F454834

General Info

Members Datasets Scaffolds Average Seq Length
496 244 454 278

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100023414|Ga0070670_1000234142
Length 298
Sequence MDAAVGPFVQSREPDAPQSDVAGMDEEKIEDIEIRLLLEALYRRYHYDFRNYAQASVKRRLRQARERLGLATFSAMQDRLLHDPATTAYLLRYLTVQVSDFFRDPTHFRAIREKVIPHLRTYPSLKLWIAGCSTGEELYSYVILFREEGLEDRTLFYATDISQEALESAGRGIYALDRVKAFTNNHRLSGGKSSLSDYYTTGYGGAVFDKSLRDHVVFSDHSLVTDAVFSEMHLISCRNVMIYFDKKLQDRAIGLFRDSLIRNGFLALGSKESLRFSANSELFSEFDRNERIYQRRMG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
4 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
5 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
6 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
7 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
8 2643221558 Rhizobium sp. Root149 Isolate Unclassified
9 2643221607 Rhizobium sp. Root73 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
12 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
13 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
14 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
15 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
16 2643221688 Rhizobium sp. Root482 Isolate Unclassified
17 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
18 2643221718 Rhizobium sp. Root268 Isolate Unclassified
19 2643221733 Bosea sp. Root381 Isolate Unclassified
20 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
21 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
22 2734482264 Dyella sp. AD052 Isolate Unclassified
23 2738543009 Luteibacter sp. OK325 Isolate Unclassified
24 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
25 2751185800 Brucella pituitosa AA2 Isolate Unclassified
26 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
27 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
28 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
29 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
30 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
31 2849560528 Caulobacter zeae 410 Isolate Unclassified
32 2851153111 Caulobacter radicis 736 Isolate Unclassified
33 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
34 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
35 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
36 2919085039 Luteibacter sp. 1214 Isolate Unclassified
37 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
38 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
39 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
40 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
96 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
236 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
244 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.53
Metatranscriptomes 0
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.19
Nodule 0.81
Rhizoplane 3.02
Rhizosphere 44.56
Stem 0
Stem Tuber 0
Unclassified 28.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_940545 2162886007 Bacteria 35775
2 JGI25162J39368_1000766 3300002737 Bacteria 21719
3 JGI25152J39213_1000380 3300002773 Bacteria 27237
4 JGI25151J46595_10001461 3300003187 Bacteria 16021
5 JGI25165J46597_1000249 3300003214 Bacteria 72693
6 JGI25165J46597_1000958 3300003214 Bacteria 19665
7 rootH1_10055786 3300003316 Bacteria 2260
8 rootH2_10019443 3300003320 Bacteria 3552
9 rootL2_10026419 3300003322 Bacteria 1467
10 rootL2_10110963 3300003322 Bacteria 2541
11 rootL2_10140123 3300003322 Bacteria 1818
12 rootH1_10039569 3300003323 Bacteria 6694
13 rootH1_10043892 3300003323 Bacteria 37623
14 rootH1_10060688 3300003323 Bacteria 6599
15 rootH1_10087940 3300003323 Bacteria 2750
16 rootH1_10162781 3300003323 Bacteria 2616
17 Ga0055532_1008765 3300003758 Bacteria 1249
18 Ga0055526_1001101 3300003771 Bacteria 19634
19 Ga0055526_1003096 3300003771 Bacteria 10791
20 Ga0055526_1019140 3300003771 Bacteria 2509
21 Ga0055524_1000517 3300003775 Bacteria 29782
22 Ga0055524_1001780 3300003775 Bacteria 11833
23 Ga0055524_1010742 3300003775 Bacteria 3626
24 Ga0055524_1010838 3300003775 Bacteria 3604
25 Ga0055524_1045185 3300003775 Bacteria 1062
26 Ga0055536_1000029 3300003781 Bacteria 157375
27 Ga0055536_1000057 3300003781 Bacteria 104652
28 Ga0055528_1000217 3300003790 Bacteria 48469
29 Ga0055528_1007924 3300003790 Bacteria 4631
30 Ga0055528_1019935 3300003790 Bacteria 2196
31 Ga0055530_10000166 3300003791 Bacteria 59932
32 Ga0055530_10001175 3300003791 Bacteria 20244
33 Ga0055530_10016177 3300003791 Bacteria 2395
34 Ga0055531_10000053 3300003794 Bacteria 124623
35 Ga0065165_1036616 3300005262 Bacteria 1495
36 Ga0065704_10072790 3300005289 Bacteria 8006
37 Ga0065704_10085072 3300005289 Bacteria 3257
38 Ga0065704_10123716 3300005289 Bacteria 1707
39 Ga0070670_100023414 3300005331 Bacteria 5316
40 Ga0070670_100406766 3300005331 Bacteria 1202
41 Ga0070668_100003441 3300005347 Bacteria 11687
42 Ga0070669_100003046 3300005353 Bacteria 12058
43 Ga0070688_100485398 3300005365 Bacteria 929
44 Ga0070665_100000107 3300005548 Bacteria 156048
45 Ga0070665_100042902 3300005548 Bacteria 4547
46 Ga0070665_100133614 3300005548 Bacteria 2483
47 Ga0068855_100144153 3300005563 Bacteria 2713
48 Ga0068854_100047325 3300005578 Bacteria 3065
49 Ga0068856_100158455 3300005614 Bacteria 2274
50 Ga0068852_100344793 3300005616 Bacteria 1453
51 Ga0068863_100004365 3300005841 Bacteria 13943
52 Ga0068858_100077357 3300005842 Bacteria 3091
53 Ga0068858_100104138 3300005842 Bacteria 2648
54 Ga0068860_100132338 3300005843 Bacteria 2394
55 Ga0068862_100005605 3300005844 Bacteria 10492
56 Ga0081540_1001703 3300005983 Bacteria 18645
57 Ga0081539_10009583 3300005985 Bacteria 8052
58 Ga0075365_10202352 3300006038 Bacteria 1391
59 Ga0075368_10000119 3300006042 Bacteria 20738
60 Ga0075363_100002088 3300006048 Bacteria 7998
61 Ga0075364_10000636 3300006051 Bacteria 18131
62 Ga0075364_10001397 3300006051 Bacteria 13061
63 Ga0075367_10000122 3300006178 Bacteria 22590
64 Ga0075369_10000493 3300006186 Bacteria 12241
65 Ga0075366_10220591 3300006195 Bacteria 1155
66 Ga0075370_10011336 3300006353 Bacteria 4682
67 Ga0075370_10015463 3300006353 Bacteria 4087
68 Ga0075370_10053248 3300006353 Bacteria 2297
69 Ga0075370_10071338 3300006353 Bacteria 1987
70 Ga0075370_10254426 3300006353 Bacteria 1041
71 Ga0079104_1000105 3300006946 Bacteria 122989
72 Ga0105251_10003912 3300009011 Bacteria 10584
73 Ga0105247_10006034 3300009101 Bacteria 7537
74 Ga0105248_10027918 3300009177 Bacteria 6284
75 Ga0105237_10054813 3300009545 Bacteria 3994
76 Ga0105239_10083183 3300010375 Bacteria 3524
77 Ga0157371_10201468 3300013102 Bacteria 1427
78 Ga0157370_10000317 3300013104 Bacteria 60594
79 Ga0157370_10142560 3300013104 Bacteria 2233
80 Ga0157370_10178172 3300013104 Bacteria 1976
81 Ga0163162_10030166 3300013306 Bacteria 5372
82 Ga0163162_10657520 3300013306 Bacteria 1171
83 Ga0157376_10356721 3300014969 Bacteria 1401
84 Ga0182006_1000005 3300015261 Bacteria 621201
85 Ga0182005_1000004 3300015265 Bacteria 609645
86 Ga0183365_10001 3300015684 Bacteria 2090444
87 Ga0163161_10026846 3300017792 Bacteria 4082
88 Ga0163161_10027357 3300017792 Bacteria 4044
89 Ga0163161_10030290 3300017792 Bacteria 3849
90 Ga0209435_106839 3300025206 Bacteria 1267
91 Ga0209147_100574 3300025229 Bacteria 20602
92 Ga0209147_100598 3300025229 Bacteria 19868
93 Ga0209437_100023 3300025233 Bacteria 614195
94 Ga0209437_101665 3300025233 Bacteria 4994
95 Ga0209026_1001102 3300025250 Bacteria 12876
96 Ga0209129_1000045 3300025258 Bacteria 272407
97 Ga0209233_1000047 3300025261 Bacteria 459614
98 Ga0209233_1000219 3300025261 Bacteria 104797
99 Ga0209565_1000049 3300025263 Bacteria 224447
100 Ga0209565_1000062 3300025263 Bacteria 184007
101 Ga0209673_1000285 3300025273 Bacteria 94731
102 Ga0209673_1000458 3300025273 Bacteria 68889
103 Ga0209673_1002243 3300025273 Bacteria 13955
104 Ga0209673_1011198 3300025273 Bacteria 3713
105 Ga0209676_1000031 3300025292 Bacteria 478976
106 Ga0209676_1000057 3300025292 Bacteria 361061
107 Ga0209676_1014832 3300025292 Bacteria 2906
108 Ga0209025_1000653 3300025294 Bacteria 60534
109 Ga0209025_1002938 3300025294 Bacteria 16954
110 Ga0209564_1000023 3300025295 Bacteria 555102
111 Ga0209564_1000881 3300025295 Bacteria 39731
112 Ga0209564_1004008 3300025295 Bacteria 9329
113 Ga0209564_1005781 3300025295 Bacteria 6904
114 Ga0209564_1008955 3300025295 Bacteria 4848
115 Ga0209564_1010407 3300025295 Bacteria 4290
116 Ga0209758_1000956 3300025297 Bacteria 38990
117 Ga0209050_1000087 3300025298 Bacteria 261460
118 Ga0209050_1000096 3300025298 Bacteria 240109
119 Ga0209050_1000176 3300025298 Bacteria 146700
120 Ga0209050_1017406 3300025298 Bacteria 2869
121 Ga0209256_1000084 3300025299 Bacteria 219257
122 Ga0209256_1000260 3300025299 Bacteria 93956
123 Ga0209256_1000360 3300025299 Bacteria 74074
124 Ga0209256_1000681 3300025299 Bacteria 45724
125 Ga0209256_1000915 3300025299 Bacteria 36110
126 Ga0209256_1005826 3300025299 Bacteria 6860
127 Ga0209256_1014350 3300025299 Bacteria 2857
128 Ga0207426_1018119 3300025302 Bacteria 2488
129 Ga0209051_1001653 3300025303 Bacteria 17996
130 Ga0209051_1015305 3300025303 Bacteria 3534
131 Ga0209257_1000050 3300025304 Bacteria 439325
132 Ga0209257_1002882 3300025304 Bacteria 15984
133 Ga0207713_1001568 3300025735 Bacteria 17924
134 Ga0207710_10098416 3300025900 Bacteria 1377
135 Ga0207671_10004000 3300025914 Bacteria 14322
136 Ga0207681_10001134 3300025923 Bacteria 17207
137 Ga0207650_10079292 3300025925 Bacteria 2486
138 Ga0207650_10357235 3300025925 Bacteria 1203
139 Ga0207711_10113581 3300025941 Bacteria 2411
140 Ga0207640_10032682 3300025981 Bacteria 3228
141 Ga0207703_10066242 3300026035 Bacteria 2971
142 Ga0207641_10005769 3300026088 Bacteria 10515
143 Ga0207674_10146054 3300026116 Bacteria 2324
144 Ga0209281_1000108 3300027111 Bacteria 217582
145 Ga0209281_1007575 3300027111 Bacteria 2714
146 Ga0209371_1015430 3300027312 Bacteria 2053
147 Ga0209813_10000090 3300027866 Bacteria 33617
148 Ga0268266_10000879 3300028379 Bacteria 38938
149 Ga0268266_10033488 3300028379 Bacteria 4368
150 Ga0268265_10017889 3300028380 Bacteria 4901
151 Ga0268256_1017114 3300030500 Bacteria 2053
152 Ga0265328_10000078 3300031239 Bacteria 50914
153 Ga0265327_10107711 3300031251 Bacteria 1336
154 Ga0307405_10020359 3300031731 Bacteria 3706
155 Ga0307406_10047344 3300031901 Bacteria 2710
156 Ga0307412_10009531 3300031911 Bacteria 5574
157 Ga0307414_10017643 3300032004 Bacteria 4373
158 Ga0307414_10036141 3300032004 Bacteria 3295
159 Ga0395905_0000058 3300037471 Bacteria 200936
160 Ga0395905_0007505 3300037471 Bacteria 10848
161 Ga0436365_1915005 3300039437 Bacteria 5526
162 Ga0436363_0053080 3300039450 Bacteria 1185
163 Ga0451807_0431171 3300041486 Bacteria 3232
164 Ga0451837_0353386 3300041494 Bacteria 1301
165 Ga0466969_0000943 3300044656 Bacteria 15670
166 Ga0466969_0005820 3300044656 Bacteria 6553
167 Ga0466966_0004084 3300044684 Bacteria 9632
168 Ga0466966_0031802 3300044684 Bacteria 3422
169 Ga0466961_0003722 3300044693 Bacteria 9523
170 Ga0466961_0164762 3300044693 Bacteria 1380
171 Ga0466963_0055128 3300044694 Bacteria 2643
172 Ga0466971_0000742 3300044719 Bacteria 13058
173 Ga0466971_0018640 3300044719 Bacteria 3076
174 Ga0466970_0011606 3300044765 Bacteria 4495
175 Ga0466957_0004023 3300044842 Bacteria 8134
176 Ga0466959_0005790 3300045049 Bacteria 8513
177 Ga0466959_0097822 3300045049 Bacteria 2102
178 Ga0466958_0002714 3300045836 Bacteria 8971
179 Ga0495617_000016 3300046452 Bacteria 253600
180 Ga0495617_021285 3300046452 Bacteria 2190
181 Ga0495627_000060 3300046453 Bacteria 140874
182 Ga0495627_000734 3300046453 Bacteria 24759
183 Ga0495638_0000346 3300046460 Bacteria 58330
184 Ga0495638_0000528 3300046460 Bacteria 44566
185 Ga0495650_0000565 3300046471 Bacteria 52077
186 Ga0495650_0004122 3300046471 Bacteria 10127
187 Ga0495584_0000312 3300046491 Bacteria 33926
188 Ga0495584_0005217 3300046491 Bacteria 6896
189 Ga0495585_0000858 3300046492 Bacteria 25986
190 Ga0495596_0000117 3300046500 Bacteria 54473
191 Ga0495596_0000993 3300046500 Bacteria 16853
192 Ga0495607_0065026 3300046501 Bacteria 2058
193 Ga0495607_0080456 3300046501 Bacteria 1792
194 Ga0495607_0287021 3300046501 Bacteria 779
195 Ga0495583_0000020 3300046506 Bacteria 296185
196 Ga0495583_0037076 3300046506 Bacteria 2314
197 Ga0495606_0000073 3300046507 Bacteria 171657
198 Ga0495606_0000091 3300046507 Bacteria 153354
199 Ga0495606_0000253 3300046507 Bacteria 94485
200 Ga0495606_0000728 3300046507 Bacteria 50871
201 Ga0495606_0024267 3300046507 Bacteria 4374
202 Ga0495606_0029014 3300046507 Bacteria 3891
203 Ga0495606_0147986 3300046507 Bacteria 1380
204 Ga0495610_0000024 3300046512 Bacteria 304748
205 Ga0495610_0000161 3300046512 Bacteria 74599
206 Ga0495610_0000191 3300046512 Bacteria 68582
207 Ga0495610_0000907 3300046512 Bacteria 27553
208 Ga0495610_0001224 3300046512 Bacteria 23107
209 Ga0495610_0019854 3300046512 Bacteria 3746
210 Ga0495610_0027411 3300046512 Bacteria 3027
211 Ga0495616_0000001 3300046513 Bacteria 780061
212 Ga0495620_0003180 3300046515 Bacteria 9423
213 Ga0495620_0059574 3300046515 Bacteria 1595
214 Ga0495631_0000611 3300046518 Bacteria 23549
215 Ga0495631_0094652 3300046518 Bacteria 1286
216 Ga0495632_0000013 3300046519 Bacteria 247879
217 Ga0495632_0000045 3300046519 Bacteria 140664
218 Ga0495632_0001003 3300046519 Bacteria 24473
219 Ga0495632_0006108 3300046519 Bacteria 7807
220 Ga0495632_0030268 3300046519 Bacteria 2811
221 Ga0495637_0001215 3300046520 Bacteria 15648
222 Ga0495637_0016277 3300046520 Bacteria 3477
223 Ga0495643_0000010 3300046522 Bacteria 341431
224 Ga0495643_0000048 3300046522 Bacteria 212788
225 Ga0495643_0018957 3300046522 Bacteria 3985
226 Ga0495643_0047853 3300046522 Bacteria 2314
227 Ga0495648_0000525 3300046524 Bacteria 41255
228 Ga0495648_0012406 3300046524 Bacteria 6362
229 Ga0495648_0034202 3300046524 Bacteria 3310
230 Ga0495648_0071938 3300046524 Bacteria 2003
231 Ga0495663_0000004 3300046525 Bacteria 355166
232 Ga0495654_0001447 3300046530 Bacteria 16303
233 Ga0495654_0049349 3300046530 Bacteria 2062
234 Ga0495645_0174291 3300046543 Bacteria 1478
235 Ga0495633_0000760 3300046558 Bacteria 29004
236 Ga0495633_0004825 3300046558 Bacteria 8451
237 Ga0495633_0055245 3300046558 Bacteria 1867
238 Ga0495668_0000039 3300046616 Bacteria 231402
239 Ga0495668_0012888 3300046616 Bacteria 4950
240 Ga0495668_0034794 3300046616 Bacteria 2824
241 Ga0495611_0000006 3300046648 Bacteria 249842
242 Ga0495625_0001608 3300046660 Bacteria 26653
243 Ga0495625_0004171 3300046660 Bacteria 13774
244 Ga0495625_0038624 3300046660 Bacteria 3493
245 Ga0495670_0004553 3300046691 Bacteria 6800
246 Ga0495671_0000014 3300046692 Bacteria 341431
247 Ga0495671_0118414 3300046692 Bacteria 1293
248 Ga0495660_0000025 3300046810 Bacteria 260275
249 Ga0495683_0001817 3300047323 Bacteria 13427
250 Ga0495673_0000001 3300047469 Bacteria 1630730
251 Ga0495673_0000018 3300047469 Bacteria 569190
252 Ga0495673_0000556 3300047469 Bacteria 38135
253 Ga0495673_0001551 3300047469 Bacteria 18022
254 Ga0495673_0056587 3300047469 Bacteria 1696
255 Ga0495681_0000014 3300047470 Bacteria 184395
256 Ga0495681_0000050 3300047470 Bacteria 109433
257 Ga0495681_0002429 3300047470 Bacteria 13307
258 Ga0495686_0000037 3300047472 Bacteria 307937
259 Ga0495686_0000171 3300047472 Bacteria 123194
260 Ga0495686_0003118 3300047472 Bacteria 14648
261 Ga0495686_0005455 3300047472 Bacteria 10022
262 Ga0495686_0005839 3300047472 Bacteria 9600
263 Ga0495686_0022630 3300047472 Bacteria 4158
264 Ga0495686_0023346 3300047472 Bacteria 4080
265 Ga0495686_0024200 3300047472 Bacteria 3994
266 Ga0495686_0027561 3300047472 Bacteria 3708
267 Ga0495602_0423477 3300048088 Bacteria 945
268 Ga0495615_0000428 3300048090 Bacteria 6234
269 Ga0495626_0000970 3300048091 Bacteria 24744
270 Ga0496100_0004883 3300048903 Bacteria 7168
271 Ga0496101_0000919 3300048904 Bacteria 17374
272 Ga0496101_0023339 3300048904 Bacteria 4272
273 Ga0496101_0212569 3300048904 Bacteria 1499
274 Ga0496103_0066227 3300048906 Bacteria 2254
275 Ga0496104_0192362 3300048907 Bacteria 1952
276 Ga0496106_0010353 3300048909 Bacteria 6891
277 Ga0496107_0000019 3300048910 Bacteria 150224
278 Ga0496111_0118095 3300048914 Bacteria 1957
279 Ga0496115_0000127 3300048918 Bacteria 68926
280 Ga0496115_0004194 3300048918 Bacteria 10419
281 Ga0496116_0000108 3300048919 Bacteria 187993
282 Ga0496116_0011422 3300048919 Bacteria 7352
283 Ga0496116_0045192 3300048919 Bacteria 2983
284 Ga0496116_0078737 3300048919 Bacteria 2054
285 Ga0496117_0001460 3300048920 Bacteria 34058
286 Ga0496117_0002537 3300048920 Bacteria 22802
287 Ga0496117_0011907 3300048920 Bacteria 7734
288 Ga0496117_0037294 3300048920 Bacteria 3623
289 Ga0496117_0085412 3300048920 Bacteria 2055
290 Ga0496118_0010477 3300048921 Bacteria 9177
291 Ga0496118_0011686 3300048921 Bacteria 8534
292 Ga0496118_0017158 3300048921 Bacteria 6604
293 Ga0496118_0059260 3300048921 Bacteria 2853
294 Ga0496118_0096167 3300048921 Bacteria 2019
295 Ga0496118_0108497 3300048921 Bacteria 1850
296 Ga0496119_0002664 3300048922 Bacteria 19315
297 Ga0496119_0013302 3300048922 Bacteria 6575
298 Ga0496119_0078244 3300048922 Bacteria 1913
299 Ga0496119_0084392 3300048922 Bacteria 1821
300 Ga0496120_0000608 3300048923 Bacteria 54347
301 Ga0496120_0019764 3300048923 Bacteria 4299
302 Ga0496121_0000005 3300048924 Bacteria 1034486
303 Ga0496121_0000022 3300048924 Bacteria 472849
304 Ga0496121_0000105 3300048924 Bacteria 191437
305 Ga0496121_0000501 3300048924 Bacteria 74907
306 Ga0496121_0000637 3300048924 Bacteria 65479
307 Ga0496121_0001054 3300048924 Bacteria 48888
308 Ga0496121_0001281 3300048924 Bacteria 43294
309 Ga0496121_0002401 3300048924 Bacteria 28702
310 Ga0496121_0003040 3300048924 Bacteria 24355
311 Ga0496121_0023405 3300048924 Bacteria 5950
312 Ga0496121_0023927 3300048924 Bacteria 5857
313 Ga0496121_0029690 3300048924 Bacteria 5044
314 Ga0496121_0130677 3300048924 Bacteria 1880
315 Ga0496121_0150014 3300048924 Bacteria 1717
316 Ga0496121_0181584 3300048924 Bacteria 1518
317 Ga0496121_0228495 3300048924 Bacteria 1305
318 Ga0496122_0000514 3300048925 Bacteria 80001
319 Ga0496122_0003347 3300048925 Bacteria 21147
320 Ga0496122_0005028 3300048925 Bacteria 15995
321 Ga0496122_0007666 3300048925 Bacteria 11903
322 Ga0496122_0011203 3300048925 Bacteria 9121
323 Ga0496122_0020350 3300048925 Bacteria 6000
324 Ga0496122_0024990 3300048925 Bacteria 5210
325 Ga0496122_0078051 3300048925 Bacteria 2321
326 Ga0496122_0131510 3300048925 Bacteria 1588
327 Ga0496123_0000462 3300048926 Bacteria 71306
328 Ga0496123_0000630 3300048926 Bacteria 58939
329 Ga0496123_0000719 3300048926 Bacteria 54039
330 Ga0496123_0001779 3300048926 Bacteria 28398
331 Ga0496123_0010151 3300048926 Bacteria 8364
332 Ga0496123_0012554 3300048926 Bacteria 7212
333 Ga0496123_0044832 3300048926 Bacteria 3019
334 Ga0496123_0046007 3300048926 Bacteria 2964
335 Ga0496123_0051175 3300048926 Bacteria 2753
336 Ga0496123_0054553 3300048926 Bacteria 2630
337 Ga0496123_0068813 3300048926 Bacteria 2227
338 Ga0496123_0095030 3300048926 Bacteria 1755
339 Ga0496124_0000175 3300048927 Bacteria 128785
340 Ga0496124_0000409 3300048927 Bacteria 77585
341 Ga0496124_0001192 3300048927 Bacteria 40512
342 Ga0496124_0001297 3300048927 Bacteria 37856
343 Ga0496124_0001553 3300048927 Bacteria 33192
344 Ga0496124_0002416 3300048927 Bacteria 24498
345 Ga0496124_0011694 3300048927 Bacteria 8757
346 Ga0496124_0014941 3300048927 Bacteria 7475
347 Ga0496124_0019244 3300048927 Bacteria 6363
348 Ga0496124_0020426 3300048927 Bacteria 6118
349 Ga0496124_0026200 3300048927 Bacteria 5262
350 Ga0496124_0075341 3300048927 Bacteria 2787
351 Ga0496124_0078737 3300048927 Bacteria 2716
352 Ga0496124_0084481 3300048927 Bacteria 2603
353 Ga0496125_0000145 3300048928 Bacteria 156267
354 Ga0496125_0000159 3300048928 Bacteria 151205
355 Ga0496125_0000162 3300048928 Bacteria 149093
356 Ga0496125_0000332 3300048928 Bacteria 90664
357 Ga0496125_0000471 3300048928 Bacteria 71765
358 Ga0496125_0014486 3300048928 Bacteria 7678
359 Ga0496125_0015517 3300048928 Bacteria 7362
360 Ga0496125_0017542 3300048928 Bacteria 6820
361 Ga0496125_0022156 3300048928 Bacteria 5904
362 Ga0496125_0028917 3300048928 Bacteria 4992
363 Ga0496125_0028978 3300048928 Bacteria 4986
364 Ga0496125_0216336 3300048928 Bacteria 1239
365 Ga0496126_0001374 3300048929 Bacteria 38480
366 Ga0496126_0003325 3300048929 Bacteria 20455
367 Ga0496126_0007169 3300048929 Bacteria 12270
368 Ga0496126_0014337 3300048929 Bacteria 8016
369 Ga0496126_0038003 3300048929 Bacteria 4482
370 Ga0496126_0042728 3300048929 Bacteria 4185
371 Ga0496126_0044754 3300048929 Bacteria 4073
372 Ga0496126_0046755 3300048929 Bacteria 3966
373 Ga0496126_0100852 3300048929 Bacteria 2526
374 Ga0496126_0440298 3300048929 Bacteria 1051
375 Ga0495682_0022329 3300049460 Bacteria 2367
376 Ga0501031_0003571 3300049568 Bacteria 9995
377 Ga0501031_0047111 3300049568 Bacteria 2810
378 Ga0501032_0000013 3300049569 Bacteria 185070
379 Ga0501032_0000071 3300049569 Bacteria 86150
380 Ga0501033_0000522 3300049570 Bacteria 36025
381 Ga0501033_0181410 3300049570 Bacteria 1509
382 Ga0501033_0199239 3300049570 Bacteria 1431
383 Ga0501034_0000001 3300049571 Bacteria 2184493
384 Ga0501034_0000054 3300049571 Bacteria 206373
385 Ga0501034_0067895 3300049571 Bacteria 3577
386 Ga0501034_0105886 3300049571 Bacteria 2805
387 Ga0501034_0110905 3300049571 Bacteria 2734
388 Ga0501034_0285007 3300049571 Bacteria 1591
389 Ga0501036_0000031 3300049572 Bacteria 92249
390 Ga0501036_0259662 3300049572 Bacteria 1455
391 Ga0501036_0295974 3300049572 Bacteria 1354
392 Ga0501037_0000096 3300049573 Bacteria 81773
393 Ga0501038_0000018 3300049574 Bacteria 155191
394 Ga0501038_0000038 3300049574 Bacteria 123099
395 Ga0501039_0000001 3300049575 Bacteria 449008
396 Ga0501039_0000120 3300049575 Bacteria 54259
397 Ga0501041_0090581 3300049577 Bacteria 1888
398 Ga0501043_0000014 3300049579 Bacteria 184687
399 Ga0501043_0049326 3300049579 Bacteria 3310
400 Ga0501046_0117763 3300049580 Bacteria 2023
401 Ga0501047_0066016 3300049581 Bacteria 3488
402 Ga0501047_0206866 3300049581 Bacteria 1822
403 Ga0501070_0085304 3300049586 Bacteria 2615
404 Ga0501070_0362499 3300049586 Bacteria 1176
405 Ga0501238_000549 3300049671 Bacteria 4322
406 Ga0501035_0000019 3300049822 Bacteria 241152
407 Ga0501035_0022872 3300049822 Bacteria 5740
408 Ga0501035_0026782 3300049822 Bacteria 5273
409 Ga0501035_0042484 3300049822 Bacteria 4100
410 Ga0501035_0045782 3300049822 Bacteria 3935
411 Ga0501044_0001388 3300049823 Bacteria 28408
412 Ga0501044_0008908 3300049823 Bacteria 10967
413 Ga0501044_0081450 3300049823 Bacteria 3277
414 Ga0501044_0086596 3300049823 Bacteria 3164
415 Ga0501044_0124011 3300049823 Bacteria 2582
416 Ga0501044_0178809 3300049823 Bacteria 2089
417 Ga0501044_0293959 3300049823 Bacteria 1555
418 nmdc:mga03n38_4336_c1 3300050490 Bacteria 4684
419 nmdc:mga00v17_13490_c1 3300050491 Bacteria 4540
420 nmdc:mga00v17_235_c1 3300050491 Bacteria 32831
421 nmdc:mga00v17_97486_c1 3300050491 Bacteria 1853
422 nmdc:mga0k408_108214_c1 3300050493 Bacteria 1211
423 nmdc:mga06z11_254_c1 3300050494 Bacteria 20765
424 nmdc:mga04h51_143_c1 3300050495 Bacteria 20737
425 nmdc:mga07m45_12356_c1 3300050496 Bacteria 4511
426 nmdc:mga07m45_128921_c1 3300050496 Bacteria 1463
427 nmdc:mga07m45_3827_c1 3300050496 Bacteria 7287
428 nmdc:mga07m45_51442_c1 3300050496 Bacteria 2323
429 nmdc:mga0sz30_31169_c1 3300050516 Bacteria 2206
430 Ga0500635_0001480 3300053080 Bacteria 5651
431 Ga0500643_000198 3300053087 Bacteria 57293
432 Ga0500643_026603 3300053087 Bacteria 1809
433 Ga0500644_0000012 3300053088 Bacteria 117525
434 Ga0500555_044683 3300053103 Bacteria 1226
435 Ga0500607_000231 3300053121 Bacteria 51561
436 Ga0500608_000048 3300053122 Bacteria 55108
437 Ga0500608_000403 3300053122 Bacteria 16592
438 Ga0500618_000247 3300053125 Bacteria 43001
439 Ga0500618_000390 3300053125 Bacteria 30118
440 Ga0500658_0018071 3300053134 Bacteria 2640
441 Ga0500559_0000046 3300053136 Bacteria 98853
442 Ga0500559_0000228 3300053136 Bacteria 44687
443 Ga0500559_0001061 3300053136 Bacteria 16692
444 Ga0500559_0005579 3300053136 Bacteria 5773
445 Ga0500559_0015860 3300053136 Bacteria 3181
446 Ga0500564_000050 3300053138 Bacteria 30326
447 Ga0500603_018183 3300053150 Bacteria 1690
448 Ga0500622_0011977 3300053156 Bacteria 4715
449 Ga0500622_0142362 3300053156 Bacteria 1142
450 Ga0500636_0000727 3300053177 Bacteria 17758
451 Ga0500637_0021487 3300053178 Bacteria 3506
452 Ga0500645_005984 3300053730 Bacteria 4397
453 Ga0500661_015746 3300055283 Bacteria 1355
454 Ga0466962_0001393 3300061719 Bacteria 11241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0287021 Ga0495607_0287021_36_764 242
2 3300048921 Ga0496118_0108497 Ga0496118_0108497_1084_1821 245
3 3300048925 Ga0496122_0131510 Ga0496122_0131510_811_1548 245
4 3300026116 Ga0207674_10146054 Ga0207674_101460542 251
5 3300049571 Ga0501034_0067895 Ga0501034_0067895_1504_2286 256
6 3300049574 Ga0501038_0000038 Ga0501038_0000038_102464_103291 261
7 3300003320 rootH2_10019443 rootH2_100194432 264
8 3300003323 rootH1_10043892 rootH1_1004389234 265
9 3300046543 Ga0495645_0174291 Ga0495645_0174291_599_1432 265
10 3300006353 Ga0075370_10053248 Ga0075370_100532482 267
11 3300053178 Ga0500637_0021487 Ga0500637_0021487_181_984 267
12 iso_pu_bacteria 2643221614 2644086419 269
13 iso_pu_bacteria 2643221661 2644344917 269
14 iso_pu_bacteria 2643221666 2644367660 269
15 iso_pu_bacteria 2884960567 2884964489 269
16 3300041486 Ga0451807_0431171 Ga0451807_0431171_152_964 270
17 3300041494 Ga0451837_0353386 Ga0451837_0353386_232_1044 270
18 iso_pu_bacteria 2849560528 2849565324 270
19 iso_pu_bacteria 2851153111 2851158219 270
20 iso_pu_bacteria 2857504554 2857507013 270
21 iso_pu_bacteria 2671180531 2673165675 271
22 iso_pu_bacteria 8054302542 8054304581 271
23 3300031239 Ga0265328_10000078 Ga0265328_1000007836 272
24 3300044656 Ga0466969_0000943 Ga0466969_0000943_2326_3144 272
25 3300044656 Ga0466969_0005820 Ga0466969_0005820_4418_5242 272
26 3300044684 Ga0466966_0004084 Ga0466966_0004084_3212_4030 272
27 3300044684 Ga0466966_0031802 Ga0466966_0031802_12_836 272
28 3300044693 Ga0466961_0003722 Ga0466961_0003722_3539_4357 272
29 3300044693 Ga0466961_0164762 Ga0466961_0164762_500_1324 272
30 3300044694 Ga0466963_0055128 Ga0466963_0055128_1566_2384 272
31 3300044719 Ga0466971_0000742 Ga0466971_0000742_4171_4989 272
32 3300044719 Ga0466971_0018640 Ga0466971_0018640_308_1132 272
33 3300044765 Ga0466970_0011606 Ga0466970_0011606_1973_2791 272
34 3300044842 Ga0466957_0004023 Ga0466957_0004023_3400_4218 272
35 3300045049 Ga0466959_0005790 Ga0466959_0005790_2454_3272 272
36 3300045049 Ga0466959_0097822 Ga0466959_0097822_951_1775 272
37 3300045836 Ga0466958_0002714 Ga0466958_0002714_5479_6297 272
38 3300061719 Ga0466962_0001393 Ga0466962_0001393_4862_5680 272
39 iso_pu_bacteria 2739367756 2739793740 272
40 iso_pu_bacteria 2881101125 2881103342 272
41 3300049823 Ga0501044_0008908 Ga0501044_0008908_7249_8076 273
42 iso_pu_bacteria 2599185236 2599724327 273
43 iso_pu_bacteria 2643221558 2643810536 273
44 iso_pu_bacteria 2643221607 2644048136 273
45 iso_pu_bacteria 2643221636 2644200257 273
46 iso_pu_bacteria 2643221686 2644480929 273
47 iso_pu_bacteria 2818991461 2819688788 273
48 3300003322 rootL2_10140123 rootL2_101401232 274
49 3300003775 Ga0055524_1010838 Ga0055524_10108383 274
50 3300003775 Ga0055524_1045185 Ga0055524_10451852 274
51 3300003781 Ga0055536_1000057 Ga0055536_100005738 274
52 3300003790 Ga0055528_1007924 Ga0055528_10079244 274
53 3300003791 Ga0055530_10001175 Ga0055530_100011759 274
54 3300003794 Ga0055531_10000053 Ga0055531_1000005365 274
55 3300005365 Ga0070688_100485398 Ga0070688_1004853981 274
56 3300006195 Ga0075366_10220591 Ga0075366_102205912 274
57 3300006353 Ga0075370_10015463 Ga0075370_100154631 274
58 3300014969 Ga0157376_10356721 Ga0157376_103567212 274
59 3300017792 Ga0163161_10026846 Ga0163161_100268462 274
60 3300017792 Ga0163161_10030290 Ga0163161_100302904 274
61 3300025233 Ga0209437_101665 Ga0209437_1016655 274
62 3300025263 Ga0209565_1000049 Ga0209565_10000497 274
63 3300025273 Ga0209673_1000458 Ga0209673_100045821 274
64 3300025292 Ga0209676_1000031 Ga0209676_1000031174 274
65 3300025295 Ga0209564_1010407 Ga0209564_10104072 274
66 3300025297 Ga0209758_1000956 Ga0209758_100095626 274
67 3300025298 Ga0209050_1000087 Ga0209050_100008798 274
68 3300025299 Ga0209256_1000360 Ga0209256_10003602 274
69 3300025299 Ga0209256_1005826 Ga0209256_10058264 274
70 3300025299 Ga0209256_1014350 Ga0209256_10143503 274
71 3300025304 Ga0209257_1000050 Ga0209257_1000050256 274
72 3300031251 Ga0265327_10107711 Ga0265327_101077112 274
73 3300039450 Ga0436363_0053080 Ga0436363_0053080_240_1064 274
74 3300046452 Ga0495617_000016 Ga0495617_000016_176975_177811 274
75 3300046460 Ga0495638_0000346 Ga0495638_0000346_48179_49003 274
76 3300046491 Ga0495584_0005217 Ga0495584_0005217_2575_3399 274
77 3300046506 Ga0495583_0000020 Ga0495583_0000020_281915_282739 274
78 3300046507 Ga0495606_0029014 Ga0495606_0029014_612_1436 274
79 3300046512 Ga0495610_0000024 Ga0495610_0000024_242140_242964 274
80 3300046518 Ga0495631_0094652 Ga0495631_0094652_125_961 274
81 3300046519 Ga0495632_0000013 Ga0495632_0000013_170004_170828 274
82 3300046520 Ga0495637_0001215 Ga0495637_0001215_9057_9881 274
83 3300046522 Ga0495643_0000010 Ga0495643_0000010_334081_334905 274
84 3300046524 Ga0495648_0000525 Ga0495648_0000525_38917_39741 274
85 3300046524 Ga0495648_0071938 Ga0495648_0071938_579_1403 274
86 3300046525 Ga0495663_0000004 Ga0495663_0000004_277268_278092 274
87 3300046558 Ga0495633_0000760 Ga0495633_0000760_10705_11529 274
88 3300046558 Ga0495633_0004825 Ga0495633_0004825_4949_5773 274
89 3300046616 Ga0495668_0000039 Ga0495668_0000039_228778_229602 274
90 3300046660 Ga0495625_0001608 Ga0495625_0001608_18818_19642 274
91 3300046692 Ga0495671_0000014 Ga0495671_0000014_334081_334905 274
92 3300047469 Ga0495673_0000556 Ga0495673_0000556_13636_14460 274
93 3300047469 Ga0495673_0001551 Ga0495673_0001551_12787_13611 274
94 3300047470 Ga0495681_0002429 Ga0495681_0002429_2272_3096 274
95 3300047472 Ga0495686_0000037 Ga0495686_0000037_198246_199082 274
96 3300047472 Ga0495686_0000171 Ga0495686_0000171_89618_90442 274
97 3300047472 Ga0495686_0005839 Ga0495686_0005839_3807_4631 274
98 3300047472 Ga0495686_0024200 Ga0495686_0024200_1700_2524 274
99 3300047472 Ga0495686_0027561 Ga0495686_0027561_1073_1897 274
100 3300048088 Ga0495602_0423477 Ga0495602_0423477_98_922 274
101 3300048907 Ga0496104_0192362 Ga0496104_0192362_206_1030 274
102 3300048910 Ga0496107_0000019 Ga0496107_0000019_114107_114931 274
103 3300048918 Ga0496115_0000127 Ga0496115_0000127_53176_54000 274
104 3300048918 Ga0496115_0004194 Ga0496115_0004194_696_1520 274
105 3300048922 Ga0496119_0002664 Ga0496119_0002664_17481_18305 274
106 3300048922 Ga0496119_0084392 Ga0496119_0084392_279_1103 274
107 3300048923 Ga0496120_0000608 Ga0496120_0000608_33439_34263 274
108 3300048924 Ga0496121_0000105 Ga0496121_0000105_15155_15979 274
109 3300048924 Ga0496121_0000637 Ga0496121_0000637_38609_39433 274
110 3300048924 Ga0496121_0181584 Ga0496121_0181584_218_1042 274
111 3300048925 Ga0496122_0000514 Ga0496122_0000514_13455_14279 274
112 3300048926 Ga0496123_0000462 Ga0496123_0000462_13536_14360 274
113 3300048927 Ga0496124_0026200 Ga0496124_0026200_2339_3169 274
114 3300048927 Ga0496124_0084481 Ga0496124_0084481_1002_1826 274
115 3300048929 Ga0496126_0007169 Ga0496126_0007169_3890_4714 274
116 3300048929 Ga0496126_0042728 Ga0496126_0042728_3194_4018 274
117 3300048929 Ga0496126_0046755 Ga0496126_0046755_1354_2178 274
118 3300049671 Ga0501238_000549 Ga0501238_000549_132_956 274
119 3300050493 nmdc:mga0k408_108214_c1 nmdc:mga0k408_108214_c1_159_983 274
120 3300050496 nmdc:mga07m45_12356_c1 nmdc:mga07m45_12356_c1_498_1322 274
121 3300050496 nmdc:mga07m45_51442_c1 nmdc:mga07m45_51442_c1_402_1226 274
122 3300053087 Ga0500643_026603 Ga0500643_026603_868_1692 274
123 3300053088 Ga0500644_0000012 Ga0500644_0000012_60080_60904 274
124 3300053103 Ga0500555_044683 Ga0500555_044683_350_1174 274
125 3300053121 Ga0500607_000231 Ga0500607_000231_4071_4895 274
126 3300053122 Ga0500608_000048 Ga0500608_000048_44967_45791 274
127 3300053125 Ga0500618_000247 Ga0500618_000247_39405_40229 274
128 3300053134 Ga0500658_0018071 Ga0500658_0018071_816_1640 274
129 3300053136 Ga0500559_0000046 Ga0500559_0000046_62875_63699 274
130 3300053136 Ga0500559_0000228 Ga0500559_0000228_39793_40617 274
131 3300053136 Ga0500559_0001061 Ga0500559_0001061_8651_9475 274
132 3300053136 Ga0500559_0015860 Ga0500559_0015860_1057_1881 274
133 3300053138 Ga0500564_000050 Ga0500564_000050_13482_14306 274
134 3300053156 Ga0500622_0011977 Ga0500622_0011977_2110_2934 274
135 3300053156 Ga0500622_0142362 Ga0500622_0142362_276_1100 274
136 3300053730 Ga0500645_005984 Ga0500645_005984_2639_3463 274
137 iso_pu_bacteria 2582581294 2585204947 274
138 iso_pu_bacteria 2599185156 2599335969 274
139 iso_pu_bacteria 2599185359 2600226583 274
140 iso_pu_bacteria 2643221637 2644207940 274
141 iso_pu_bacteria 2643221688 2644492738 274
142 iso_pu_bacteria 2643221688 2644493909 274
143 iso_pu_bacteria 2643221689 2644498515 274
144 iso_pu_bacteria 2643221718 2644651342 274
145 iso_pu_bacteria 2643221733 2644729955 274
146 iso_pu_bacteria 2718218334 2721027173 274
147 iso_pu_bacteria 2734482264 2735837229 274
148 iso_pu_bacteria 2738543009 2739226702 274
149 iso_pu_bacteria 2751185800 2753361076 274
150 iso_pu_bacteria 2818991466 2819712454 274
151 iso_pu_bacteria 2842922631 2842926877 274
152 iso_pu_bacteria 2919085039 2919085210 274
153 iso_pu_bacteria 2928526807 2928526965 274
154 iso_pu_bacteria 2928968154 2928969431 274
155 iso_pu_bacteria 2929138655 2929142880 274
156 iso_pu_bacteria 3005445848 3005452134 274
157 iso_pu_bacteria 8005542996 8005548762 274
158 3300003323 rootH1_10162781 rootH1_101627812 275
159 3300003791 Ga0055530_10016177 Ga0055530_100161772 275
160 3300005289 Ga0065704_10123716 Ga0065704_101237162 275
161 3300005347 Ga0070668_100003441 Ga0070668_1000034417 275
162 3300005353 Ga0070669_100003046 Ga0070669_1000030465 275
163 3300005614 Ga0068856_100158455 Ga0068856_1001584552 275
164 3300005844 Ga0068862_100005605 Ga0068862_1000056054 275
165 3300006042 Ga0075368_10000119 Ga0075368_1000011910 275
166 3300006048 Ga0075363_100002088 Ga0075363_1000020882 275
167 3300006178 Ga0075367_10000122 Ga0075367_1000012210 275
168 3300006353 Ga0075370_10011336 Ga0075370_100113362 275
169 3300009011 Ga0105251_10003912 Ga0105251_100039121 275
170 3300009177 Ga0105248_10027918 Ga0105248_100279182 275
171 3300025229 Ga0209147_100598 Ga0209147_10059811 275
172 3300025250 Ga0209026_1001102 Ga0209026_10011023 275
173 3300025298 Ga0209050_1000176 Ga0209050_100017696 275
174 3300025735 Ga0207713_1001568 Ga0207713_10015685 275
175 3300025941 Ga0207711_10113581 Ga0207711_101135812 275
176 3300027866 Ga0209813_10000090 Ga0209813_1000009016 275
177 3300028380 Ga0268265_10017889 Ga0268265_100178892 275
178 3300037471 Ga0395905_0007505 Ga0395905_0007505_4583_5410 275
179 3300046453 Ga0495627_000734 Ga0495627_000734_15071_15898 275
180 3300046471 Ga0495650_0000565 Ga0495650_0000565_8525_9352 275
181 3300046512 Ga0495610_0000191 Ga0495610_0000191_15806_16633 275
182 3300046515 Ga0495620_0059574 Ga0495620_0059574_291_1118 275
183 3300046530 Ga0495654_0049349 Ga0495654_0049349_296_1123 275
184 3300047470 Ga0495681_0000014 Ga0495681_0000014_175070_175897 275
185 3300048904 Ga0496101_0212569 Ga0496101_0212569_355_1182 275
186 3300048906 Ga0496103_0066227 Ga0496103_0066227_590_1417 275
187 3300048919 Ga0496116_0000108 Ga0496116_0000108_59719_60546 275
188 3300048920 Ga0496117_0002537 Ga0496117_0002537_10333_11160 275
189 3300048920 Ga0496117_0037294 Ga0496117_0037294_657_1484 275
190 3300048921 Ga0496118_0017158 Ga0496118_0017158_2451_3278 275
191 3300048924 Ga0496121_0023405 Ga0496121_0023405_797_1624 275
192 3300048926 Ga0496123_0000630 Ga0496123_0000630_51256_52083 275
193 3300048927 Ga0496124_0020426 Ga0496124_0020426_1024_1851 275
194 3300048928 Ga0496125_0000162 Ga0496125_0000162_118657_119484 275
195 3300048929 Ga0496126_0001374 Ga0496126_0001374_36550_37377 275
196 3300049569 Ga0501032_0000071 Ga0501032_0000071_77386_78213 275
197 3300049570 Ga0501033_0199239 Ga0501033_0199239_434_1261 275
198 3300049571 Ga0501034_0000001 Ga0501034_0000001_897875_898702 275
199 3300049572 Ga0501036_0295974 Ga0501036_0295974_205_1032 275
200 3300049575 Ga0501039_0000001 Ga0501039_0000001_22365_23192 275
201 3300049586 Ga0501070_0362499 Ga0501070_0362499_163_999 275
202 3300049823 Ga0501044_0086596 Ga0501044_0086596_1331_2158 275
203 3300050490 nmdc:mga03n38_4336_c1 nmdc:mga03n38_4336_c1_547_1374 275
204 3300050494 nmdc:mga06z11_254_c1 nmdc:mga06z11_254_c1_9091_9918 275
205 3300050495 nmdc:mga04h51_143_c1 nmdc:mga04h51_143_c1_10848_11675 275
206 3300050496 nmdc:mga07m45_3827_c1 nmdc:mga07m45_3827_c1_2800_3627 275
207 3300053087 Ga0500643_000198 Ga0500643_000198_52331_53158 275
208 3300053136 Ga0500559_0005579 Ga0500559_0005579_4736_5563 275
209 3300055283 Ga0500661_015746 Ga0500661_015746_96_923 275
210 3300005563 Ga0068855_100144153 Ga0068855_1001441532 276
211 3300009545 Ga0105237_10054813 Ga0105237_100548133 276
212 3300046460 Ga0495638_0000528 Ga0495638_0000528_14233_15063 276
213 3300046616 Ga0495668_0012888 Ga0495668_0012888_176_1006 276
214 3300048928 Ga0496125_0015517 Ga0496125_0015517_4315_5160 276
215 iso_pu_bacteria 2510917021 2511127908 276
216 iso_pu_bacteria 2842914999 2842916561 276
217 3300002737 JGI25162J39368_1000766 JGI25162J39368_100076615 277
218 3300002773 JGI25152J39213_1000380 JGI25152J39213_100038025 277
219 3300003187 JGI25151J46595_10001461 JGI25151J46595_1000146110 277
220 3300003214 JGI25165J46597_1000249 JGI25165J46597_100024936 277
221 3300003214 JGI25165J46597_1000958 JGI25165J46597_10009589 277
222 3300003323 rootH1_10039569 rootH1_100395694 277
223 3300003758 Ga0055532_1008765 Ga0055532_10087651 277
224 3300003771 Ga0055526_1003096 Ga0055526_10030966 277
225 3300003775 Ga0055524_1000517 Ga0055524_100051724 277
226 3300003775 Ga0055524_1001780 Ga0055524_10017805 277
227 3300003790 Ga0055528_1000217 Ga0055528_100021738 277
228 3300005548 Ga0070665_100133614 Ga0070665_1001336142 277
229 3300005578 Ga0068854_100047325 Ga0068854_1000473253 277
230 3300005983 Ga0081540_1001703 Ga0081540_10017036 277
231 3300005985 Ga0081539_10009583 Ga0081539_100095837 277
232 3300006038 Ga0075365_10202352 Ga0075365_102023522 277
233 3300006051 Ga0075364_10000636 Ga0075364_1000063623 277
234 3300006051 Ga0075364_10001397 Ga0075364_100013973 277
235 3300006353 Ga0075370_10071338 Ga0075370_100713382 277
236 3300006353 Ga0075370_10254426 Ga0075370_102544262 277
237 3300006946 Ga0079104_1000105 Ga0079104_100010592 277
238 3300009101 Ga0105247_10006034 Ga0105247_100060342 277
239 3300015261 Ga0182006_1000005 Ga0182006_1000005326 277
240 3300025229 Ga0209147_100574 Ga0209147_10057410 277
241 3300025233 Ga0209437_100023 Ga0209437_1000239 277
242 3300025258 Ga0209129_1000045 Ga0209129_1000045284 277
243 3300025261 Ga0209233_1000047 Ga0209233_1000047378 277
244 3300025261 Ga0209233_1000219 Ga0209233_10002199 277
245 3300025273 Ga0209673_1000285 Ga0209673_100028522 277
246 3300025273 Ga0209673_1002243 Ga0209673_10022439 277
247 3300025292 Ga0209676_1014832 Ga0209676_10148323 277
248 3300025294 Ga0209025_1000653 Ga0209025_100065345 277
249 3300025294 Ga0209025_1002938 Ga0209025_100293814 277
250 3300025295 Ga0209564_1000881 Ga0209564_100088139 277
251 3300025295 Ga0209564_1008955 Ga0209564_10089552 277
252 3300025299 Ga0209256_1000084 Ga0209256_1000084191 277
253 3300025299 Ga0209256_1000260 Ga0209256_100026011 277
254 3300025299 Ga0209256_1000681 Ga0209256_100068115 277
255 3300025299 Ga0209256_1000915 Ga0209256_10009158 277
256 3300025303 Ga0209051_1015305 Ga0209051_10153052 277
257 3300025900 Ga0207710_10098416 Ga0207710_100984162 277
258 3300025914 Ga0207671_10004000 Ga0207671_100040005 277
259 3300025981 Ga0207640_10032682 Ga0207640_100326823 277
260 3300027312 Ga0209371_1015430 Ga0209371_10154302 277
261 3300030500 Ga0268256_1017114 Ga0268256_10171142 277
262 3300031731 Ga0307405_10020359 Ga0307405_100203592 277
263 3300031901 Ga0307406_10047344 Ga0307406_100473442 277
264 3300031911 Ga0307412_10009531 Ga0307412_100095314 277
265 3300032004 Ga0307414_10036141 Ga0307414_100361412 277
266 3300046471 Ga0495650_0004122 Ga0495650_0004122_9202_10047 277
267 3300046491 Ga0495584_0000312 Ga0495584_0000312_23670_24515 277
268 3300046492 Ga0495585_0000858 Ga0495585_0000858_22254_23099 277
269 3300046507 Ga0495606_0000073 Ga0495606_0000073_25124_25969 277
270 3300046507 Ga0495606_0024267 Ga0495606_0024267_2151_2996 277
271 3300046512 Ga0495610_0019854 Ga0495610_0019854_2554_3399 277
272 3300046513 Ga0495616_0000001 Ga0495616_0000001_685712_686557 277
273 3300046515 Ga0495620_0003180 Ga0495620_0003180_3436_4281 277
274 3300046518 Ga0495631_0000611 Ga0495631_0000611_13523_14368 277
275 3300046519 Ga0495632_0006108 Ga0495632_0006108_4790_5635 277
276 3300046519 Ga0495632_0030268 Ga0495632_0030268_176_1021 277
277 3300046522 Ga0495643_0047853 Ga0495643_0047853_1338_2183 277
278 3300046524 Ga0495648_0034202 Ga0495648_0034202_2279_3124 277
279 3300046530 Ga0495654_0001447 Ga0495654_0001447_6353_7192 277
280 3300046616 Ga0495668_0034794 Ga0495668_0034794_1711_2553 277
281 3300046648 Ga0495611_0000006 Ga0495611_0000006_48636_49481 277
282 3300046660 Ga0495625_0038624 Ga0495625_0038624_2037_2882 277
283 3300046691 Ga0495670_0004553 Ga0495670_0004553_4483_5328 277
284 3300046692 Ga0495671_0118414 Ga0495671_0118414_321_1160 277
285 3300046810 Ga0495660_0000025 Ga0495660_0000025_224951_225793 277
286 3300047323 Ga0495683_0001817 Ga0495683_0001817_6094_6939 277
287 3300047469 Ga0495673_0000001 Ga0495673_0000001_466633_467475 277
288 3300047469 Ga0495673_0000018 Ga0495673_0000018_77223_78068 277
289 3300047472 Ga0495686_0023346 Ga0495686_0023346_92_937 277
290 3300048090 Ga0495615_0000428 Ga0495615_0000428_2140_2973 277
291 3300048909 Ga0496106_0010353 Ga0496106_0010353_2581_3423 277
292 3300048920 Ga0496117_0001460 Ga0496117_0001460_6904_7743 277
293 3300048922 Ga0496119_0013302 Ga0496119_0013302_2552_3391 277
294 3300048924 Ga0496121_0000005 Ga0496121_0000005_1010227_1011066 277
295 3300048924 Ga0496121_0000501 Ga0496121_0000501_39826_40668 277
296 3300048924 Ga0496121_0001054 Ga0496121_0001054_3514_4359 277
297 3300048924 Ga0496121_0150014 Ga0496121_0150014_695_1537 277
298 3300048925 Ga0496122_0003347 Ga0496122_0003347_8844_9677 277
299 3300048925 Ga0496122_0007666 Ga0496122_0007666_5178_6017 277
300 3300048925 Ga0496122_0020350 Ga0496122_0020350_4990_5829 277
301 3300048926 Ga0496123_0001779 Ga0496123_0001779_5880_6713 277
302 3300048926 Ga0496123_0044832 Ga0496123_0044832_1940_2779 277
303 3300048926 Ga0496123_0051175 Ga0496123_0051175_1442_2281 277
304 3300048926 Ga0496123_0068813 Ga0496123_0068813_536_1378 277
305 3300048927 Ga0496124_0019244 Ga0496124_0019244_759_1598 277
306 3300048927 Ga0496124_0075341 Ga0496124_0075341_1473_2312 277
307 3300048928 Ga0496125_0000145 Ga0496125_0000145_76269_77108 277
308 3300048928 Ga0496125_0000159 Ga0496125_0000159_134349_135188 277
309 3300048928 Ga0496125_0000332 Ga0496125_0000332_44049_44882 277
310 3300048928 Ga0496125_0000471 Ga0496125_0000471_52135_52974 277
311 3300048928 Ga0496125_0017542 Ga0496125_0017542_4453_5292 277
312 3300048928 Ga0496125_0022156 Ga0496125_0022156_4239_5078 277
313 3300048928 Ga0496125_0216336 Ga0496125_0216336_323_1156 277
314 3300048929 Ga0496126_0044754 Ga0496126_0044754_160_999 277
315 3300048929 Ga0496126_0100852 Ga0496126_0100852_1433_2272 277
316 3300049571 Ga0501034_0110905 Ga0501034_0110905_977_1816 277
317 3300049581 Ga0501047_0206866 Ga0501047_0206866_433_1272 277
318 3300049586 Ga0501070_0085304 Ga0501070_0085304_1328_2167 277
319 3300049822 Ga0501035_0022872 Ga0501035_0022872_299_1138 277
320 3300049822 Ga0501035_0042484 Ga0501035_0042484_3108_3947 277
321 3300049823 Ga0501044_0081450 Ga0501044_0081450_259_1098 277
322 3300049823 Ga0501044_0124011 Ga0501044_0124011_605_1444 277
323 3300049823 Ga0501044_0178809 Ga0501044_0178809_501_1340 277
324 3300049823 Ga0501044_0293959 Ga0501044_0293959_171_1010 277
325 3300050491 nmdc:mga00v17_13490_c1 nmdc:mga00v17_13490_c1_3308_4147 277
326 3300053150 Ga0500603_018183 Ga0500603_018183_509_1348 277
327 3300053177 Ga0500636_0000727 Ga0500636_0000727_4729_5568 277
328 iso_pu_bacteria 2534681796 2535517892 277
329 3300003316 rootH1_10055786 rootH1_100557863 278
330 3300003322 rootL2_10110963 rootL2_101109633 278
331 3300003323 rootH1_10060688 rootH1_100606884 278
332 3300003781 Ga0055536_1000029 Ga0055536_100002973 278
333 3300003791 Ga0055530_10000166 Ga0055530_1000016639 278
334 3300005262 Ga0065165_1036616 Ga0065165_10366162 278
335 3300005289 Ga0065704_10072790 Ga0065704_100727903 278
336 3300005289 Ga0065704_10085072 Ga0065704_100850722 278
337 3300005331 Ga0070670_100023414 Ga0070670_1000234142 278
338 3300005548 Ga0070665_100000107 Ga0070665_1000001075 278
339 3300005841 Ga0068863_100004365 Ga0068863_1000043653 278
340 3300005842 Ga0068858_100104138 Ga0068858_1001041382 278
341 3300005843 Ga0068860_100132338 Ga0068860_1001323383 278
342 3300006186 Ga0075369_10000493 Ga0075369_100004932 278
343 3300017792 Ga0163161_10027357 Ga0163161_100273572 278
344 3300025263 Ga0209565_1000062 Ga0209565_100006283 278
345 3300025273 Ga0209673_1011198 Ga0209673_10111981 278
346 3300025292 Ga0209676_1000057 Ga0209676_1000057205 278
347 3300025295 Ga0209564_1004008 Ga0209564_10040089 278
348 3300025295 Ga0209564_1005781 Ga0209564_10057815 278
349 3300025298 Ga0209050_1000096 Ga0209050_1000096102 278
350 3300025298 Ga0209050_1017406 Ga0209050_10174062 278
351 3300025302 Ga0207426_1018119 Ga0207426_10181193 278
352 3300025303 Ga0209051_1001653 Ga0209051_100165311 278
353 3300025304 Ga0209257_1002882 Ga0209257_10028827 278
354 3300025923 Ga0207681_10001134 Ga0207681_100011345 278
355 3300025925 Ga0207650_10079292 Ga0207650_100792923 278
356 3300026035 Ga0207703_10066242 Ga0207703_100662422 278
357 3300026088 Ga0207641_10005769 Ga0207641_100057697 278
358 3300028379 Ga0268266_10000879 Ga0268266_1000087948 278
359 3300046452 Ga0495617_021285 Ga0495617_021285_568_1407 278
360 3300046500 Ga0495596_0000117 Ga0495596_0000117_51956_52798 278
361 3300046500 Ga0495596_0000993 Ga0495596_0000993_6570_7412 278
362 3300046501 Ga0495607_0065026 Ga0495607_0065026_104_946 278
363 3300046506 Ga0495583_0037076 Ga0495583_0037076_93_935 278
364 3300046507 Ga0495606_0147986 Ga0495606_0147986_45_887 278
365 3300046512 Ga0495610_0000907 Ga0495610_0000907_3637_4476 278
366 3300046512 Ga0495610_0001224 Ga0495610_0001224_7441_8283 278
367 3300046512 Ga0495610_0027411 Ga0495610_0027411_324_1166 278
368 3300046520 Ga0495637_0016277 Ga0495637_0016277_1260_2099 278
369 3300046522 Ga0495643_0000048 Ga0495643_0000048_185399_186241 278
370 3300046522 Ga0495643_0018957 Ga0495643_0018957_1350_2192 278
371 3300046558 Ga0495633_0055245 Ga0495633_0055245_394_1233 278
372 3300046660 Ga0495625_0004171 Ga0495625_0004171_5993_6835 278
373 3300047470 Ga0495681_0000050 Ga0495681_0000050_66828_67667 278
374 3300048091 Ga0495626_0000970 Ga0495626_0000970_22540_23382 278
375 3300048903 Ga0496100_0004883 Ga0496100_0004883_5686_6534 278
376 3300048904 Ga0496101_0000919 Ga0496101_0000919_13280_14128 278
377 3300048919 Ga0496116_0078737 Ga0496116_0078737_257_1096 278
378 3300048920 Ga0496117_0085412 Ga0496117_0085412_801_1640 278
379 3300048921 Ga0496118_0059260 Ga0496118_0059260_1400_2251 278
380 3300048921 Ga0496118_0096167 Ga0496118_0096167_592_1431 278
381 3300048924 Ga0496121_0003040 Ga0496121_0003040_8903_9760 278
382 3300048925 Ga0496122_0024990 Ga0496122_0024990_894_1742 278
383 3300048926 Ga0496123_0012554 Ga0496123_0012554_1887_2735 278
384 3300048927 Ga0496124_0002416 Ga0496124_0002416_9223_10080 278
385 3300048927 Ga0496124_0078737 Ga0496124_0078737_787_1629 278
386 3300048928 Ga0496125_0028917 Ga0496125_0028917_663_1499 278
387 3300048928 Ga0496125_0028978 Ga0496125_0028978_682_1521 278
388 3300048929 Ga0496126_0003325 Ga0496126_0003325_623_1459 278
389 3300048929 Ga0496126_0440298 Ga0496126_0440298_49_921 278
390 3300049571 Ga0501034_0105886 Ga0501034_0105886_466_1305 278
391 3300049822 Ga0501035_0045782 Ga0501035_0045782_392_1231 278
392 3300050516 nmdc:mga0sz30_31169_c1 nmdc:mga0sz30_31169_c1_1177_2013 278
393 iso_pu_bacteria 2818991438 2819554319 278
394 3300005331 Ga0070670_100406766 Ga0070670_1004067661 279
395 3300010375 Ga0105239_10083183 Ga0105239_100831832 279
396 3300013104 Ga0157370_10000317 Ga0157370_100003178 279
397 3300015265 Ga0182005_1000004 Ga0182005_1000004399 279
398 3300025925 Ga0207650_10357235 Ga0207650_103572351 279
399 3300046501 Ga0495607_0080456 Ga0495607_0080456_878_1726 279
400 3300048925 Ga0496122_0011203 Ga0496122_0011203_5388_6236 279
401 3300048926 Ga0496123_0054553 Ga0496123_0054553_1728_2576 279
402 3300048927 Ga0496124_0001192 Ga0496124_0001192_20517_21365 279
403 3300048927 Ga0496124_0001297 Ga0496124_0001297_20564_21412 279
404 3300003323 rootH1_10087940 rootH1_100879402 280
405 3300046519 Ga0495632_0000045 Ga0495632_0000045_24466_25317 280
406 3300053080 Ga0500635_0001480 Ga0500635_0001480_2897_3739 280
407 3300003322 rootL2_10026419 rootL2_100264191 281
408 3300003771 Ga0055526_1001101 Ga0055526_10011012 281
409 3300003771 Ga0055526_1019140 Ga0055526_10191401 281
410 3300003775 Ga0055524_1010742 Ga0055524_10107423 281
411 3300003790 Ga0055528_1019935 Ga0055528_10199352 281
412 3300005548 Ga0070665_100042902 Ga0070665_1000429023 281
413 3300005616 Ga0068852_100344793 Ga0068852_1003447932 281
414 3300005842 Ga0068858_100077357 Ga0068858_1000773572 281
415 3300013104 Ga0157370_10178172 Ga0157370_101781722 281
416 3300013306 Ga0163162_10030166 Ga0163162_100301662 281
417 3300013306 Ga0163162_10657520 Ga0163162_106575202 281
418 3300025206 Ga0209435_106839 Ga0209435_1068392 281
419 3300025295 Ga0209564_1000023 Ga0209564_1000023494 281
420 3300027111 Ga0209281_1000108 Ga0209281_100010861 281
421 3300028379 Ga0268266_10033488 Ga0268266_100334882 281
422 3300032004 Ga0307414_10017643 Ga0307414_100176432 281
423 3300037471 Ga0395905_0000058 Ga0395905_0000058_103578_104426 281
424 3300046453 Ga0495627_000060 Ga0495627_000060_124244_125098 281
425 3300046507 Ga0495606_0000091 Ga0495606_0000091_22011_22868 281
426 3300046507 Ga0495606_0000253 Ga0495606_0000253_26239_27090 281
427 3300046512 Ga0495610_0000161 Ga0495610_0000161_1977_2828 281
428 3300046519 Ga0495632_0001003 Ga0495632_0001003_20338_21183 281
429 3300046524 Ga0495648_0012406 Ga0495648_0012406_4834_5688 281
430 3300047469 Ga0495673_0056587 Ga0495673_0056587_252_1103 281
431 3300047472 Ga0495686_0003118 Ga0495686_0003118_12666_13517 281
432 3300047472 Ga0495686_0005455 Ga0495686_0005455_5469_6317 281
433 3300047472 Ga0495686_0022630 Ga0495686_0022630_1210_2061 281
434 3300048904 Ga0496101_0023339 Ga0496101_0023339_101_946 281
435 3300048914 Ga0496111_0118095 Ga0496111_0118095_939_1784 281
436 3300048919 Ga0496116_0011422 Ga0496116_0011422_4090_4935 281
437 3300048919 Ga0496116_0045192 Ga0496116_0045192_824_1669 281
438 3300048920 Ga0496117_0011907 Ga0496117_0011907_2256_3101 281
439 3300048921 Ga0496118_0010477 Ga0496118_0010477_3072_3917 281
440 3300048921 Ga0496118_0011686 Ga0496118_0011686_23_868 281
441 3300048922 Ga0496119_0078244 Ga0496119_0078244_75_920 281
442 3300048923 Ga0496120_0019764 Ga0496120_0019764_948_1811 281
443 3300048924 Ga0496121_0000022 Ga0496121_0000022_338968_339819 281
444 3300048924 Ga0496121_0001281 Ga0496121_0001281_35431_36276 281
445 3300048924 Ga0496121_0002401 Ga0496121_0002401_23397_24248 281
446 3300048924 Ga0496121_0023927 Ga0496121_0023927_2214_3071 281
447 3300048924 Ga0496121_0029690 Ga0496121_0029690_2738_3583 281
448 3300048924 Ga0496121_0130677 Ga0496121_0130677_899_1750 281
449 3300048924 Ga0496121_0228495 Ga0496121_0228495_316_1161 281
450 3300048925 Ga0496122_0005028 Ga0496122_0005028_7931_8776 281
451 3300048925 Ga0496122_0078051 Ga0496122_0078051_180_1025 281
452 3300048926 Ga0496123_0000719 Ga0496123_0000719_38491_39336 281
453 3300048926 Ga0496123_0010151 Ga0496123_0010151_2183_3028 281
454 3300048926 Ga0496123_0046007 Ga0496123_0046007_141_986 281
455 3300048926 Ga0496123_0095030 Ga0496123_0095030_732_1583 281
456 3300048927 Ga0496124_0000175 Ga0496124_0000175_37060_37923 281
457 3300048927 Ga0496124_0000409 Ga0496124_0000409_66919_67764 281
458 3300048927 Ga0496124_0001553 Ga0496124_0001553_14926_15777 281
459 3300048927 Ga0496124_0011694 Ga0496124_0011694_3383_4228 281
460 3300048927 Ga0496124_0014941 Ga0496124_0014941_3537_4388 281
461 3300048928 Ga0496125_0014486 Ga0496125_0014486_2711_3556 281
462 3300048929 Ga0496126_0014337 Ga0496126_0014337_4494_5339 281
463 3300048929 Ga0496126_0038003 Ga0496126_0038003_1390_2235 281
464 3300049460 Ga0495682_0022329 Ga0495682_0022329_194_1060 281
465 3300049568 Ga0501031_0003571 Ga0501031_0003571_4966_5817 281
466 3300049569 Ga0501032_0000013 Ga0501032_0000013_64884_65735 281
467 3300049570 Ga0501033_0000522 Ga0501033_0000522_32899_33750 281
468 3300049571 Ga0501034_0000054 Ga0501034_0000054_169266_170117 281
469 3300049572 Ga0501036_0000031 Ga0501036_0000031_11457_12308 281
470 3300049573 Ga0501037_0000096 Ga0501037_0000096_64097_64948 281
471 3300049574 Ga0501038_0000018 Ga0501038_0000018_121433_122284 281
472 3300049575 Ga0501039_0000120 Ga0501039_0000120_28112_28963 281
473 3300049577 Ga0501041_0090581 Ga0501041_0090581_477_1328 281
474 3300049579 Ga0501043_0000014 Ga0501043_0000014_40234_41085 281
475 3300049580 Ga0501046_0117763 Ga0501046_0117763_400_1251 281
476 3300049581 Ga0501047_0066016 Ga0501047_0066016_204_1055 281
477 3300049822 Ga0501035_0000019 Ga0501035_0000019_72284_73135 281
478 3300049823 Ga0501044_0001388 Ga0501044_0001388_8531_9382 281
479 3300050491 nmdc:mga00v17_235_c1 nmdc:mga00v17_235_c1_6558_7403 281
480 3300050491 nmdc:mga00v17_97486_c1 nmdc:mga00v17_97486_c1_464_1309 281
481 3300050496 nmdc:mga07m45_128921_c1 nmdc:mga07m45_128921_c1_346_1191 281
482 3300053125 Ga0500618_000390 Ga0500618_000390_26599_27444 281
483 3300013102 Ga0157371_10201468 Ga0157371_102014682 282
484 3300013104 Ga0157370_10142560 Ga0157370_101425602 282
485 3300015684 Ga0183365_10001 Ga0183365_1000183 282
486 3300039437 Ga0436365_1915005 Ga0436365_1915005_4385_5236 282
487 3300049568 Ga0501031_0047111 Ga0501031_0047111_655_1506 282
488 3300049570 Ga0501033_0181410 Ga0501033_0181410_507_1373 282
489 3300049571 Ga0501034_0285007 Ga0501034_0285007_294_1154 282
490 3300049579 Ga0501043_0049326 Ga0501043_0049326_1776_2642 282
491 3300049822 Ga0501035_0026782 Ga0501035_0026782_1667_2533 282
492 3300053122 Ga0500608_000403 Ga0500608_000403_5428_6288 282
493 3300046507 Ga0495606_0000728 Ga0495606_0000728_39982_40854 286
494 3300049572 Ga0501036_0259662 Ga0501036_0259662_335_1201 286
495 3300027111 Ga0209281_1007575 Ga0209281_10075752 291
496 2162886007 SwRhRL2b_contig_940545 SwRhRL2b_0886.00005670 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

32

84

0.98

PF01739

CheR

CheR methyltransferase, SAM binding domain

97

291

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.9039 16 279
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.8972 16 279
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8402 82 279
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8243 82 279
3dtn-assembly1.cif.gz_A crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8201 105 249
ID Description Score Start End Superfamily
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8875 79 279 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.883 79 279 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8451 79 279 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.841 79 279 3.40.50.150
3uj6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7759 89 251 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5E7H0X5-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9934 12 279 GO:0008983
GO:0032259
AF-A0A4R6MUG6-F1-model_v4 deleted 0.9918 12 279
AF-A0A7Z2VRK9-F1-model_v4 Protein-glutamate O-methyltransferase CheR 0.9904 12 279 GO:0008757
GO:0032259
AF-A0A848HAQ2-F1-model_v4 Protein-glutamate O-methyltransferase CheR 0.9894 10 278 GO:0008757
GO:0032259
AF-A0A6M5YAP3-F1-model_v4 Protein-glutamate O-methyltransferase CheR 0.9889 15 279 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
89.74 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map