metagRoot

F455944

General Info

Members	Datasets	Scaffolds	Average Seq Length
502	406	296	622

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2876808645\|2876809482
Length	671
Sequence	RPHILVALLCTGLWAGAIWLGHSSGHLRFLDRLESALTDVRTLARGVKAPPDLVTIVAIDDTIVKLGGTYPLPRAEIARIVEAIARLEPKVIAIDLLLVDKGPADGDAALAKSLAASPTVLAAAAVFSNILQPSAEDDGPLARLPKADRFLLPLPALADHAEVGIANVTTRQTGTPLSVPMLFRTRDRIELSFPLRVASIAIGQKLTIEPDRLLFGDRPIATASDYALPIAYYGPRRTIRTVSAANLFDGQIDKEAIQGRIVVLGATATGAGDFFPTPFDSLMPGVEIISTAITHLVAGDGVVRDRPVRIVEAVTTILLPVLLVGLLAWRRNAVGLLTVSAVMLAWATANSVAFAHGIWLDAATTMAAAVPPVVLFGTLQLWSDRRSAEHLAVQNKLLEQFQTPGLQQWLTRDPDFLLAPVRQNAAVVFVDLSGFTSLSETLDPDATRGLLKEFHALVDKEVTRCGGMITSFLGDGAMILFGLPEAALDDAARAAQCSIALCVKTERWIEALPPPIGLRIGFKIGAHFGPIVASRLGGRNHQHITAXXXXXXXXXXXXXXXXXXXXXXXXXXXGSGSPPRCPIGAERYVAHRSGAHRCTAEDRQPCRPRRDADSRPIRLAHGLAVAERTTHGGSTHAPRRRGVTGRAPYCSSGGGVRSNTSPFGPSSRCSA

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
4	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
5	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
6	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
7	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
8	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
9	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
10	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
11	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
12	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
13	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
14	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
15	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
16	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
17	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
18	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
19	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
20	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
21	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
22	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
23	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
24	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
25	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
26	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
27	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
28	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
29	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
30	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
31	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
32	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
33	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
34	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
35	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
36	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
37	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
38	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
39	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
40	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
41	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
42	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
43	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
44	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
45	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
46	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
47	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
48	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
49	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
50	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
51	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
52	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
53	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
54	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
55	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
56	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
57	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
58	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
59	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
60	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
61	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
62	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
63	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
64	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
65	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
66	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
67	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
68	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
69	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
70	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
71	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
72	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
73	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
74	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
75	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
76	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
77	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
78	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
79	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
80	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
81	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
82	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
83	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
84	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
85	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
86	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
87	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
88	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
89	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
90	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
91	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
92	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
93	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
94	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
95	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
96	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
97	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
98	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
99	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
100	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
101	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
102	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
103	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
104	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
105	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
106	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
107	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
108	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
109	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
110	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
111	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
112	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
113	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
114	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
115	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
116	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
117	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
118	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
119	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
120	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
121	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
122	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
123	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
124	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
125	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
126	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
127	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
128	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
129	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
130	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
131	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
132	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
133	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
134	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
135	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
136	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
137	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
138	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
139	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
140	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
141	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
142	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
143	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
144	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
145	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
146	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
147	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
148	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
149	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
150	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
151	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
152	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
153	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
154	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
155	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
156	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
157	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
158	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
159	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
160	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
161	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
162	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
163	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
164	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
165	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
166	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
167	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
168	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
169	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
170	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
171	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
172	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
173	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
174	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
175	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
176	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
177	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
178	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
179	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
180	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
181	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
182	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
183	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
184	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
185	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
186	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
187	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
188	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
189	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
190	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
191	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
192	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
193	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
194	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
195	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
196	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
197	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
198	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
199	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
200	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
201	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
202	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
203	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
204	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
205	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
206	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
207	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
208	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
209	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
210	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
211	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
212	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
213	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
214	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
215	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
216	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
217	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
218	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
219	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
220	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
221	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
222	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
223	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
224	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
225	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
226	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
227	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
228	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
250	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
251	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
252	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
253	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
257	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
258	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
259	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
260	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
261	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
262	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
263	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
264	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
265	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
266	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
267	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
268	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
269	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
270	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
271	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
272	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
273	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
274	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
275	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
276	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
277	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
278	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
279	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
280	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
281	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
282	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
283	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
284	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
285	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
286	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
287	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
288	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
289	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
290	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
291	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
292	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
293	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
294	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
295	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
296	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
297	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
298	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
299	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
300	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
301	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
302	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
303	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
304	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
305	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
306	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
307	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
308	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
309	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
310	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
311	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
312	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
313	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
314	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
315	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
316	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
317	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
318	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
319	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
320	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
321	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
322	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
323	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
324	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
325	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
326	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
327	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
328	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
329	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
330	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
331	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
332	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
333	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
334	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
335	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
336	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
337	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
338	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
339	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
340	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
341	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
342	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
343	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
344	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
345	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
346	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
347	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
348	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
349	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
350	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
351	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
352	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
353	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
354	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
355	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
356	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
357	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
358	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
359	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
360	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
361	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
362	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
363	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
364	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
365	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
366	3300053723	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere	Metagenome	Endosphere
367	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
368	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
369	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
370	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
371	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
372	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
373	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
374	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
375	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
376	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
377	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
378	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
379	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
380	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
381	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
382	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
383	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
384	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
385	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
386	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
387	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
388	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
389	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
390	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
391	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
392	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
393	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
394	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
395	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
396	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
397	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
398	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
399	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
400	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
401	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
402	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
403	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
404	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
405	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
406	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	59.2
Metatranscriptomes	0
Isolates	40.8

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.73
Nodule	31.08
Rhizoplane	2.59
Rhizosphere	31.87
Stem	0
Stem Tuber	0
Unclassified	16.73

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10004468	3300003203	Bacteria	6511
2	JGI25153J46596_10001125	3300003215	Bacteria	16201
3	JGI25153J46596_10009055	3300003215	Bacteria	4677
4	JGI25153J46596_10009100	3300003215	Bacteria	4661
5	JGI25153J46596_10013991	3300003215	Bacteria	3361
6	JGI25160J50197_1004378	3300003354	Bacteria	6121
7	JGI25160J50197_1009323	3300003354	Bacteria	3653
8	Ga0055543_1002720	3300004625	Bacteria	5648
9	Ga0065165_1000278	3300005262	Bacteria	87353
10	Ga0065165_1002873	3300005262	Bacteria	13275
11	Ga0070683_100014787	3300005329	Bacteria	6838
12	Ga0068869_100008228	3300005334	Bacteria	6713
13	Ga0068869_100016286	3300005334	Bacteria	5008
14	Ga0068869_100017847	3300005334	Bacteria	4821
15	Ga0070671_100019527	3300005355	Bacteria	5517
16	Ga0070667_100042025	3300005367	Bacteria	3834
17	Ga0070709_10000436	3300005434	Bacteria	25236
18	Ga0070709_10001961	3300005434	Bacteria	11212
19	Ga0070713_100047910	3300005436	Bacteria	3516
20	Ga0070713_100051202	3300005436	Bacteria	3415
21	Ga0070713_100087484	3300005436	Bacteria	2673
22	Ga0070710_10000185	3300005437	Bacteria	28883
23	Ga0070710_10059323	3300005437	Bacteria	2173
24	Ga0070711_100020959	3300005439	Bacteria	4221
25	Ga0070663_100016831	3300005455	Bacteria	4757
26	Ga0070663_100021789	3300005455	Bacteria	4268
27	Ga0070663_100029245	3300005455	Bacteria	3763
28	Ga0070663_100060711	3300005455	Bacteria	2720
29	Ga0070663_100075772	3300005455	Bacteria	2459
30	Ga0070678_100037291	3300005456	Bacteria	3412
31	Ga0070681_10020158	3300005458	Bacteria	6683
32	Ga0070679_100035766	3300005530	Bacteria	4927
33	Ga0070679_100070112	3300005530	Bacteria	3497
34	Ga0070684_100009832	3300005535	Bacteria	7554
35	Ga0068853_100034152	3300005539	Bacteria	4316
36	Ga0070665_100012464	3300005548	Bacteria	8571
37	Ga0070665_100023894	3300005548	Bacteria	6157
38	Ga0070665_100037042	3300005548	Bacteria	4905
39	Ga0070665_100112792	3300005548	Bacteria	2721
40	Ga0068855_100039660	3300005563	Bacteria	5590
41	Ga0068855_100243547	3300005563	Bacteria	2008
42	Ga0068857_100036621	3300005577	Bacteria	4347
43	Ga0068852_100063076	3300005616	Bacteria	3226
44	Ga0068861_100026326	3300005719	Bacteria	4227
45	Ga0068860_100028918	3300005843	Bacteria	5333
46	Ga0068860_100107858	3300005843	Bacteria	2661
47	Ga0068860_100125260	3300005843	Bacteria	2462
48	Ga0081455_10012853	3300005937	Bacteria	8313
49	Ga0081455_10030247	3300005937	Bacteria	4922
50	Ga0081540_1000978	3300005983	Bacteria	25763
51	Ga0081540_1003589	3300005983	Bacteria	12193
52	Ga0081540_1006019	3300005983	Bacteria	8923
53	Ga0081540_1019636	3300005983	Bacteria	4097
54	Ga0081539_10000306	3300005985	Bacteria	110402
55	Ga0070717_10038439	3300006028	Bacteria	3890
56	Ga0075368_10012562	3300006042	Bacteria	3097
57	Ga0075363_100004970	3300006048	Bacteria	5883
58	Ga0075363_100013801	3300006048	Bacteria	3931
59	Ga0070712_100007499	3300006175	Bacteria	6814
60	Ga0070712_100008583	3300006175	Bacteria	6429
61	Ga0075367_10014467	3300006178	Bacteria	4271
62	Ga0075367_10018247	3300006178	Bacteria	3868
63	Ga0075367_10020505	3300006178	Bacteria	3683
64	Ga0075369_10005561	3300006186	Bacteria	4717
65	Ga0075366_10013965	3300006195	Bacteria	4581
66	Ga0075370_10036533	3300006353	Bacteria	2759
67	Ga0099823_1013686	3300006944	Bacteria	8147
68	Ga0099795_10008341	3300007788	Bacteria	2949
69	Ga0105240_10132775	3300009093	Bacteria	2984
70	Ga0105243_10053685	3300009148	Bacteria	3197
71	Ga0105241_10092121	3300009174	Bacteria	2393
72	Ga0105248_10091669	3300009177	Bacteria	3422
73	Ga0105248_10167847	3300009177	Bacteria	2474
74	Ga0105237_10067242	3300009545	Bacteria	3577
75	Ga0157369_10083318	3300013105	Bacteria	3421
76	Ga0163163_10073300	3300014325	Bacteria	3414
77	Ga0157376_10035896	3300014969	Bacteria	4013
78	Ga0163161_10008867	3300017792	Bacteria	6954
79	Ga0214544_1000020	3300021320	Bacteria	178560
80	Ga0214542_1000024	3300021321	Bacteria	191218
81	Ga0214545_1000011	3300021324	Bacteria	190550
82	Ga0214543_1000033	3300021327	Bacteria	190419
83	Ga0209677_102267	3300025253	Bacteria	7435
84	Ga0209148_1000789	3300025254	Bacteria	23558
85	Ga0209455_1002658	3300025272	Bacteria	6736
86	Ga0209564_1000755	3300025295	Bacteria	45779
87	Ga0209564_1002663	3300025295	Bacteria	13570
88	Ga0209758_1000065	3300025297	Bacteria	306288
89	Ga0209758_1000498	3300025297	Bacteria	64011
90	Ga0209758_1000997	3300025297	Bacteria	37703
91	Ga0209758_1003283	3300025297	Bacteria	14995
92	Ga0209758_1003889	3300025297	Bacteria	13063
93	Ga0209758_1013812	3300025297	Bacteria	4364
94	Ga0207426_1000721	3300025302	Bacteria	38161
95	Ga0207426_1000728	3300025302	Bacteria	37754
96	Ga0207426_1006883	3300025302	Bacteria	4847
97	Ga0209257_1001031	3300025304	Bacteria	37368
98	Ga0207692_10000719	3300025898	Bacteria	11649
99	Ga0207647_10003213	3300025904	Bacteria	12258
100	Ga0207699_10000426	3300025906	Bacteria	21558
101	Ga0207707_10003044	3300025912	Bacteria	14897
102	Ga0207707_10009655	3300025912	Bacteria	8371
103	Ga0207695_10137213	3300025913	Bacteria	2398
104	Ga0207693_10005504	3300025915	Bacteria	10546
105	Ga0207657_10091768	3300025919	Bacteria	2532
106	Ga0207652_10006101	3300025921	Bacteria	9747
107	Ga0207652_10026189	3300025921	Bacteria	4854
108	Ga0207700_10034647	3300025928	Bacteria	3627
109	Ga0207706_10012522	3300025933	Bacteria	7726
110	Ga0207665_10032258	3300025939	Bacteria	3468
111	Ga0207667_10013789	3300025949	Bacteria	9234
112	Ga0207667_10037571	3300025949	Bacteria	5175
113	Ga0207667_10063090	3300025949	Bacteria	3872
114	Ga0207712_10032789	3300025961	Bacteria	3508
115	Ga0207668_10009039	3300025972	Bacteria	5954
116	Ga0207668_10012067	3300025972	Bacteria	5275
117	Ga0207668_10063860	3300025972	Bacteria	2599
118	Ga0207703_10011077	3300026035	Bacteria	7026
119	Ga0207678_10010367	3300026067	Bacteria	8180
120	Ga0207678_10029816	3300026067	Bacteria	4763
121	Ga0207678_10031587	3300026067	Bacteria	4619
122	Ga0207678_10033263	3300026067	Bacteria	4493
123	Ga0207678_10053627	3300026067	Bacteria	3475
124	Ga0207702_10053930	3300026078	Bacteria	3405
125	Ga0207648_10044936	3300026089	Bacteria	3875
126	Ga0207674_10070149	3300026116	Bacteria	3523
127	Ga0207674_10098036	3300026116	Bacteria	2915
128	Ga0207675_100052944	3300026118	Bacteria	3787
129	Ga0207683_10041039	3300026121	Bacteria	4039
130	Ga0209389_1000011	3300027296	Bacteria	223265
131	Ga0209389_1000025	3300027296	Bacteria	149588
132	Ga0209589_1000066	3300027357	Bacteria	100795
133	Ga0209489_100017	3300027361	Bacteria	223265
134	Ga0209489_100030	3300027361	Bacteria	185999
135	Ga0209700_100027	3300027363	Bacteria	223462
136	Ga0268266_10003952	3300028379	Bacteria	14394
137	Ga0268266_10013301	3300028379	Bacteria	7093
138	Ga0268265_10007673	3300028380	Bacteria	7281
139	Ga0268264_10033315	3300028381	Bacteria	4231
140	Ga0268264_10084133	3300028381	Bacteria	2727
141	Ga0307509_10126451	3300031507	Bacteria	2520
142	Ga0307508_10000650	3300031616	Bacteria	41770
143	Ga0265342_10002958	3300031712	Bacteria	14291
144	Ga0307516_10010903	3300031730	Bacteria	9940
145	Ga0307510_10008744	3300033180	Bacteria	12069
146	Ga0307510_10044206	3300033180	Bacteria	4828
147	Ga0373934_0002829	3300035086	Bacteria	6356
148	Ga0373923_0008671	3300035111	Bacteria	3640
149	Ga0373936_0012102	3300035113	Unclassified	3276
150	Ga0373953_0006551	3300035117	Bacteria	3844
151	Ga0373954_0003601	3300035118	Bacteria	6589
152	Ga0373956_0040642	3300035119	Bacteria	2063
153	Ga0373955_0001979	3300035172	Bacteria	8831
154	Ga0373924_0004239	3300035410	Bacteria	4994
155	Ga0373935_0007256	3300035692	Bacteria	6624
156	Ga0373933_0001129	3300035724	Bacteria	15857
157	Ga0373937_0003339	3300036401	Bacteria	13467
158	Ga0395905_0044432	3300037471	Bacteria	4170
159	Ga0436363_1016630	3300039450	Bacteria	1850
160	Ga0436362_0615862	3300039453	Bacteria	6368
161	Ga0466968_0001112	3300044735	Bacteria	9516
162	Ga0495592_0022669	3300046454	Bacteria	4776
163	Ga0495603_0004058	3300046455	Bacteria	8715
164	Ga0495603_0039228	3300046455	Bacteria	2838
165	Ga0495629_0001101	3300046459	Bacteria	21378
166	Ga0495638_0001554	3300046460	Bacteria	20587
167	Ga0495638_0014661	3300046460	Bacteria	5288
168	Ga0495653_0002591	3300046463	Bacteria	14392
169	Ga0495653_0045645	3300046463	Bacteria	3397
170	Ga0495650_0031346	3300046471	Bacteria	2394
171	Ga0495664_0065560	3300046477	Bacteria	2165
172	Ga0495585_0030109	3300046492	Bacteria	3088
173	Ga0495594_0020720	3300046499	Bacteria	3504
174	Ga0495606_0000901	3300046507	Bacteria	44189
175	Ga0495606_0008105	3300046507	Bacteria	9212
176	Ga0495608_0002217	3300046511	Bacteria	14030
177	Ga0495618_0022161	3300046514	Bacteria	3922
178	Ga0495648_0011852	3300046524	Bacteria	6540
179	Ga0495648_0027153	3300046524	Bacteria	3838
180	Ga0495640_0003781	3300046533	Bacteria	12144
181	Ga0495598_0004937	3300046537	Bacteria	2924
182	Ga0495667_0028638	3300046559	Bacteria	3751
183	Ga0495656_0017052	3300046615	Bacteria	2765
184	Ga0495668_0014863	3300046616	Bacteria	4555
185	Ga0495668_0056190	3300046616	Bacteria	2173
186	Ga0495634_0038791	3300046642	Bacteria	3246
187	Ga0495635_0001213	3300046663	Bacteria	17235
188	Ga0495635_0004272	3300046663	Bacteria	9893
189	Ga0495657_0039644	3300046675	Bacteria	3235
190	Ga0495657_0043728	3300046675	Bacteria	3052
191	Ga0495599_0003019	3300046678	Bacteria	9793
192	Ga0495623_0070559	3300046679	Bacteria	2176
193	Ga0495646_0006785	3300046680	Bacteria	7265
194	Ga0495649_0006901	3300046694	Bacteria	7026
195	Ga0495600_0020241	3300046809	Bacteria	4255
196	Ga0495581_0025143	3300047315	Bacteria	3453
197	Ga0495604_0040325	3300047317	Bacteria	3666
198	Ga0495674_0041035	3300047319	Bacteria	4136
199	Ga0495680_0033842	3300047322	Bacteria	4134
200	Ga0495675_0018056	3300047444	Bacteria	4472
201	Ga0495673_0019673	3300047469	Unclassified	3379
202	Ga0495684_0011635	3300047471	Bacteria	6792
203	Ga0495686_0027972	3300047472	Bacteria	3676
204	Ga0495593_0007418	3300047673	Bacteria	6422
205	Ga0495602_0015360	3300048088	Bacteria	7732
206	Ga0495602_0033472	3300048088	Bacteria	4821
207	Ga0496104_0007090	3300048907	Bacteria	9882
208	Ga0496104_0007655	3300048907	Bacteria	9563
209	Ga0496105_0014195	3300048908	Bacteria	6339
210	Ga0496106_0001874	3300048909	Bacteria	15739
211	Ga0496108_0073728	3300048911	Bacteria	2882
212	Ga0496110_0031050	3300048913	Bacteria	4608
213	Ga0496112_0000056	3300048915	Bacteria	77708
214	Ga0496112_0017655	3300048915	Bacteria	6711
215	Ga0496114_0091423	3300048917	Bacteria	2585
216	Ga0496114_0124470	3300048917	Bacteria	2221
217	Ga0496115_0042485	3300048918	Bacteria	3621
218	Ga0496116_0002966	3300048919	Bacteria	17265
219	Ga0496116_0036831	3300048919	Bacteria	3419
220	Ga0496117_0026561	3300048920	Bacteria	4529
221	Ga0496117_0066201	3300048920	Bacteria	2452
222	Ga0496118_0003878	3300048921	Bacteria	18360
223	Ga0496118_0034285	3300048921	Bacteria	4145
224	Ga0496121_0000041	3300048924	Bacteria	346686
225	Ga0496121_0030034	3300048924	Bacteria	5003
226	Ga0496121_0037409	3300048924	Bacteria	4311
227	Ga0496123_0013709	3300048926	Bacteria	6778
228	Ga0496124_0003100	3300048927	Bacteria	20651
229	Ga0496125_0000158	3300048928	Bacteria	151273
230	Ga0496125_0000814	3300048928	Bacteria	50711
231	Ga0496125_0028992	3300048928	Bacteria	4984
232	Ga0496125_0092285	3300048928	Bacteria	2264
233	Ga0496125_0095497	3300048928	Bacteria	2211
234	Ga0496125_0105864	3300048928	Bacteria	2055
235	Ga0496126_0004798	3300048929	Bacteria	15887
236	Ga0496126_0009161	3300048929	Bacteria	10564
237	Ga0496126_0010459	3300048929	Bacteria	9719
238	Ga0496126_0010775	3300048929	Bacteria	9547
239	nmdc:mga0yw44_24235_c1	3300050492	Bacteria	3431
240	nmdc:mga0k408_38173_c1	3300050493	Bacteria	2757
241	nmdc:mga06z11_14066_c1	3300050494	Bacteria	3533
242	nmdc:mga07m45_31890_c1	3300050496	Bacteria	2921
243	nmdc:mga07m45_55953_c1	3300050496	Bacteria	2230
244	nmdc:mga0sz30_8479_c1	3300050516	Bacteria	2750
245	Ga0500635_0008114	3300053080	Bacteria	2870
246	Ga0495595_0010976	3300053084	Bacteria	3779
247	Ga0500578_0037046	3300053086	Bacteria	3132
248	Ga0500643_000019	3300053087	Bacteria	294301
249	Ga0500583_0006789	3300053092	Bacteria	3969
250	Ga0500566_0000003	3300053094	Bacteria	166820
251	Ga0500566_0000474	3300053094	Bacteria	22351
252	Ga0500566_0001382	3300053094	Bacteria	14186
253	Ga0500566_0001951	3300053094	Bacteria	12138
254	Ga0500641_0002719	3300053096	Bacteria	6249
255	Ga0500641_0003818	3300053096	Bacteria	5324
256	Ga0500650_0021072	3300053098	Bacteria	2867
257	Ga0500555_002417	3300053103	Bacteria	5428
258	Ga0500556_0000029	3300053104	Bacteria	165326
259	Ga0500557_000090	3300053105	Bacteria	31022
260	Ga0500562_000516	3300053108	Bacteria	9357
261	Ga0500572_000096	3300053111	Bacteria	28795
262	Ga0500592_001418	3300053116	Bacteria	3879
263	Ga0500595_000286	3300053119	Bacteria	33353
264	Ga0500595_003244	3300053119	Bacteria	7679
265	Ga0500595_003738	3300053119	Bacteria	7014
266	Ga0500595_005556	3300053119	Bacteria	5492
267	Ga0500595_010701	3300053119	Bacteria	3632
268	Ga0500607_028181	3300053121	Bacteria	3111
269	Ga0500608_003155	3300053122	Bacteria	6125
270	Ga0500614_000130	3300053123	Bacteria	18262
271	Ga0500642_0000020	3300053130	Bacteria	159498
272	Ga0500642_0000203	3300053130	Bacteria	24329
273	Ga0500652_001305	3300053131	Bacteria	7899
274	Ga0500559_0001025	3300053136	Bacteria	17132
275	Ga0500568_0000521	3300053139	Bacteria	28398
276	Ga0500568_0007344	3300053139	Bacteria	5416
277	Ga0500577_0010705	3300053142	Bacteria	2711
278	Ga0500586_000970	3300053145	Bacteria	5911
279	Ga0500590_004588	3300053148	Bacteria	6537
280	Ga0500603_000786	3300053150	Bacteria	7607
281	Ga0500616_0000112	3300053153	Bacteria	151210
282	Ga0500622_0000717	3300053156	Bacteria	28993
283	Ga0500622_0004100	3300053156	Bacteria	9334
284	Ga0500627_0007465	3300053158	Bacteria	3809
285	Ga0500630_001861	3300053159	Bacteria	10143
286	Ga0500638_000361	3300053162	Bacteria	10532
287	Ga0500639_000264	3300053163	Bacteria	25991
288	Ga0500636_0000076	3300053177	Bacteria	48321
289	Ga0500636_0007166	3300053177	Bacteria	6443
290	Ga0500636_0028663	3300053177	Bacteria	3287
291	Ga0500567_023400	3300053723	Bacteria	2957
292	Ga0500625_000655	3300053729	Bacteria	10043
293	Ga0500596_001354	3300053735	Bacteria	4931
294	Ga0500601_000030	3300053737	Bacteria	31644
295	Ga0500661_000031	3300055283	Bacteria	21207
296	Ga0501082_0050799	3300060353	Bacteria	3576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	8016622563	8016628366	534
2	3300025302	Ga0207426_1006883	Ga0207426_10068833	539
3	3300005983	Ga0081540_1003589	Ga0081540_10035894	542
4	3300048928	Ga0496125_0105864	Ga0496125_0105864_264_2021	542
5	iso_pu_bacteria	2922361189	2922362162	542
6	3300039450	Ga0436363_1016630	Ga0436363_1016630_25_1833	544
7	iso_pu_bacteria	2882632389	2882634813	546
8	3300053080	Ga0500635_0008114	Ga0500635_0008114_255_2117	552
9	3300048924	Ga0496121_0030034	Ga0496121_0030034_1827_3632	556
10	iso_pu_bacteria	2874123672	2874128681	556
11	3300053156	Ga0500622_0000717	Ga0500622_0000717_2661_4550	558
12	iso_pu_bacteria	2545555834	2545676973	560
13	iso_pu_bacteria	641522639	641641040	560
14	3300047315	Ga0495581_0025143	Ga0495581_0025143_656_2515	563
15	3300047469	Ga0495673_0019673	Ga0495673_0019673_1272_3140	563
16	3300005434	Ga0070709_10001961	Ga0070709_100019619	564
17	3300005436	Ga0070713_100087484	Ga0070713_1000874841	564
18	3300005437	Ga0070710_10059323	Ga0070710_100593231	564
19	3300006175	Ga0070712_100007499	Ga0070712_1000074993	564
20	3300025915	Ga0207693_10005504	Ga0207693_1000550412	564
21	3300025939	Ga0207665_10032258	Ga0207665_100322583	564
22	iso_pu_bacteria	2767802442	2770196264	564
23	iso_pu_bacteria	2904690495	2904697738	564
24	iso_pu_bacteria	2908756301	2908757165	564
25	3300005937	Ga0081455_10012853	Ga0081455_100128532	565
26	iso_pu_bacteria	643348564	643602241	567
27	iso_pu_bacteria	2876808645	2876809482	568
28	3300053119	Ga0500595_003244	Ga0500595_003244_747_2636	569
29	3300005548	Ga0070665_100037042	Ga0070665_1000370423	570
30	3300033180	Ga0307510_10008744	Ga0307510_100087443	570
31	3300053094	Ga0500566_0001382	Ga0500566_0001382_3946_5832	570
32	3300053105	Ga0500557_000090	Ga0500557_000090_14245_16131	570
33	3300053130	Ga0500642_0000203	Ga0500642_0000203_10255_12141	570
34	3300053156	Ga0500622_0004100	Ga0500622_0004100_6860_8746	570
35	3300053729	Ga0500625_000655	Ga0500625_000655_5685_7571	570
36	3300047472	Ga0495686_0027972	Ga0495686_0027972_352_2205	571
37	3300048928	Ga0496125_0000158	Ga0496125_0000158_133837_135705	572
38	3300046477	Ga0495664_0065560	Ga0495664_0065560_97_1983	573
39	3300046675	Ga0495657_0043728	Ga0495657_0043728_355_2241	573
40	3300046679	Ga0495623_0070559	Ga0495623_0070559_119_2005	573
41	3300047319	Ga0495674_0041035	Ga0495674_0041035_1077_2963	573
42	3300048088	Ga0495602_0033472	Ga0495602_0033472_2501_4387	573
43	3300035692	Ga0373935_0007256	Ga0373935_0007256_4754_6613	574
44	3300046524	Ga0495648_0027153	Ga0495648_0027153_1677_3563	574
45	3300006944	Ga0099823_1013686	Ga0099823_10136864	575
46	3300026067	Ga0207678_10053627	Ga0207678_100536272	575
47	3300046463	Ga0495653_0045645	Ga0495653_0045645_106_1968	575
48	3300005436	Ga0070713_100047910	Ga0070713_1000479101	576
49	3300025928	Ga0207700_10034647	Ga0207700_100346474	576
50	3300053086	Ga0500578_0037046	Ga0500578_0037046_592_2478	576
51	3300053737	Ga0500601_000030	Ga0500601_000030_5598_7484	576
52	iso_pu_bacteria	2775506902	2776268597	576
53	iso_pu_bacteria	2775506904	2776285322	576
54	iso_pu_bacteria	2840764183	2840770554	576
55	iso_pu_bacteria	2885312484	2885317076	576
56	iso_pu_bacteria	8055617313	8055619769	576
57	3300005329	Ga0070683_100014787	Ga0070683_1000147872	577
58	3300005458	Ga0070681_10020158	Ga0070681_100201584	577
59	3300005530	Ga0070679_100035766	Ga0070679_1000357662	577
60	3300005530	Ga0070679_100070112	Ga0070679_1000701123	577
61	3300005535	Ga0070684_100009832	Ga0070684_1000098323	577
62	3300005563	Ga0068855_100039660	Ga0068855_1000396602	577
63	3300006186	Ga0075369_10005561	Ga0075369_100055613	577
64	3300009093	Ga0105240_10132775	Ga0105240_101327752	577
65	3300009174	Ga0105241_10092121	Ga0105241_100921212	577
66	3300013105	Ga0157369_10083318	Ga0157369_100833182	577
67	3300025912	Ga0207707_10003044	Ga0207707_100030444	577
68	3300025912	Ga0207707_10009655	Ga0207707_100096554	577
69	3300025913	Ga0207695_10137213	Ga0207695_101372132	577
70	3300025921	Ga0207652_10006101	Ga0207652_100061012	577
71	3300025921	Ga0207652_10026189	Ga0207652_100261893	577
72	3300025949	Ga0207667_10037571	Ga0207667_100375712	577
73	3300026089	Ga0207648_10044936	Ga0207648_100449362	577
74	3300046460	Ga0495638_0014661	Ga0495638_0014661_2672_4558	577
75	3300048918	Ga0496115_0042485	Ga0496115_0042485_939_2831	577
76	3300048919	Ga0496116_0002966	Ga0496116_0002966_3587_5476	577
77	3300048921	Ga0496118_0034285	Ga0496118_0034285_1439_3328	577
78	3300048926	Ga0496123_0013709	Ga0496123_0013709_1584_3470	577
79	3300048928	Ga0496125_0028992	Ga0496125_0028992_2082_3971	577
80	3300048928	Ga0496125_0092285	Ga0496125_0092285_105_1991	577
81	3300053098	Ga0500650_0021072	Ga0500650_0021072_876_2765	577
82	3300053104	Ga0500556_0000029	Ga0500556_0000029_117351_119237	577
83	3300053116	Ga0500592_001418	Ga0500592_001418_681_2570	577
84	3300053130	Ga0500642_0000020	Ga0500642_0000020_119912_121798	577
85	3300053131	Ga0500652_001305	Ga0500652_001305_1725_3614	577
86	3300053139	Ga0500568_0000521	Ga0500568_0000521_17221_19110	577
87	iso_pu_bacteria	2643221595	2643984188	577
88	3300026067	Ga0207678_10010367	Ga0207678_100103672	578
89	3300035113	Ga0373936_0012102	Ga0373936_0012102_601_2463	578
90	3300053094	Ga0500566_0000003	Ga0500566_0000003_1072_2934	578
91	3300053111	Ga0500572_000096	Ga0500572_000096_15502_17364	578
92	3300053123	Ga0500614_000130	Ga0500614_000130_6533_8395	578
93	3300053136	Ga0500559_0001025	Ga0500559_0001025_9905_11767	578
94	3300053150	Ga0500603_000786	Ga0500603_000786_4558_6420	578
95	3300053159	Ga0500630_001861	Ga0500630_001861_3741_5603	578
96	3300053163	Ga0500639_000264	Ga0500639_000264_11679_13541	578
97	3300053735	Ga0500596_001354	Ga0500596_001354_2074_3936	578
98	iso_pu_bacteria	8006926726	8006928225	578
99	3300048917	Ga0496114_0091423	Ga0496114_0091423_418_2286	579
100	3300053096	Ga0500641_0002719	Ga0500641_0002719_1162_3036	579
101	3300053177	Ga0500636_0007166	Ga0500636_0007166_3298_5190	579
102	iso_pu_bacteria	2511231028	2511397556	579
103	iso_pu_bacteria	2513237094	2513643527	579
104	iso_pu_bacteria	2513237095	2513652294	579
105	iso_pu_bacteria	2513237139	2513878140	579
106	iso_pu_bacteria	2513237161	2514012563	579
107	iso_pu_bacteria	2517093001	2517108772	579
108	iso_pu_bacteria	2528768022	2528849579	579
109	iso_pu_bacteria	2602042107	2603857260	579
110	iso_pu_bacteria	2617270735	2617353096	579
111	iso_pu_bacteria	2791355196	2793060012	579
112	iso_pu_bacteria	2802429603	2805920101	579
113	iso_pu_bacteria	2816332527	2818241568	579
114	iso_pu_bacteria	2824661429	2824666620	579
115	iso_pu_bacteria	2824671348	2824674182	579
116	iso_pu_bacteria	2824687955	2824693038	579
117	iso_pu_bacteria	2824696289	2824698919	579
118	iso_pu_bacteria	2824773399	2824774277	579
119	iso_pu_bacteria	2838122688	2838127551	579
120	iso_pu_bacteria	2841941048	2841941497	579
121	iso_pu_bacteria	2841949485	2841952490	579
122	iso_pu_bacteria	2841957949	2841959512	579
123	iso_pu_bacteria	2841966195	2841967639	579
124	iso_pu_bacteria	2841974524	2841982194	579
125	iso_pu_bacteria	2841983080	2841986512	579
126	iso_pu_bacteria	2842038055	2842038276	579
127	iso_pu_bacteria	2842045827	2842048779	579
128	iso_pu_bacteria	2847939898	2847945151	579
129	iso_pu_bacteria	2849076700	2849080667	579
130	iso_pu_bacteria	2857524615	2857526634	579
131	iso_pu_bacteria	2874620515	2874623235	579
132	iso_pu_bacteria	2874628541	2874636005	579
133	iso_pu_bacteria	2879099564	2879107753	579
134	iso_pu_bacteria	2881665667	2881671745	579
135	iso_pu_bacteria	2885366525	2885368953	579
136	iso_pu_bacteria	2885409591	2885414451	579
137	iso_pu_bacteria	2888378607	2888382485	579
138	iso_pu_bacteria	2888388044	2888388208	579
139	iso_pu_bacteria	2893066018	2893070975	579
140	iso_pu_bacteria	2894652903	2894657375	579
141	iso_pu_bacteria	2904666416	2904670055	579
142	iso_pu_bacteria	2919073203	2919077857	579
143	iso_pu_bacteria	2922368715	2922375481	579
144	iso_pu_bacteria	2924762789	2924768021	579
145	iso_pu_bacteria	2929615660	2929616216	579
146	iso_pu_bacteria	2929624759	2929624960	579
147	iso_pu_bacteria	2932784394	2932787117	579
148	iso_pu_bacteria	2932794094	2932797346	579
149	iso_pu_bacteria	2932801729	2932804769	579
150	iso_pu_bacteria	2932809354	2932811312	579
151	iso_pu_bacteria	2932818245	2932819815	579
152	iso_pu_bacteria	2932828146	2932832293	579
153	iso_pu_bacteria	2933577622	2933578500	579
154	iso_pu_bacteria	2935675223	2935677054	579
155	iso_pu_bacteria	2935684952	2935693093	579
156	iso_pu_bacteria	2935694250	2935695416	579
157	iso_pu_bacteria	2935703347	2935709475	579
158	iso_pu_bacteria	2935713505	2935719701	579
159	iso_pu_bacteria	2935722832	2935729532	579
160	iso_pu_bacteria	2935732158	2935739584	579
161	iso_pu_bacteria	2935741537	2935748622	579
162	iso_pu_bacteria	2935750917	2935756791	579
163	iso_pu_bacteria	2935760218	2935761220	579
164	iso_pu_bacteria	2935769743	2935771500	579
165	iso_pu_bacteria	2935777560	2935779189	579
166	iso_pu_bacteria	2935785616	2935790842	579
167	iso_pu_bacteria	2935793552	2935799217	579
168	iso_pu_bacteria	2935801545	2935807324	579
169	iso_pu_bacteria	2935810662	2935812463	579
170	iso_pu_bacteria	2935883170	2935884995	579
171	iso_pu_bacteria	2935959822	2935963367	579
172	iso_pu_bacteria	2935992306	2935998974	579
173	iso_pu_bacteria	2936002035	2936008268	579
174	iso_pu_bacteria	2936037263	2936039056	579
175	iso_pu_bacteria	2940556831	2940562705	579
176	iso_pu_bacteria	2941531003	2941536395	579
177	iso_pu_bacteria	3005710791	3005713526	579
178	iso_pu_bacteria	8016511872	8016515089	579
179	iso_pu_bacteria	8016522445	8016522882	579
180	iso_pu_bacteria	8016530956	8016536339	579
181	iso_pu_bacteria	8016539877	8016540618	579
182	iso_pu_bacteria	8016548790	8016552624	579
183	iso_pu_bacteria	8016557553	8016561003	579
184	iso_pu_bacteria	8016566248	8016574704	579
185	iso_pu_bacteria	8016595262	8016598866	579
186	iso_pu_bacteria	8016603502	8016612211	579
187	iso_pu_bacteria	8016613128	8016621593	579
188	iso_pu_bacteria	8017057580	8017061364	579
189	iso_pu_bacteria	8019530166	8019536062	579
190	iso_pu_bacteria	8019538911	8019543409	579
191	iso_pu_bacteria	8019547302	8019555446	579
192	iso_pu_bacteria	8019648815	8019656492	579
193	iso_pu_bacteria	8055742211	8055747863	579
194	iso_pu_bacteria	8056967851	8056969568	579
195	3300003215	JGI25153J46596_10013991	JGI25153J46596_100139913	580
196	3300007788	Ga0099795_10008341	Ga0099795_100083412	580
197	3300025253	Ga0209677_102267	Ga0209677_1022672	580
198	3300025297	Ga0209758_1013812	Ga0209758_10138122	580
199	3300048928	Ga0496125_0000814	Ga0496125_0000814_40692_42554	580
200	3300048929	Ga0496126_0010459	Ga0496126_0010459_6810_8672	580
201	3300048929	Ga0496126_0010775	Ga0496126_0010775_5094_6977	580
202	3300053122	Ga0500608_003155	Ga0500608_003155_3932_5794	580
203	iso_pu_bacteria	2507262055	2507510010	580
204	iso_pu_bacteria	2508501009	2508544012	580
205	iso_pu_bacteria	2508501042	2508698056	580
206	iso_pu_bacteria	2513237092	2513628167	580
207	iso_pu_bacteria	2513237102	2513700287	580
208	iso_pu_bacteria	2515154112	2515629487	580
209	iso_pu_bacteria	2524023205	2524439032	580
210	iso_pu_bacteria	2744054633	2745078855	580
211	iso_pu_bacteria	2824600985	2824605624	580
212	iso_pu_bacteria	2824609381	2824609874	580
213	iso_pu_bacteria	2824617872	2824625340	580
214	iso_pu_bacteria	2824626560	2824633827	580
215	iso_pu_bacteria	2824635225	2824641569	580
216	iso_pu_bacteria	2824644064	2824652069	580
217	iso_pu_bacteria	2824653114	2824655727	580
218	iso_pu_bacteria	2824679649	2824684217	580
219	iso_pu_bacteria	2824704595	2824707757	580
220	iso_pu_bacteria	2824714736	2824722432	580
221	iso_pu_bacteria	2824723954	2824729014	580
222	iso_pu_bacteria	2824746037	2824752376	580
223	iso_pu_bacteria	2824753945	2824758065	580
224	iso_pu_bacteria	2824763712	2824766203	580
225	iso_pu_bacteria	2847930680	2847934544	580
226	iso_pu_bacteria	2857509624	2857509970	580
227	iso_pu_bacteria	2874590934	2874596754	580
228	iso_pu_bacteria	2874612657	2874618242	580
229	iso_pu_bacteria	2874645413	2874653016	580
230	iso_pu_bacteria	2876761206	2876766668	580
231	iso_pu_bacteria	2876771140	2876776950	580
232	iso_pu_bacteria	2876818435	2876825300	580
233	iso_pu_bacteria	2879074833	2879081087	580
234	iso_pu_bacteria	2879083081	2879089735	580
235	iso_pu_bacteria	2879127579	2879130825	580
236	iso_pu_bacteria	2879142872	2879147585	580
237	iso_pu_bacteria	2881364244	2881365655	580
238	iso_pu_bacteria	2888419890	2888423061	580
239	iso_pu_bacteria	2904711408	2904718445	580
240	iso_pu_bacteria	2906626472	2906633565	580
241	iso_pu_bacteria	2906643746	2906649938	580
242	iso_pu_bacteria	2908775508	2908778729	580
243	iso_pu_bacteria	2922393267	2922395002	580
244	iso_pu_bacteria	2935608549	2935611086	580
245	iso_pu_bacteria	2935616580	2935619003	580
246	iso_pu_bacteria	2935648319	2935648524	580
247	iso_pu_bacteria	2935656913	2935657488	580
248	iso_pu_bacteria	2935665750	2935669806	580
249	iso_pu_bacteria	2935819856	2935820571	580
250	iso_pu_bacteria	2935847175	2935849420	580
251	iso_pu_bacteria	2935855204	2935857368	580
252	iso_pu_bacteria	2935908558	2935911805	580
253	iso_pu_bacteria	2935916978	2935919461	580
254	iso_pu_bacteria	2935926038	2935928834	580
255	iso_pu_bacteria	2935934488	2935938479	580
256	iso_pu_bacteria	2935942939	2935945629	580
257	iso_pu_bacteria	2935951376	2935954764	580
258	iso_pu_bacteria	2935967501	2935970651	580
259	iso_pu_bacteria	2935975950	2935979110	580
260	iso_pu_bacteria	2935984226	2935987880	580
261	iso_pu_bacteria	2936011229	2936011434	580
262	iso_pu_bacteria	2936019824	2936020029	580
263	iso_pu_bacteria	2936028420	2936028625	580
264	iso_pu_bacteria	2936046547	2936046752	580
265	iso_pu_bacteria	2936055302	2936058373	580
266	iso_pu_bacteria	2941538514	2941539935	580
267	iso_pu_bacteria	3005483717	3005487954	580
268	iso_pu_bacteria	3005587118	3005589461	580
269	iso_pu_bacteria	8016630954	8016632562	580
270	iso_pu_bacteria	8019638758	8019643706	580
271	iso_pu_bacteria	8019668869	8019673355	580
272	iso_pu_bacteria	8019678201	8019682771	580
273	3300005434	Ga0070709_10000436	Ga0070709_100004367	581
274	3300005436	Ga0070713_100051202	Ga0070713_1000512022	581
275	3300005437	Ga0070710_10000185	Ga0070710_1000018511	581
276	3300005439	Ga0070711_100020959	Ga0070711_1000209592	581
277	3300006175	Ga0070712_100008583	Ga0070712_1000085833	581
278	3300025898	Ga0207692_10000719	Ga0207692_1000071910	581
279	3300025906	Ga0207699_10000426	Ga0207699_1000042612	581
280	3300039453	Ga0436362_0615862	Ga0436362_0615862_483_2351	581
281	3300046460	Ga0495638_0001554	Ga0495638_0001554_17225_19111	581
282	3300046616	Ga0495668_0056190	Ga0495668_0056190_131_2020	581
283	3300053108	Ga0500562_000516	Ga0500562_000516_211_2097	581
284	3300053119	Ga0500595_005556	Ga0500595_005556_2680_4569	581
285	3300053153	Ga0500616_0000112	Ga0500616_0000112_120786_122672	581
286	iso_pu_bacteria	2874604998	2874610680	581
287	iso_pu_bacteria	2937822353	2937825023	581
288	3300025295	Ga0209564_1000755	Ga0209564_100075515	582
289	3300031712	Ga0265342_10002958	Ga0265342_100029588	582
290	3300053094	Ga0500566_0000474	Ga0500566_0000474_16091_17980	582
291	3300053121	Ga0500607_028181	Ga0500607_028181_558_2447	582
292	3300053145	Ga0500586_000970	Ga0500586_000970_1860_3749	582
293	3300053148	Ga0500590_004588	Ga0500590_004588_3181_5070	582
294	3300053177	Ga0500636_0028663	Ga0500636_0028663_859_2748	582
295	3300053723	Ga0500567_023400	Ga0500567_023400_303_2192	582
296	iso_pu_bacteria	2513237101	2513696905	582
297	iso_pu_bacteria	2513237104	2513720515	582
298	iso_pu_bacteria	2721755755	2723846355	582
299	iso_pu_bacteria	2791355199	2793081178	582
300	iso_pu_bacteria	2879110137	2879118749	582
301	iso_pu_bacteria	2889033259	2889039140	582
302	iso_pu_bacteria	2922386360	2922388079	582
303	iso_pu_bacteria	8006964411	8006964734	582
304	iso_pu_bacteria	8006984368	8006991903	582
305	iso_pu_bacteria	8006994254	8006999841	582
306	iso_pu_bacteria	8056673599	8056680260	582
307	3300003215	JGI25153J46596_10001125	JGI25153J46596_1000112518	583
308	3300003354	JGI25160J50197_1004378	JGI25160J50197_10043783	583
309	3300003354	JGI25160J50197_1009323	JGI25160J50197_10093233	583
310	3300004625	Ga0055543_1002720	Ga0055543_10027202	583
311	3300005262	Ga0065165_1000278	Ga0065165_100027815	583
312	3300005262	Ga0065165_1002873	Ga0065165_100287310	583
313	3300005355	Ga0070671_100019527	Ga0070671_1000195272	583
314	3300005563	Ga0068855_100243547	Ga0068855_1002435471	583
315	3300005843	Ga0068860_100125260	Ga0068860_1001252601	583
316	3300006042	Ga0075368_10012562	Ga0075368_100125622	583
317	3300006048	Ga0075363_100004970	Ga0075363_1000049705	583
318	3300006195	Ga0075366_10013965	Ga0075366_100139652	583
319	3300006353	Ga0075370_10036533	Ga0075370_100365332	583
320	3300009177	Ga0105248_10167847	Ga0105248_101678471	583
321	3300014325	Ga0163163_10073300	Ga0163163_100733002	583
322	3300025254	Ga0209148_1000789	Ga0209148_100078917	583
323	3300025272	Ga0209455_1002658	Ga0209455_10026583	583
324	3300025295	Ga0209564_1002663	Ga0209564_10026632	583
325	3300025297	Ga0209758_1000065	Ga0209758_100006539	583
326	3300025297	Ga0209758_1003283	Ga0209758_10032832	583
327	3300025302	Ga0207426_1000721	Ga0207426_100072132	583
328	3300025304	Ga0209257_1001031	Ga0209257_100103118	583
329	3300025904	Ga0207647_10003213	Ga0207647_100032136	583
330	3300025949	Ga0207667_10063090	Ga0207667_100630903	583
331	3300026116	Ga0207674_10070149	Ga0207674_100701493	583
332	3300027296	Ga0209389_1000025	Ga0209389_100002583	583
333	3300027357	Ga0209589_1000066	Ga0209589_100006632	583
334	3300027361	Ga0209489_100030	Ga0209489_10003081	583
335	3300037471	Ga0395905_0044432	Ga0395905_0044432_1649_3535	583
336	3300044735	Ga0466968_0001112	Ga0466968_0001112_5020_6906	583
337	3300046507	Ga0495606_0000901	Ga0495606_0000901_19947_21839	583
338	3300048919	Ga0496116_0036831	Ga0496116_0036831_13_1899	583
339	3300048920	Ga0496117_0026561	Ga0496117_0026561_1182_3071	583
340	3300048920	Ga0496117_0066201	Ga0496117_0066201_78_1964	583
341	3300048928	Ga0496125_0095497	Ga0496125_0095497_268_2154	583
342	3300053087	Ga0500643_000019	Ga0500643_000019_59990_61876	583
343	3300053092	Ga0500583_0006789	Ga0500583_0006789_1580_3466	583
344	3300053103	Ga0500555_002417	Ga0500555_002417_823_2709	583
345	3300053139	Ga0500568_0007344	Ga0500568_0007344_3236_5122	583
346	3300053142	Ga0500577_0010705	Ga0500577_0010705_739_2625	583
347	3300053158	Ga0500627_0007465	Ga0500627_0007465_642_2528	583
348	3300053177	Ga0500636_0000076	Ga0500636_0000076_9427_11313	583
349	iso_pu_bacteria	3005506211	3005508725	583
350	3300003215	JGI25153J46596_10009100	JGI25153J46596_100091002	584
351	3300021320	Ga0214544_1000020	Ga0214544_1000020181	584
352	3300021321	Ga0214542_1000024	Ga0214542_1000024192	584
353	3300021324	Ga0214545_1000011	Ga0214545_1000011192	584
354	3300021327	Ga0214543_1000033	Ga0214543_100003312	584
355	3300025297	Ga0209758_1000498	Ga0209758_100049813	584
356	3300025302	Ga0207426_1000728	Ga0207426_100072837	584
357	3300025919	Ga0207657_10091768	Ga0207657_100917682	584
358	3300027296	Ga0209389_1000011	Ga0209389_100001125	584
359	3300027361	Ga0209489_100017	Ga0209489_100017209	584
360	3300027363	Ga0209700_100027	Ga0209700_10002725	584
361	3300046507	Ga0495606_0008105	Ga0495606_0008105_6923_8824	584
362	3300046524	Ga0495648_0011852	Ga0495648_0011852_2375_4276	584
363	3300046616	Ga0495668_0014863	Ga0495668_0014863_1446_3341	584
364	3300046663	Ga0495635_0001213	Ga0495635_0001213_3089_4990	584
365	3300046694	Ga0495649_0006901	Ga0495649_0006901_146_2047	584
366	3300048907	Ga0496104_0007090	Ga0496104_0007090_1264_3153	584
367	3300048907	Ga0496104_0007655	Ga0496104_0007655_5055_6956	584
368	3300048908	Ga0496105_0014195	Ga0496105_0014195_2958_4859	584
369	3300048913	Ga0496110_0031050	Ga0496110_0031050_2239_4128	584
370	3300053119	Ga0500595_003738	Ga0500595_003738_4692_6647	584
371	3300060353	Ga0501082_0050799	Ga0501082_0050799_76_1971	584
372	iso_pu_bacteria	2617270741	2617378933	584
373	iso_pu_bacteria	2935638405	2935643180	584
374	iso_pu_bacteria	2935827899	2935832676	584
375	iso_pu_bacteria	2935837841	2935839245	584
376	iso_pu_bacteria	2935864058	2935864897	584
377	iso_pu_bacteria	2935873716	2935876675	584
378	iso_pu_bacteria	8016583857	8016590869	584
379	iso_pu_bacteria	8019586578	8019588571	584
380	iso_pu_bacteria	8019597564	8019602766	584
381	iso_pu_bacteria	8019608314	8019615792	584
382	iso_pu_bacteria	8056689827	8056695181	584
383	3300046471	Ga0495650_0031346	Ga0495650_0031346_426_2321	585
384	3300053094	Ga0500566_0001951	Ga0500566_0001951_9963_11855	585
385	3300053119	Ga0500595_000286	Ga0500595_000286_27836_29728	585
386	3300053162	Ga0500638_000361	Ga0500638_000361_7552_9444	585
387	3300055283	Ga0500661_000031	Ga0500661_000031_15665_17557	585
388	3300003215	JGI25153J46596_10009055	JGI25153J46596_100090555	586
389	3300005334	Ga0068869_100008228	Ga0068869_1000082282	586
390	3300005334	Ga0068869_100016286	Ga0068869_1000162862	586
391	3300005334	Ga0068869_100017847	Ga0068869_1000178473	586
392	3300005367	Ga0070667_100042025	Ga0070667_1000420252	586
393	3300005455	Ga0070663_100016831	Ga0070663_1000168313	586
394	3300005455	Ga0070663_100021789	Ga0070663_1000217892	586
395	3300005455	Ga0070663_100029245	Ga0070663_1000292452	586
396	3300005455	Ga0070663_100060711	Ga0070663_1000607112	586
397	3300005455	Ga0070663_100075772	Ga0070663_1000757722	586
398	3300005456	Ga0070678_100037291	Ga0070678_1000372913	586
399	3300005539	Ga0068853_100034152	Ga0068853_1000341522	586
400	3300005548	Ga0070665_100012464	Ga0070665_1000124643	586
401	3300005548	Ga0070665_100023894	Ga0070665_1000238944	586
402	3300005548	Ga0070665_100112792	Ga0070665_1001127922	586
403	3300005577	Ga0068857_100036621	Ga0068857_1000366215	586
404	3300005616	Ga0068852_100063076	Ga0068852_1000630761	586
405	3300005719	Ga0068861_100026326	Ga0068861_1000263263	586
406	3300005843	Ga0068860_100028918	Ga0068860_1000289182	586
407	3300005843	Ga0068860_100107858	Ga0068860_1001078582	586
408	3300005937	Ga0081455_10030247	Ga0081455_100302474	586
409	3300005983	Ga0081540_1000978	Ga0081540_10009788	586
410	3300005983	Ga0081540_1006019	Ga0081540_10060192	586
411	3300005983	Ga0081540_1019636	Ga0081540_10196362	586
412	3300006048	Ga0075363_100013801	Ga0075363_1000138013	586
413	3300006178	Ga0075367_10014467	Ga0075367_100144674	586
414	3300006178	Ga0075367_10018247	Ga0075367_100182473	586
415	3300006178	Ga0075367_10020505	Ga0075367_100205053	586
416	3300009148	Ga0105243_10053685	Ga0105243_100536853	586
417	3300009177	Ga0105248_10091669	Ga0105248_100916692	586
418	3300009545	Ga0105237_10067242	Ga0105237_100672423	586
419	3300014969	Ga0157376_10035896	Ga0157376_100358963	586
420	3300017792	Ga0163161_10008867	Ga0163161_100088673	586
421	3300025297	Ga0209758_1003889	Ga0209758_10038894	586
422	3300025933	Ga0207706_10012522	Ga0207706_100125223	586
423	3300025949	Ga0207667_10013789	Ga0207667_100137897	586
424	3300025961	Ga0207712_10032789	Ga0207712_100327892	586
425	3300025972	Ga0207668_10009039	Ga0207668_100090392	586
426	3300025972	Ga0207668_10012067	Ga0207668_100120672	586
427	3300025972	Ga0207668_10063860	Ga0207668_100638602	586
428	3300026035	Ga0207703_10011077	Ga0207703_100110775	586
429	3300026067	Ga0207678_10029816	Ga0207678_100298163	586
430	3300026067	Ga0207678_10031587	Ga0207678_100315874	586
431	3300026067	Ga0207678_10033263	Ga0207678_100332633	586
432	3300026078	Ga0207702_10053930	Ga0207702_100539302	586
433	3300026116	Ga0207674_10098036	Ga0207674_100980363	586
434	3300026118	Ga0207675_100052944	Ga0207675_1000529442	586
435	3300026121	Ga0207683_10041039	Ga0207683_100410392	586
436	3300028379	Ga0268266_10003952	Ga0268266_1000395210	586
437	3300028379	Ga0268266_10013301	Ga0268266_100133013	586
438	3300028380	Ga0268265_10007673	Ga0268265_100076732	586
439	3300028381	Ga0268264_10033315	Ga0268264_100333153	586
440	3300028381	Ga0268264_10084133	Ga0268264_100841332	586
441	3300033180	Ga0307510_10044206	Ga0307510_100442062	586
442	3300046455	Ga0495603_0004058	Ga0495603_0004058_2196_4091	586
443	3300046455	Ga0495603_0039228	Ga0495603_0039228_577_2472	586
444	3300046492	Ga0495585_0030109	Ga0495585_0030109_940_2835	586
445	3300046499	Ga0495594_0020720	Ga0495594_0020720_1241_3136	586
446	3300046537	Ga0495598_0004937	Ga0495598_0004937_278_2173	586
447	3300046615	Ga0495656_0017052	Ga0495656_0017052_700_2595	586
448	3300048911	Ga0496108_0073728	Ga0496108_0073728_930_2825	586
449	3300048915	Ga0496112_0017655	Ga0496112_0017655_2140_4035	586
450	3300048917	Ga0496114_0124470	Ga0496114_0124470_306_2201	586
451	3300048924	Ga0496121_0037409	Ga0496121_0037409_101_1996	586
452	3300048929	Ga0496126_0004798	Ga0496126_0004798_4121_6016	586
453	3300050492	nmdc:mga0yw44_24235_c1	nmdc:mga0yw44_24235_c1_238_2133	586
454	3300050493	nmdc:mga0k408_38173_c1	nmdc:mga0k408_38173_c1_604_2499	586
455	3300050494	nmdc:mga06z11_14066_c1	nmdc:mga06z11_14066_c1_1281_3176	586
456	3300050496	nmdc:mga07m45_31890_c1	nmdc:mga07m45_31890_c1_557_2452	586
457	3300050496	nmdc:mga07m45_55953_c1	nmdc:mga07m45_55953_c1_38_1933	586
458	3300050516	nmdc:mga0sz30_8479_c1	nmdc:mga0sz30_8479_c1_30_1925	586
459	3300053096	Ga0500641_0003818	Ga0500641_0003818_1462_3357	586
460	3300053119	Ga0500595_010701	Ga0500595_010701_1560_3455	586
461	3300031507	Ga0307509_10126451	Ga0307509_101264512	587
462	3300031616	Ga0307508_10000650	Ga0307508_1000065033	587
463	3300031730	Ga0307516_10010903	Ga0307516_100109033	587
464	3300048909	Ga0496106_0001874	Ga0496106_0001874_3166_5064	587
465	3300048921	Ga0496118_0003878	Ga0496118_0003878_15297_17195	587
466	3300048924	Ga0496121_0000041	Ga0496121_0000041_327426_329324	587
467	3300048927	Ga0496124_0003100	Ga0496124_0003100_1718_3616	587
468	3300048929	Ga0496126_0009161	Ga0496126_0009161_5486_7384	587
469	3300025297	Ga0209758_1000997	Ga0209758_100099721	588
470	3300048915	Ga0496112_0000056	Ga0496112_0000056_893_2785	588
471	3300006028	Ga0070717_10038439	Ga0070717_100384392	589
472	3300035086	Ga0373934_0002829	Ga0373934_0002829_286_2178	589
473	3300035111	Ga0373923_0008671	Ga0373923_0008671_973_2865	589
474	3300035117	Ga0373953_0006551	Ga0373953_0006551_786_2678	589
475	3300035118	Ga0373954_0003601	Ga0373954_0003601_2696_4588	589
476	3300035119	Ga0373956_0040642	Ga0373956_0040642_54_1946	589
477	3300035172	Ga0373955_0001979	Ga0373955_0001979_5808_7700	589
478	3300035410	Ga0373924_0004239	Ga0373924_0004239_803_2695	589
479	3300035724	Ga0373933_0001129	Ga0373933_0001129_2575_4467	589
480	3300036401	Ga0373937_0003339	Ga0373937_0003339_11273_13165	589
481	3300046454	Ga0495592_0022669	Ga0495592_0022669_1499_3391	589
482	3300046459	Ga0495629_0001101	Ga0495629_0001101_13974_15866	589
483	3300046463	Ga0495653_0002591	Ga0495653_0002591_1086_2978	589
484	3300046511	Ga0495608_0002217	Ga0495608_0002217_303_2195	589
485	3300046514	Ga0495618_0022161	Ga0495618_0022161_1878_3770	589
486	3300046533	Ga0495640_0003781	Ga0495640_0003781_4378_6270	589
487	3300046559	Ga0495667_0028638	Ga0495667_0028638_32_1924	589
488	3300046642	Ga0495634_0038791	Ga0495634_0038791_100_1992	589
489	3300046663	Ga0495635_0004272	Ga0495635_0004272_1471_3363	589
490	3300046675	Ga0495657_0039644	Ga0495657_0039644_32_1924	589
491	3300046678	Ga0495599_0003019	Ga0495599_0003019_1450_3342	589
492	3300046680	Ga0495646_0006785	Ga0495646_0006785_5056_6948	589
493	3300046809	Ga0495600_0020241	Ga0495600_0020241_2061_3953	589
494	3300047317	Ga0495604_0040325	Ga0495604_0040325_463_2355	589
495	3300047322	Ga0495680_0033842	Ga0495680_0033842_2011_3903	589
496	3300047444	Ga0495675_0018056	Ga0495675_0018056_2150_4042	589
497	3300047471	Ga0495684_0011635	Ga0495684_0011635_1118_3010	589
498	3300047673	Ga0495593_0007418	Ga0495593_0007418_2498_4390	589
499	3300048088	Ga0495602_0015360	Ga0495602_0015360_5809_7701	589
500	3300053084	Ga0495595_0010976	Ga0495595_0010976_448_2340	589
501	3300003203	JGI25406J46586_10004468	JGI25406J46586_100044682	590
502	3300005985	Ga0081539_10000306	Ga0081539_1000030698	590

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

418

544

0.85 PF05226

CHASE2

CHASE2 domain

6

329

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5oyh-assembly8.cif.gz_O	crystal structure of the catalytic core of a rhodopsin-guanylyl cyclase with converted specificity in complex with atpalphas	0.8584	385	578
3mr7-assembly1.cif.gz_B	crystal structure of adenylate/guanylate cyclase/hydrolase from silicibacter pomeroyi	0.8515	385	579
5oyh-assembly8.cif.gz_P	crystal structure of the catalytic core of a rhodopsin-guanylyl cyclase with converted specificity in complex with atpalphas	0.8509	386	578
1wc6-assembly2.cif.gz_B-2	soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas in presence of bicarbonate	0.8504	386	577
2w01-assembly3.cif.gz_F	crystal structure of the guanylyl cyclase cya2	0.8479	386	576

ID	Description	Score	Start	End	Superfamily
af_P9WQ33_348_539_3.30.70.1230	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain	0.9099	386	581	3.30.70.1230
af_Q4CLR1_298_428_3.30.70.1230	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain	0.8984	385	515	3.30.70.1230
af_Q4CLR1_298_428_3.30.70.1230	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain	0.8858	385	515	3.30.70.1230
af_Q55F68_1579_1775_3.30.70.1230	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain	0.8767	389	576	3.30.70.1230
af_P9WQ33_348_539_3.30.70.1230	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain	0.8695	386	581	3.30.70.1230

ID	Description	Score	Start	End	GO Terms
AF-A0A7V3IZN7-F1-model_v4	Zinc-ribbon domain-containing protein	0.9313	391	491	GO:0004016 GO:0009190 GO:0035556
AF-A0A847HYR5-F1-model_v4	Adenylate/guanylate cyclase domain-containing protein	0.9278	386	528	GO:0004016 GO:0006171 GO:0035556
AF-A0A7Z9PRS1-F1-model_v4	Adenylate/guanylate cyclase domain-containing protein	0.9128	385	543	GO:0004016 GO:0006171 GO:0035556
AF-A0A2V6LNJ3-F1-model_v4	Guanylate cyclase domain-containing protein	0.9022	385	575	GO:0004016 GO:0009190 GO:0035556
AF-A0A0F8ZK23-F1-model_v4	Guanylate cyclase domain-containing protein	0.8973	385	576	GO:0009190 GO:0009975 GO:0016849 GO:0035556

Feature Viewer

pLDDT	pTM	Quality
76.48	0.54	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455944

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

418

544

0.85

PF05226

CHASE2

CHASE2 domain

6

329

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map