004361976 8004363961 324
325 iso_pu_bacteria 8004387939 8004391054 324
326 iso_pu_bacteria 8004395343 8004403381 324
327 iso_pu_bacteria 8004445564 8004445741 324
328 iso_pu_bacteria 8004633249 8004637919 324
329 iso_pu_bacteria 8004640170 8004645944 324
330 iso_pu_bacteria 8004695233 8004700518 324
331 iso_pu_bacteria 8004703790 8004704101 324
332 iso_pu_bacteria 8004714634 8004716425 324
333 iso_pu_bacteria 8004727605 8004732355 324
334 iso_pu_bacteria 8055617313 8055623630 324
335 3300003354 JGI25160J50197_1002298 JGI25160J50197_10022982 327
336 3300005434 Ga0070709_10064111 Ga0070709_100641112 327
337 3300021441 Ga0213871_10030989 Ga0213871_100309891 327
338 3300039438 Ga0436360_0574478 Ga0436360_0574478_1396_2379 327
339 3300039447 Ga0436361_0636144 Ga0436361_0636144_847_1830 327
340 3300044684 Ga0466966_0113315 Ga0466966_0113315_63_1046 327
341 3300045049 Ga0466959_0094007 Ga0466959_0094007_112_1095 327
342 3300002705 JGI25156J39149_1004951 JGI25156J39149_10049513 328
343 3300002741 JGI25157J39369_1000658 JGI25157J39369_10006582 328
344 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016311 328
345 3300003374 JGI25161J50226_1000060 JGI25161J50226_100006077 328
346 3300003762 Ga0055542_1000172 Ga0055542_100017223 328
347 3300004625 Ga0055543_1000557 Ga0055543_100055720 328
348 3300005262 Ga0065165_1000208 Ga0065165_100020877 328
349 3300005539 Ga0068853_100044126 Ga0068853_1000441264 328
350 3300005548 Ga0070665_100108725 Ga0070665_1001087252 328
351 3300005563 Ga0068855_100129294 Ga0068855_1001292942 328
352 3300005577 Ga0068857_100297866 Ga0068857_1002978662 328
353 3300006871 Ga0075434_100058742 Ga0075434_1000587424 328
354 3300006946 Ga0079104_1018646 Ga0079104_10186462 328
355 3300009093 Ga0105240_10073191 Ga0105240_100731912 328
356 3300009093 Ga0105240_10331822 Ga0105240_103318222 328
357 3300009147 Ga0114129_10465832 Ga0114129_104658322 328
358 3300009174 Ga0105241_10196136 Ga0105241_101961362 328
359 3300009545 Ga0105237_10211012 Ga0105237_102110122 328
360 3300009545 Ga0105237_10237502 Ga0105237_102375022 328
361 3300009551 Ga0105238_10260864 Ga0105238_102608642 328
362 3300010375 Ga0105239_10070690 Ga0105239_100706903 328
363 3300010375 Ga0105239_10187282 Ga0105239_101872822 328
364 3300010375 Ga0105239_10296984 Ga0105239_102969842 328
365 3300013307 Ga0157372_10261599 Ga0157372_102615992 328
366 3300022739 Ga0228711_1000008 Ga0228711_100000885 328
367 3300022740 Ga0228710_1000009 Ga0228710_100000984 328
368 3300025246 Ga0209646_1004988 Ga0209646_10049882 328
369 3300025250 Ga0209026_1000005 Ga0209026_1000005431 328
370 3300025254 Ga0209148_1000057 Ga0209148_1000057199 328
371 3300025256 Ga0209759_1000265 Ga0209759_10002654 328
372 3300025261 Ga0209233_1000068 Ga0209233_1000068313 328
373 3300025272 Ga0209455_1000240 Ga0209455_100024064 328
374 3300025284 Ga0209130_1000152 Ga0209130_100015220 328
375 3300025302 Ga0207426_1000017 Ga0207426_1000017437 328
376 3300025913 Ga0207695_10117916 Ga0207695_101179162 328
377 3300025914 Ga0207671_10151364 Ga0207671_101513642 328
378 3300025914 Ga0207671_10201639 Ga0207671_102016392 328
379 3300025924 Ga0207694_10029700 Ga0207694_100297002 328
380 3300026041 Ga0207639_10031501 Ga0207639_100315014 328
381 3300026116 Ga0207674_10188055 Ga0207674_101880552 328
382 3300027111 Ga0209281_1000106 Ga0209281_1000106146 328
383 3300027666 Ga0209282_1000024 Ga0209282_100002477 328
384 3300028379 Ga0268266_10013730 Ga0268266_100137308 328
385 3300028794 Ga0307515_10165450 Ga0307515_101654502 328
386 3300031456 Ga0307513_10023165 Ga0307513_100231652 328
387 3300031548 Ga0307408_100085324 Ga0307408_1000853242 328
388 3300031616 Ga0307508_10195706 Ga0307508_101957062 328
389 3300031967 Ga0315914_1000012 Ga0315914_100001285 328
390 3300033430 Ga0315913_1000006 Ga0315913_100000684 328
391 3300033464 Ga0315915_1000010 Ga0315915_1000010179 328
392 3300037418 Ga0395900_0041285 Ga0395900_0041285_2508_3494 328
393 3300037418 Ga0395900_0294625 Ga0395900_0294625_151_1137 328
394 3300037471 Ga0395905_0001657 Ga0395905_0001657_5188_6174 328
395 3300037471 Ga0395905_0039764 Ga0395905_0039764_1926_2912 328
396 3300037471 Ga0395905_0109274 Ga0395905_0109274_792_1778 328
397 3300037471 Ga0395905_0227588 Ga0395905_0227588_320_1306 328
398 3300038443 Ga0395901_0099852 Ga0395901_0099852_300_1286 328
399 3300038443 Ga0395901_0136281 Ga0395901_0136281_901_1887 328
400 3300041997 Ga0439431_0007564 Ga0439431_0007564_1069_2055 328
401 3300042157 Ga0439458_0018743 Ga0439458_0018743_372_1358 328
402 3300046522 Ga0495643_0058570 Ga0495643_0058570_392_1378 328
403 3300046660 Ga0495625_0060810 Ga0495625_0060810_676_1662 328
404 3300046660 Ga0495625_0083532 Ga0495625_0083532_812_1798 328
405 3300047443 Ga0495687_028676 Ga0495687_028676_505_1491 328
406 3300047470 Ga0495681_0113457 Ga0495681_0113457_151_1137 328
407 3300048905 Ga0496102_0402704 Ga0496102_0402704_253_1239 328
408 3300048907 Ga0496104_0070718 Ga0496104_0070718_2289_3275 328
409 3300048913 Ga0496110_0447524 Ga0496110_0447524_133_1119 328
410 3300048915 Ga0496112_0066442 Ga0496112_0066442_2480_3466 328
411 3300048916 Ga0496113_0125996 Ga0496113_0125996_760_1746 328
412 3300048916 Ga0496113_0183134 Ga0496113_0183134_634_1620 328
413 3300048921 Ga0496118_0130278 Ga0496118_0130278_559_1545 328
414 3300048922 Ga0496119_0041366 Ga0496119_0041366_1855_2841 328
415 3300048923 Ga0496120_0002038 Ga0496120_0002038_17032_18018 328
416 3300048924 Ga0496121_0069235 Ga0496121_0069235_1758_2744 328
417 3300048929 Ga0496126_0221959 Ga0496126_0221959_252_1238 328
418 3300049568 Ga0501031_0107966 Ga0501031_0107966_190_1176 328
419 3300049570 Ga0501033_0021328 Ga0501033_0021328_2998_3984 328
420 3300049571 Ga0501034_0026740 Ga0501034_0026740_702_1688 328
421 3300049571 Ga0501034_0217782 Ga0501034_0217782_198_1184 328
422 3300049572 Ga0501036_0090149 Ga0501036_0090149_811_1797 328
423 3300049574 Ga0501038_0125339 Ga0501038_0125339_898_1884 328
424 3300049579 Ga0501043_0088329 Ga0501043_0088329_1319_2305 328
425 3300049581 Ga0501047_0036407 Ga0501047_0036407_798_1784 328
426 3300049581 Ga0501047_0141117 Ga0501047_0141117_837_1823 328
427 3300049585 Ga0501069_0049661 Ga0501069_0049661_1298_2284 328
428 3300049586 Ga0501070_0142149 Ga0501070_0142149_903_1889 328
429 3300049742 Ga0501080_0032210 Ga0501080_0032210_921_1907 328
430 3300049742 Ga0501080_0168456 Ga0501080_0168456_575_1561 328
431 3300049823 Ga0501044_0144377 Ga0501044_0144377_877_1863 328
432 3300050492 nmdc:mga0yw44_33592_c1 nmdc:mga0yw44_33592_c1_1084_2070 328
433 3300050516 nmdc:mga0sz30_3658_c1 nmdc:mga0sz30_3658_c1_2361_3347 328
434 3300053088 Ga0500644_0033871 Ga0500644_0033871_27_1013 328
435 3300053119 Ga0500595_047688 Ga0500595_047688_243_1229 328
436 3300053139 Ga0500568_0000057 Ga0500568_0000057_36801_37787 328
437 3300053153 Ga0500616_0020381 Ga0500616_0020381_1506_2492 328
438 3300053153 Ga0500616_0062479 Ga0500616_0062479_731_1717 328
439 3300053155 Ga0500620_004010 Ga0500620_004010_110_1096 328
440 3300039450 Ga0436363_0512178 Ga0436363_0512178_5171_6187 329
441 iso_pu_bacteria 2968138860 2968142861 329
442 iso_pu_bacteria 2937113482 2937117744 331
443 iso_pu_bacteria 2957415311 2957419015 331
444 iso_pu_bacteria 2977523885 2977524758 331
445 3300025261 Ga0209233_1009315 Ga0209233_10093153 332
446 3300006051 Ga0075364_10079837 Ga0075364_100798373 333
447 3300039450 Ga0436363_1029093 Ga0436363_1029093_50_1081 333
448 3300039453 Ga0436362_0729508 Ga0436362_0729508_312_1343 333
449 iso_pu_bacteria 2791355262 2793336599 333
450 iso_pu_bacteria 2791355264 2793345382 333
451 iso_pu_bacteria 2791355265 2793354927 333
452 iso_pu_bacteria 2802429605 2805927147 333
453 iso_pu_bacteria 2802429606 2805934427 333
454 iso_pu_bacteria 2838022645 2838028325 333
455 iso_pu_bacteria 2838668709 2838669549 333
456 iso_pu_bacteria 2838701080 2838701921 333
457 iso_pu_bacteria 2842192696 2842196195 333
458 iso_pu_bacteria 2842198810 2842204301 333
459 iso_pu_bacteria 2842250916 2842251656 333
460 iso_pu_bacteria 2842317721 2842323358 333
461 iso_pu_bacteria 2842402390 2842405729 333
462 iso_pu_bacteria 2842409023 2842412313 333
463 iso_pu_bacteria 2842415677 2842418959 333
464 iso_pu_bacteria 2842489311 2842489633 333
465 iso_pu_bacteria 2842495871 2842500465 333
466 iso_pu_bacteria 8024501048 8024507173 333
467 iso_pu_bacteria 8056382006 8056382494 333
468 iso_pu_bacteria 2643221595 2643986203 335
469 iso_pu_bacteria 2643221627 2644152435 335
470 3300041413 Ga0439465_0006350 Ga0439465_0006350_1361_2431 336
471 3300053087 Ga0500643_043361 Ga0500643_043361_216_1253 338
472 iso_pu_bacteria 637000159 637079170 338
473 3300003187 JGI25151J46595_10000143 JGI25151J46595_1000014316 339
474 3300005459 Ga0068867_100166434 Ga0068867_1001664342 339
475 3300014969 Ga0157376_10308387 Ga0157376_103083872 339
476 3300025294 Ga0209025_1002435 Ga0209025_100243515 339
477 3300025297 Ga0209758_1035647 Ga0209758_10356472 339
478 3300025907 Ga0207645_10044841 Ga0207645_100448413 339
479 3300025935 Ga0207709_10037823 Ga0207709_100378232 339
480 3300026089 Ga0207648_10171058 Ga0207648_101710582 339
481 iso_pu_bacteria 2958100919 2958104885 340
482 iso_pu_bacteria 2958172287 2958174398 340
483 iso_pu_bacteria 2965119406 2965124127 340
484 iso_pu_bacteria 2977971508 2977975776 340
485 iso_pu_bacteria 2979710463 2979717695 340
486 3300001989 JGI24739J22299_10009320 JGI24739J22299_100093203 343
487 3300002067 JGI24735J21928_10033067 JGI24735J21928_100330671 343
488 iso_pu_bacteria 2599185301 2599938553 343
489 iso_pu_bacteria 2876392853 2876398998 344
490 iso_pu_bacteria 2904659560 2904665530 344
491 iso_pu_bacteria 2961114664 2961120530 344
492 iso_pu_bacteria 2968110612 2968116997 344
493 iso_pu_bacteria 2977864932 2977870466 345
494 iso_pu_bacteria 2958071322 2958075806 346
495 3300001979 JGI24740J21852_10003819 JGI24740J21852_100038194 362
496 3300006178 Ga0075367_10047009 Ga0075367_100470093 362
497 3300010375 Ga0105239_10117386 Ga0105239_101173864 362
498 3300013105 Ga0157369_10234017 Ga0157369_102340172 362
499 3300026142 Ga0207698_10179643 Ga0207698_101796432 362
500 3300048928 Ga0496125_0111253 Ga0496125_0111253_436_1524 362
501 3300050491 nmdc:mga00v17_24641_c1 nmdc:mga00v17_24641_c1_267_1355 362
502 3300050492 nmdc:mga0yw44_9520_c1 nmdc:mga0yw44_9520_c1_2120_3208 362
503 3300050494 nmdc:mga06z11_51985_c1 nmdc:mga06z11_51985_c1_397_1485 362
504 3300050496 nmdc:mga07m45_40309_c1 nmdc:mga07m45_40309_c1_364_1452 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

75

348

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5843 39 324
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5797 39 349
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5597 39 349
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5487 50 353
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5376 50 353
ID Description Score Start End Superfamily
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9409 75 346 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9363 75 345 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9358 76 346 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9351 75 345 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9322 72 345 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A387FJB3-F1-model_v4 ABC transporter permease 0.9473 44 352 GO:0005886
GO:0022857
AF-A0A1G2YVH5-F1-model_v4 ABC transporter permease 0.9443 48 353 GO:0005886
GO:0022857
AF-A0A6D0IG30-F1-model_v4 L-arabinose ABC transporter permease AraH 0.9436 50 331 GO:0005886
GO:0022857
AF-A0A662DG78-F1-model_v4 ABC transporter permease 0.9422 50 350 GO:0005886
GO:0022857
AF-X1BQQ6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9419 83 357 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
78.57 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map