F452895
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 256 | 483 | 49 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_102034731|Ga0070698_1020347311 |
| Length | 48 |
| Sequence | MIRKLPSGGYRLYSRKKDKQGKRKNLGTFPTLQAAKKQERAVQFLKRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 193 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 195 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 198 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 199 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 200 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 201 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 202 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 248 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 249 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 250 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 251 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 252 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 254 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 256 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.93 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 94.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1003700 | 3300000532 | Bacteria | 1003 |
| 2 | rootH1_10299069 | 3300003323 | Bacteria | 2157 |
| 3 | JGI25405J52794_10034903 | 3300003911 | Bacteria | 1052 |
| 4 | Ga0065712_10347866 | 3300005290 | Bacteria | 791 |
| 5 | Ga0065715_10093668 | 3300005293 | Bacteria | 4603 |
| 6 | Ga0065707_10067785 | 3300005295 | Bacteria | 685 |
| 7 | Ga0065707_10144688 | 3300005295 | Bacteria | 1728 |
| 8 | Ga0065707_10267798 | 3300005295 | Bacteria | 1079 |
| 9 | Ga0065707_10511463 | 3300005295 | Bacteria | 749 |
| 10 | Ga0065707_10572829 | 3300005295 | Bacteria | 707 |
| 11 | Ga0070658_10003312 | 3300005327 | Bacteria | 13290 |
| 12 | Ga0070676_10154187 | 3300005328 | Bacteria | 1473 |
| 13 | Ga0070676_10494936 | 3300005328 | Bacteria | 867 |
| 14 | Ga0070676_11369204 | 3300005328 | Unclassified | 542 |
| 15 | Ga0070690_100209300 | 3300005330 | Unclassified | 1361 |
| 16 | Ga0070690_100294230 | 3300005330 | Unclassified | 1162 |
| 17 | Ga0070690_100330943 | 3300005330 | Bacteria | 1100 |
| 18 | Ga0070670_100716934 | 3300005331 | Bacteria | 900 |
| 19 | Ga0068869_102161118 | 3300005334 | Bacteria | 500 |
| 20 | Ga0070680_100009958 | 3300005336 | Bacteria | 7321 |
| 21 | Ga0068868_100105601 | 3300005338 | Unclassified | 2284 |
| 22 | Ga0068868_100114033 | 3300005338 | Unclassified | 2198 |
| 23 | Ga0070660_100090874 | 3300005339 | Bacteria | 2407 |
| 24 | Ga0070660_101942718 | 3300005339 | Unclassified | 502 |
| 25 | Ga0070689_100000014 | 3300005340 | Bacteria | 185640 |
| 26 | Ga0070689_101592639 | 3300005340 | Unclassified | 593 |
| 27 | Ga0070692_10963352 | 3300005345 | Unclassified | 594 |
| 28 | Ga0070668_100041306 | 3300005347 | Plasmid | 3533 |
| 29 | Ga0070668_100254219 | 3300005347 | Bacteria | 1459 |
| 30 | Ga0070669_100118487 | 3300005353 | Bacteria | 2016 |
| 31 | Ga0070669_100218356 | 3300005353 | Bacteria | 1507 |
| 32 | Ga0070669_100335018 | 3300005353 | Bacteria | 1225 |
| 33 | Ga0070669_101377380 | 3300005353 | Bacteria | 612 |
| 34 | Ga0070675_100033388 | 3300005354 | Unclassified | 4172 |
| 35 | Ga0070675_100501433 | 3300005354 | Unclassified | 1094 |
| 36 | Ga0070675_100507863 | 3300005354 | Unclassified | 1087 |
| 37 | Ga0070675_102130871 | 3300005354 | Bacteria | 517 |
| 38 | Ga0070674_101976790 | 3300005356 | Unclassified | 531 |
| 39 | Ga0070673_101742592 | 3300005364 | Bacteria | 590 |
| 40 | Ga0070688_100734318 | 3300005365 | Bacteria | 767 |
| 41 | Ga0070659_101614355 | 3300005366 | Unclassified | 579 |
| 42 | Ga0070667_100590831 | 3300005367 | Bacteria | 1022 |
| 43 | Ga0070667_101076704 | 3300005367 | Bacteria | 751 |
| 44 | Ga0070703_10121195 | 3300005406 | Bacteria | 949 |
| 45 | Ga0070709_11235160 | 3300005434 | Unclassified | 601 |
| 46 | Ga0070709_11644522 | 3300005434 | Unclassified | 523 |
| 47 | Ga0070714_100323162 | 3300005435 | Unclassified | 1443 |
| 48 | Ga0070714_100334676 | 3300005435 | Bacteria | 1418 |
| 49 | Ga0070714_101041612 | 3300005435 | Bacteria | 797 |
| 50 | Ga0070713_100215134 | 3300005436 | Bacteria | 1741 |
| 51 | Ga0070701_10317307 | 3300005438 | Bacteria | 963 |
| 52 | Ga0070701_11358961 | 3300005438 | Bacteria | 509 |
| 53 | Ga0070711_100265828 | 3300005439 | Bacteria | 1352 |
| 54 | Ga0070711_101288567 | 3300005439 | Bacteria | 634 |
| 55 | Ga0070705_100187461 | 3300005440 | Bacteria | 1407 |
| 56 | Ga0070705_100203655 | 3300005440 | Bacteria | 1359 |
| 57 | Ga0070705_100295609 | 3300005440 | Unclassified | 1158 |
| 58 | Ga0070705_100476628 | 3300005440 | Bacteria | 942 |
| 59 | Ga0070705_100652313 | 3300005440 | Archaea | 821 |
| 60 | Ga0070705_100672719 | 3300005440 | Bacteria | 810 |
| 61 | Ga0070705_101747570 | 3300005440 | Bacteria | 526 |
| 62 | Ga0070694_100043322 | 3300005444 | Bacteria | 3009 |
| 63 | Ga0070694_101747017 | 3300005444 | Bacteria | 530 |
| 64 | Ga0070708_100053117 | 3300005445 | Unclassified | 3594 |
| 65 | Ga0070708_100162535 | 3300005445 | Bacteria | 2081 |
| 66 | Ga0070708_100203263 | 3300005445 | Bacteria | 1855 |
| 67 | Ga0070708_100507158 | 3300005445 | Bacteria | 1138 |
| 68 | Ga0070708_100564557 | 3300005445 | Unclassified | 1073 |
| 69 | Ga0070708_100733137 | 3300005445 | Bacteria | 929 |
| 70 | Ga0070708_101633564 | 3300005445 | Unclassified | 599 |
| 71 | Ga0070663_100563044 | 3300005455 | Bacteria | 954 |
| 72 | Ga0070662_100050804 | 3300005457 | Bacteria | 2991 |
| 73 | Ga0070662_100057821 | 3300005457 | Bacteria | 2819 |
| 74 | Ga0070681_10053889 | 3300005458 | Bacteria | 4008 |
| 75 | Ga0070681_10919593 | 3300005458 | Bacteria | 793 |
| 76 | Ga0068867_100434610 | 3300005459 | Bacteria | 1115 |
| 77 | Ga0068867_101710096 | 3300005459 | Unclassified | 590 |
| 78 | Ga0070706_100000012 | 3300005467 | Bacteria | 195040 |
| 79 | Ga0070706_100001789 | 3300005467 | Bacteria | 22254 |
| 80 | Ga0070706_100023631 | 3300005467 | Bacteria | 5659 |
| 81 | Ga0070706_100037779 | 3300005467 | Bacteria | 4459 |
| 82 | Ga0070706_100143344 | 3300005467 | Bacteria | 2230 |
| 83 | Ga0070706_100193493 | 3300005467 | Bacteria | 1900 |
| 84 | Ga0070706_100429457 | 3300005467 | Bacteria | 1229 |
| 85 | Ga0070706_100445603 | 3300005467 | Bacteria | 1205 |
| 86 | Ga0070706_100806637 | 3300005467 | Bacteria | 869 |
| 87 | Ga0070707_100033444 | 3300005468 | Bacteria | 4903 |
| 88 | Ga0070707_100036097 | 3300005468 | Bacteria | 4716 |
| 89 | Ga0070707_100078935 | 3300005468 | Bacteria | 3176 |
| 90 | Ga0070707_100235917 | 3300005468 | Bacteria | 1780 |
| 91 | Ga0070707_100646612 | 3300005468 | Bacteria | 1020 |
| 92 | Ga0070707_101222591 | 3300005468 | Unclassified | 717 |
| 93 | Ga0070707_101599140 | 3300005468 | Bacteria | 619 |
| 94 | Ga0070698_100000185 | 3300005471 | Bacteria | 59098 |
| 95 | Ga0070698_100003563 | 3300005471 | Bacteria | 17109 |
| 96 | Ga0070698_100072318 | 3300005471 | Bacteria | 3456 |
| 97 | Ga0070698_100110391 | 3300005471 | Bacteria | 2715 |
| 98 | Ga0070698_100123806 | 3300005471 | Unclassified | 2543 |
| 99 | Ga0070698_100219775 | 3300005471 | Bacteria | 1834 |
| 100 | Ga0070698_101413388 | 3300005471 | Bacteria | 647 |
| 101 | Ga0070698_101841561 | 3300005471 | Bacteria | 558 |
| 102 | Ga0070698_102034731 | 3300005471 | Unclassified | 528 |
| 103 | Ga0070699_100024010 | 3300005518 | Bacteria | 5254 |
| 104 | Ga0070699_100047193 | 3300005518 | Bacteria | 3726 |
| 105 | Ga0070699_100112234 | 3300005518 | Bacteria | 2394 |
| 106 | Ga0070699_100340182 | 3300005518 | Bacteria | 1350 |
| 107 | Ga0070699_100490558 | 3300005518 | Bacteria | 1115 |
| 108 | Ga0070699_101553593 | 3300005518 | Bacteria | 606 |
| 109 | Ga0070679_100018909 | 3300005530 | Bacteria | 6690 |
| 110 | Ga0070697_100001284 | 3300005536 | Bacteria | 18916 |
| 111 | Ga0070697_100039980 | 3300005536 | Unclassified | 3793 |
| 112 | Ga0070697_100157480 | 3300005536 | Bacteria | 1918 |
| 113 | Ga0070697_100170574 | 3300005536 | Bacteria | 1841 |
| 114 | Ga0070697_100183852 | 3300005536 | Bacteria | 1772 |
| 115 | Ga0070697_100261624 | 3300005536 | Unclassified | 1481 |
| 116 | Ga0070697_100268952 | 3300005536 | Unclassified | 1461 |
| 117 | Ga0070697_100313308 | 3300005536 | Bacteria | 1350 |
| 118 | Ga0070697_100858286 | 3300005536 | Unclassified | 804 |
| 119 | Ga0070697_100956254 | 3300005536 | Bacteria | 761 |
| 120 | Ga0070697_101012131 | 3300005536 | Unclassified | 739 |
| 121 | Ga0068853_100501539 | 3300005539 | Bacteria | 1146 |
| 122 | Ga0068853_101447909 | 3300005539 | Bacteria | 665 |
| 123 | Ga0070672_100043359 | 3300005543 | Bacteria | 3468 |
| 124 | Ga0070686_100010200 | 3300005544 | Bacteria | 5288 |
| 125 | Ga0070686_100215032 | 3300005544 | Bacteria | 1386 |
| 126 | Ga0070686_100229392 | 3300005544 | Bacteria | 1346 |
| 127 | Ga0070695_100011987 | 3300005545 | Bacteria | 5193 |
| 128 | Ga0070695_100287960 | 3300005545 | Bacteria | 1210 |
| 129 | Ga0070695_100480351 | 3300005545 | Bacteria | 958 |
| 130 | Ga0070695_100509991 | 3300005545 | Bacteria | 931 |
| 131 | Ga0070696_100416340 | 3300005546 | Bacteria | 1054 |
| 132 | Ga0070696_100518833 | 3300005546 | Bacteria | 950 |
| 133 | Ga0070696_100753939 | 3300005546 | Bacteria | 798 |
| 134 | Ga0070693_100106104 | 3300005547 | Unclassified | 1720 |
| 135 | Ga0070693_100106911 | 3300005547 | Bacteria | 1714 |
| 136 | Ga0070665_100201613 | 3300005548 | Bacteria | 1990 |
| 137 | Ga0070665_100422822 | 3300005548 | Bacteria | 1341 |
| 138 | Ga0070704_100042919 | 3300005549 | Unclassified | 3132 |
| 139 | Ga0070704_100257624 | 3300005549 | Bacteria | 1436 |
| 140 | Ga0070704_100270416 | 3300005549 | Bacteria | 1404 |
| 141 | Ga0070704_100297328 | 3300005549 | Bacteria | 1344 |
| 142 | Ga0070704_100376717 | 3300005549 | Bacteria | 1205 |
| 143 | Ga0070704_101723575 | 3300005549 | Bacteria | 579 |
| 144 | Ga0068855_100001388 | 3300005563 | Bacteria | 29998 |
| 145 | Ga0068855_100029996 | 3300005563 | Bacteria | 6504 |
| 146 | Ga0068855_101339518 | 3300005563 | Bacteria | 740 |
| 147 | Ga0068854_100102938 | 3300005578 | Bacteria | 2143 |
| 148 | Ga0068856_100006962 | 3300005614 | Bacteria | 11051 |
| 149 | Ga0068856_100043860 | 3300005614 | Bacteria | 4400 |
| 150 | Ga0068856_100196690 | 3300005614 | Bacteria | 2030 |
| 151 | Ga0070702_100215628 | 3300005615 | Unclassified | 1280 |
| 152 | Ga0070702_100508768 | 3300005615 | Bacteria | 886 |
| 153 | Ga0068852_101377363 | 3300005616 | Bacteria | 727 |
| 154 | Ga0068859_100003398 | 3300005617 | Bacteria | 16192 |
| 155 | Ga0068859_100016848 | 3300005617 | Bacteria | 7337 |
| 156 | Ga0068859_100041785 | 3300005617 | Bacteria | 4605 |
| 157 | Ga0068859_100364329 | 3300005617 | Bacteria | 1541 |
| 158 | Ga0068859_102378430 | 3300005617 | Bacteria | 584 |
| 159 | Ga0068859_102673383 | 3300005617 | Bacteria | 549 |
| 160 | Ga0068859_102981044 | 3300005617 | Bacteria | 517 |
| 161 | Ga0068859_103061150 | 3300005617 | Bacteria | 510 |
| 162 | Ga0068864_100104615 | 3300005618 | Bacteria | 2515 |
| 163 | Ga0068864_100541586 | 3300005618 | Bacteria | 1124 |
| 164 | Ga0068866_10102009 | 3300005718 | Bacteria | 1585 |
| 165 | Ga0068861_100032582 | 3300005719 | Bacteria | 3838 |
| 166 | Ga0068861_100364214 | 3300005719 | Bacteria | 1272 |
| 167 | Ga0068861_100438263 | 3300005719 | Bacteria | 1168 |
| 168 | Ga0068863_102755607 | 3300005841 | Bacteria | 500 |
| 169 | Ga0068858_101689386 | 3300005842 | Unclassified | 625 |
| 170 | Ga0068860_100035752 | 3300005843 | Bacteria | 4763 |
| 171 | Ga0068860_100380762 | 3300005843 | Bacteria | 1393 |
| 172 | Ga0068862_100002704 | 3300005844 | Bacteria | 15560 |
| 173 | Ga0068862_100125509 | 3300005844 | Bacteria | 2266 |
| 174 | Ga0068862_100422834 | 3300005844 | Bacteria | 1251 |
| 175 | Ga0068862_100517599 | 3300005844 | Bacteria | 1135 |
| 176 | Ga0081455_10000289 | 3300005937 | Bacteria | 66552 |
| 177 | Ga0081455_10430423 | 3300005937 | Unclassified | 907 |
| 178 | Ga0070717_10454546 | 3300006028 | Bacteria | 1154 |
| 179 | Ga0070717_10920780 | 3300006028 | Bacteria | 796 |
| 180 | Ga0075365_10080650 | 3300006038 | Bacteria | 2203 |
| 181 | Ga0075432_10389893 | 3300006058 | Bacteria | 599 |
| 182 | Ga0070715_10126009 | 3300006163 | Bacteria | 1227 |
| 183 | Ga0070715_10629584 | 3300006163 | Unclassified | 632 |
| 184 | Ga0070716_100265808 | 3300006173 | Bacteria | 1176 |
| 185 | Ga0070716_101388872 | 3300006173 | Bacteria | 570 |
| 186 | Ga0070712_100252696 | 3300006175 | Bacteria | 1409 |
| 187 | Ga0075362_10211605 | 3300006177 | Bacteria | 946 |
| 188 | Ga0075366_10012012 | 3300006195 | Bacteria | 4905 |
| 189 | Ga0075366_10729550 | 3300006195 | Bacteria | 615 |
| 190 | Ga0097621_100068878 | 3300006237 | Unclassified | 2920 |
| 191 | Ga0097621_100255164 | 3300006237 | Bacteria | 1537 |
| 192 | Ga0068871_100011447 | 3300006358 | Bacteria | 6507 |
| 193 | Ga0068871_100279948 | 3300006358 | Bacteria | 1459 |
| 194 | Ga0075428_101407935 | 3300006844 | Bacteria | 732 |
| 195 | Ga0075431_100168819 | 3300006847 | Unclassified | 2249 |
| 196 | Ga0075433_10003850 | 3300006852 | Bacteria | 11620 |
| 197 | Ga0075433_10057933 | 3300006852 | Bacteria | 3387 |
| 198 | Ga0075433_10262537 | 3300006852 | Bacteria | 1531 |
| 199 | Ga0075433_10341887 | 3300006852 | Bacteria | 1323 |
| 200 | Ga0075433_10624039 | 3300006852 | Bacteria | 946 |
| 201 | Ga0075434_100017012 | 3300006871 | Bacteria | 6998 |
| 202 | Ga0075434_101428093 | 3300006871 | Unclassified | 702 |
| 203 | Ga0075429_100156567 | 3300006880 | Bacteria | 1995 |
| 204 | Ga0075429_101296712 | 3300006880 | Bacteria | 635 |
| 205 | Ga0075436_100617713 | 3300006914 | Bacteria | 799 |
| 206 | Ga0097620_100003397 | 3300006931 | Bacteria | 16192 |
| 207 | Ga0097620_100016849 | 3300006931 | Bacteria | 7337 |
| 208 | Ga0097620_100041787 | 3300006931 | Bacteria | 4605 |
| 209 | Ga0097620_100364322 | 3300006931 | Bacteria | 1541 |
| 210 | Ga0097620_102379154 | 3300006931 | Bacteria | 584 |
| 211 | Ga0097620_102673093 | 3300006931 | Bacteria | 549 |
| 212 | Ga0097620_102981027 | 3300006931 | Bacteria | 517 |
| 213 | Ga0097620_103060718 | 3300006931 | Bacteria | 510 |
| 214 | Ga0075435_100508028 | 3300007076 | Bacteria | 1042 |
| 215 | Ga0075435_101250528 | 3300007076 | Bacteria | 650 |
| 216 | Ga0099794_10377083 | 3300007265 | Bacteria | 740 |
| 217 | Ga0099795_10163029 | 3300007788 | Bacteria | 921 |
| 218 | Ga0105240_10024042 | 3300009093 | Bacteria | 8046 |
| 219 | Ga0105240_10606136 | 3300009093 | Bacteria | 1205 |
| 220 | Ga0105240_11575823 | 3300009093 | Bacteria | 688 |
| 221 | Ga0111539_10023344 | 3300009094 | Bacteria | 7599 |
| 222 | Ga0105245_10110986 | 3300009098 | Unclassified | 2550 |
| 223 | Ga0105245_10610978 | 3300009098 | Bacteria | 1118 |
| 224 | Ga0105247_10029799 | 3300009101 | Unclassified | 3308 |
| 225 | Ga0105247_10042266 | 3300009101 | Bacteria | 2791 |
| 226 | Ga0105247_11019770 | 3300009101 | Unclassified | 647 |
| 227 | Ga0105247_11804235 | 3300009101 | Unclassified | 509 |
| 228 | Ga0114129_10000373 | 3300009147 | Bacteria | 52145 |
| 229 | Ga0114129_10026896 | 3300009147 | Bacteria | 8144 |
| 230 | Ga0114129_10065207 | 3300009147 | Bacteria | 5083 |
| 231 | Ga0114129_10358913 | 3300009147 | Bacteria | 1929 |
| 232 | Ga0114129_11794930 | 3300009147 | Bacteria | 746 |
| 233 | Ga0105243_11033213 | 3300009148 | Bacteria | 826 |
| 234 | Ga0105241_11764511 | 3300009174 | Bacteria | 603 |
| 235 | Ga0105242_10900168 | 3300009176 | Bacteria | 885 |
| 236 | Ga0105242_11100938 | 3300009176 | Bacteria | 808 |
| 237 | Ga0105242_11408330 | 3300009176 | Bacteria | 725 |
| 238 | Ga0105248_10073690 | 3300009177 | Bacteria | 3837 |
| 239 | Ga0105248_10177485 | 3300009177 | Bacteria | 2400 |
| 240 | Ga0105248_10733475 | 3300009177 | Bacteria | 1115 |
| 241 | Ga0105248_11937048 | 3300009177 | Bacteria | 669 |
| 242 | Ga0105237_10297780 | 3300009545 | Bacteria | 1616 |
| 243 | Ga0105249_10190044 | 3300009553 | Bacteria | 2004 |
| 244 | Ga0105249_10513510 | 3300009553 | Unclassified | 1245 |
| 245 | Ga0105249_10612782 | 3300009553 | Bacteria | 1144 |
| 246 | Ga0105249_11112122 | 3300009553 | Bacteria | 860 |
| 247 | Ga0105246_11165777 | 3300011119 | Bacteria | 707 |
| 248 | Ga0157327_1038906 | 3300012512 | Bacteria | 630 |
| 249 | Ga0157371_10016401 | 3300013102 | Bacteria | 5529 |
| 250 | Ga0157370_10036086 | 3300013104 | Bacteria | 4800 |
| 251 | Ga0157370_10068249 | 3300013104 | Bacteria | 3360 |
| 252 | Ga0157370_11208517 | 3300013104 | Bacteria | 682 |
| 253 | Ga0157374_10157230 | 3300013296 | Unclassified | 2213 |
| 254 | Ga0157378_10001895 | 3300013297 | Bacteria | 18777 |
| 255 | Ga0157378_10143457 | 3300013297 | Bacteria | 2219 |
| 256 | Ga0157378_10228365 | 3300013297 | Bacteria | 1772 |
| 257 | Ga0157378_11857027 | 3300013297 | Unclassified | 651 |
| 258 | Ga0163162_10270383 | 3300013306 | Bacteria | 1831 |
| 259 | Ga0163162_12191632 | 3300013306 | Bacteria | 634 |
| 260 | Ga0163162_13165098 | 3300013306 | Unclassified | 528 |
| 261 | Ga0157372_10080800 | 3300013307 | Bacteria | 3679 |
| 262 | Ga0157375_12109787 | 3300013308 | Unclassified | 671 |
| 263 | Ga0157380_10179764 | 3300014326 | Bacteria | 1857 |
| 264 | Ga0157380_10328880 | 3300014326 | Unclassified | 1420 |
| 265 | Ga0157380_10933849 | 3300014326 | Bacteria | 896 |
| 266 | Ga0157380_11245969 | 3300014326 | Bacteria | 789 |
| 267 | Ga0157380_13520121 | 3300014326 | Bacteria | 502 |
| 268 | Ga0157377_10225658 | 3300014745 | Bacteria | 1201 |
| 269 | Ga0209758_1060078 | 3300025297 | Bacteria | 1261 |
| 270 | Ga0207653_10096988 | 3300025885 | Bacteria | 1039 |
| 271 | Ga0207653_10185986 | 3300025885 | Bacteria | 779 |
| 272 | Ga0207642_10141540 | 3300025899 | Bacteria | 1269 |
| 273 | Ga0207710_10070482 | 3300025900 | Bacteria | 1602 |
| 274 | Ga0207699_11321126 | 3300025906 | Bacteria | 534 |
| 275 | Ga0207645_10008540 | 3300025907 | Bacteria | 7137 |
| 276 | Ga0207705_10018074 | 3300025909 | Bacteria | 5042 |
| 277 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 278 | Ga0207684_10001522 | 3300025910 | Bacteria | 24851 |
| 279 | Ga0207684_10004832 | 3300025910 | Bacteria | 12610 |
| 280 | Ga0207684_10097207 | 3300025910 | Unclassified | 2514 |
| 281 | Ga0207684_10120776 | 3300025910 | Bacteria | 2246 |
| 282 | Ga0207684_10364185 | 3300025910 | Archaea | 1244 |
| 283 | Ga0207654_10884146 | 3300025911 | Unclassified | 647 |
| 284 | Ga0207707_10062472 | 3300025912 | Bacteria | 3241 |
| 285 | Ga0207707_10787932 | 3300025912 | Bacteria | 793 |
| 286 | Ga0207695_10085478 | 3300025913 | Bacteria | 3183 |
| 287 | Ga0207663_10223516 | 3300025916 | Unclassified | 1371 |
| 288 | Ga0207660_10583320 | 3300025917 | Bacteria | 910 |
| 289 | Ga0207657_10105791 | 3300025919 | Bacteria | 2329 |
| 290 | Ga0207652_10012328 | 3300025921 | Bacteria | 6907 |
| 291 | Ga0207646_10064010 | 3300025922 | Bacteria | 3283 |
| 292 | Ga0207646_10100740 | 3300025922 | Bacteria | 2589 |
| 293 | Ga0207646_10106335 | 3300025922 | Bacteria | 2517 |
| 294 | Ga0207646_10187864 | 3300025922 | Bacteria | 1866 |
| 295 | Ga0207646_10235634 | 3300025922 | Bacteria | 1654 |
| 296 | Ga0207646_10338113 | 3300025922 | Bacteria | 1360 |
| 297 | Ga0207646_10370679 | 3300025922 | Bacteria | 1294 |
| 298 | Ga0207681_10073424 | 3300025923 | Bacteria | 2393 |
| 299 | Ga0207681_10721124 | 3300025923 | Unclassified | 830 |
| 300 | Ga0207659_10398519 | 3300025926 | Unclassified | 1151 |
| 301 | Ga0207659_10418226 | 3300025926 | Unclassified | 1124 |
| 302 | Ga0207659_10807845 | 3300025926 | Bacteria | 806 |
| 303 | Ga0207659_11779112 | 3300025926 | Bacteria | 524 |
| 304 | Ga0207700_10212696 | 3300025928 | Unclassified | 1636 |
| 305 | Ga0207706_10050575 | 3300025933 | Bacteria | 3672 |
| 306 | Ga0207706_10053360 | 3300025933 | Bacteria | 3569 |
| 307 | Ga0207706_11650470 | 3300025933 | Unclassified | 518 |
| 308 | Ga0207686_10064184 | 3300025934 | Bacteria | 2338 |
| 309 | Ga0207670_10000834 | 3300025936 | Bacteria | 16145 |
| 310 | Ga0207670_11468228 | 3300025936 | Bacteria | 579 |
| 311 | Ga0207665_11076069 | 3300025939 | Unclassified | 641 |
| 312 | Ga0207691_10066734 | 3300025940 | Bacteria | 3254 |
| 313 | Ga0207711_10052212 | 3300025941 | Bacteria | 3503 |
| 314 | Ga0207711_10137034 | 3300025941 | Bacteria | 2199 |
| 315 | Ga0207711_11033611 | 3300025941 | Bacteria | 762 |
| 316 | Ga0207667_10013301 | 3300025949 | Bacteria | 9425 |
| 317 | Ga0207667_10302878 | 3300025949 | Bacteria | 1633 |
| 318 | Ga0207667_11545981 | 3300025949 | Bacteria | 633 |
| 319 | Ga0207651_10104908 | 3300025960 | Bacteria | 2107 |
| 320 | Ga0207712_10377106 | 3300025961 | Bacteria | 1186 |
| 321 | Ga0207712_11135088 | 3300025961 | Bacteria | 696 |
| 322 | Ga0207668_10399011 | 3300025972 | Unclassified | 1162 |
| 323 | Ga0207640_10082488 | 3300025981 | Bacteria | 2202 |
| 324 | Ga0207658_12056438 | 3300025986 | Bacteria | 519 |
| 325 | Ga0207677_11404369 | 3300026023 | Unclassified | 643 |
| 326 | Ga0207639_11623971 | 3300026041 | Unclassified | 606 |
| 327 | Ga0207678_11419913 | 3300026067 | Bacteria | 613 |
| 328 | Ga0207708_11250566 | 3300026075 | Bacteria | 650 |
| 329 | Ga0207702_10122051 | 3300026078 | Bacteria | 2333 |
| 330 | Ga0207702_10150461 | 3300026078 | Bacteria | 2117 |
| 331 | Ga0207641_11517850 | 3300026088 | Bacteria | 672 |
| 332 | Ga0207648_11051657 | 3300026089 | Bacteria | 763 |
| 333 | Ga0207648_11798281 | 3300026089 | Bacteria | 574 |
| 334 | Ga0207676_12195151 | 3300026095 | Unclassified | 550 |
| 335 | Ga0207676_12240839 | 3300026095 | Unclassified | 544 |
| 336 | Ga0207674_10286460 | 3300026116 | Bacteria | 1596 |
| 337 | Ga0207675_100005692 | 3300026118 | Bacteria | 11926 |
| 338 | Ga0207675_100397628 | 3300026118 | Bacteria | 1357 |
| 339 | Ga0207675_100425835 | 3300026118 | Bacteria | 1311 |
| 340 | Ga0207675_100484903 | 3300026118 | Bacteria | 1229 |
| 341 | Ga0207683_11622521 | 3300026121 | Bacteria | 596 |
| 342 | Ga0207698_11504704 | 3300026142 | Bacteria | 688 |
| 343 | Ga0207428_10018643 | 3300027907 | Bacteria | 5924 |
| 344 | Ga0268266_10204155 | 3300028379 | Bacteria | 1810 |
| 345 | Ga0268266_11085511 | 3300028379 | Bacteria | 774 |
| 346 | Ga0268265_10018894 | 3300028380 | Bacteria | 4783 |
| 347 | Ga0268265_10105694 | 3300028380 | Bacteria | 2285 |
| 348 | Ga0268265_11554323 | 3300028380 | Bacteria | 666 |
| 349 | Ga0268265_12248584 | 3300028380 | Unclassified | 552 |
| 350 | Ga0268264_10074401 | 3300028381 | Bacteria | 2885 |
| 351 | Ga0268264_10110294 | 3300028381 | Bacteria | 2409 |
| 352 | Ga0265334_10118842 | 3300028573 | Bacteria | 946 |
| 353 | Ga0265338_10111608 | 3300028800 | Bacteria | 2200 |
| 354 | Ga0265338_10223303 | 3300028800 | Bacteria | 1406 |
| 355 | Ga0265330_10019350 | 3300031235 | Bacteria | 3121 |
| 356 | Ga0265325_10002344 | 3300031241 | Bacteria | 12818 |
| 357 | Ga0265325_10026511 | 3300031241 | Bacteria | 3138 |
| 358 | Ga0265325_10086598 | 3300031241 | Bacteria | 1550 |
| 359 | Ga0265340_10011936 | 3300031247 | Bacteria | 4599 |
| 360 | Ga0265339_10004696 | 3300031249 | Bacteria | 9271 |
| 361 | Ga0265339_10161736 | 3300031249 | Bacteria | 1126 |
| 362 | Ga0265339_10359383 | 3300031249 | Bacteria | 685 |
| 363 | Ga0265331_10054558 | 3300031250 | Bacteria | 1903 |
| 364 | Ga0265316_10791138 | 3300031344 | Unclassified | 665 |
| 365 | Ga0307408_100312430 | 3300031548 | Bacteria | 1321 |
| 366 | Ga0307408_100436310 | 3300031548 | Bacteria | 1133 |
| 367 | Ga0265313_10091102 | 3300031595 | Bacteria | 1369 |
| 368 | Ga0265313_10171912 | 3300031595 | Bacteria | 915 |
| 369 | Ga0265314_10671340 | 3300031711 | Bacteria | 527 |
| 370 | Ga0265342_10151148 | 3300031712 | Bacteria | 1289 |
| 371 | Ga0307413_10039657 | 3300031824 | Bacteria | 2741 |
| 372 | Ga0307413_10076628 | 3300031824 | Bacteria | 2126 |
| 373 | Ga0307410_10169785 | 3300031852 | Bacteria | 1642 |
| 374 | Ga0307406_10935470 | 3300031901 | Bacteria | 740 |
| 375 | Ga0307407_10080584 | 3300031903 | Bacteria | 1968 |
| 376 | Ga0307412_11352759 | 3300031911 | Bacteria | 643 |
| 377 | Ga0307409_100079662 | 3300031995 | Bacteria | 2640 |
| 378 | Ga0307409_100586482 | 3300031995 | Bacteria | 1100 |
| 379 | Ga0307416_103167185 | 3300032002 | Bacteria | 550 |
| 380 | Ga0307414_10188611 | 3300032004 | Bacteria | 1666 |
| 381 | Ga0307411_10007362 | 3300032005 | Bacteria | 5598 |
| 382 | Ga0307411_11086477 | 3300032005 | Bacteria | 720 |
| 383 | Ga0307415_102048961 | 3300032126 | Bacteria | 558 |
| 384 | Ga0307415_102062271 | 3300032126 | Bacteria | 556 |
| 385 | Ga0373939_0373587 | 3300035114 | Bacteria | 585 |
| 386 | Ga0373943_0437394 | 3300035170 | Unclassified | 759 |
| 387 | Ga0373946_0057227 | 3300035171 | Bacteria | 1649 |
| 388 | Ga0373946_0411329 | 3300035171 | Bacteria | 684 |
| 389 | Ga0373924_0139655 | 3300035410 | Bacteria | 1057 |
| 390 | Ga0373935_0122774 | 3300035692 | Unclassified | 1737 |
| 391 | Ga0373947_0066280 | 3300035725 | Bacteria | 2204 |
| 392 | Ga0373947_1124150 | 3300035725 | Bacteria | 535 |
| 393 | Ga0373937_0087468 | 3300036401 | Bacteria | 2884 |
| 394 | Ga0373937_0873408 | 3300036401 | Bacteria | 848 |
| 395 | Ga0373925_0648089 | 3300037068 | Unclassified | 870 |
| 396 | Ga0395905_0314502 | 3300037471 | Unclassified | 1455 |
| 397 | Ga0395901_1420131 | 3300038443 | Unclassified | 652 |
| 398 | Ga0436360_0716602 | 3300039438 | Unclassified | 507 |
| 399 | Ga0436363_0147995 | 3300039450 | Unclassified | 515 |
| 400 | Ga0439436_0031282 | 3300041404 | Bacteria | 1545 |
| 401 | Ga0439436_0091080 | 3300041404 | Unclassified | 849 |
| 402 | Ga0439439_0012741 | 3300041406 | Bacteria | 2035 |
| 403 | Ga0439466_0211977 | 3300041411 | Bacteria | 588 |
| 404 | Ga0451802_2178283 | 3300041460 | Unclassified | 980 |
| 405 | Ga0451833_0429582 | 3300041491 | Bacteria | 515 |
| 406 | Ga0451855_1871194 | 3300041511 | Unclassified | 678 |
| 407 | Ga0451853_3665323 | 3300041512 | Bacteria | 623 |
| 408 | Ga0439431_0225595 | 3300041997 | Bacteria | 551 |
| 409 | Ga0439442_023198 | 3300042002 | Bacteria | 1289 |
| 410 | Ga0439451_092837 | 3300042009 | Unclassified | 609 |
| 411 | Ga0439457_040169 | 3300042014 | Bacteria | 1043 |
| 412 | Ga0439462_0117104 | 3300042015 | Unclassified | 740 |
| 413 | Ga0450890_034339 | 3300042127 | Archaea | 732 |
| 414 | Ga0439446_0334396 | 3300042156 | Bacteria | 537 |
| 415 | Ga0439444_0192964 | 3300042437 | Bacteria | 511 |
| 416 | Ga0439464_0260747 | 3300042439 | Bacteria | 561 |
| 417 | Ga0451576_0293366 | 3300045051 | Bacteria | 1700 |
| 418 | Ga0451576_0604074 | 3300045051 | Bacteria | 1153 |
| 419 | Ga0495580_0250266 | 3300046472 | Bacteria | 1213 |
| 420 | Ga0495584_0177456 | 3300046491 | Bacteria | 1083 |
| 421 | Ga0495663_0077139 | 3300046525 | Bacteria | 1068 |
| 422 | Ga0495586_0581217 | 3300046535 | Bacteria | 647 |
| 423 | Ga0495645_0171519 | 3300046543 | Bacteria | 1493 |
| 424 | Ga0495656_0129424 | 3300046615 | Bacteria | 1200 |
| 425 | Ga0495599_0505388 | 3300046678 | Bacteria | 711 |
| 426 | Ga0495636_0000475 | 3300047318 | Bacteria | 14776 |
| 427 | Ga0495672_0038034 | 3300047320 | Bacteria | 2939 |
| 428 | Ga0495685_034935 | 3300047447 | Bacteria | 1727 |
| 429 | Ga0495593_0201132 | 3300047673 | Unclassified | 1001 |
| 430 | Ga0496102_0699786 | 3300048905 | Bacteria | 936 |
| 431 | Ga0496111_0137898 | 3300048914 | Bacteria | 1807 |
| 432 | Ga0496115_0930267 | 3300048918 | Bacteria | 669 |
| 433 | Ga0501032_0896889 | 3300049569 | Bacteria | 558 |
| 434 | Ga0501047_0336587 | 3300049581 | Bacteria | 1347 |
| 435 | Ga0501068_0325484 | 3300049584 | Bacteria | 986 |
| 436 | Ga0501069_0348824 | 3300049585 | Bacteria | 872 |
| 437 | Ga0501070_0742763 | 3300049586 | Bacteria | 774 |
| 438 | Ga0501072_0235662 | 3300049588 | Bacteria | 1458 |
| 439 | Ga0501073_0755986 | 3300049589 | Bacteria | 670 |
| 440 | Ga0501074_0258346 | 3300049590 | Bacteria | 1239 |
| 441 | Ga0501076_1353838 | 3300049592 | Bacteria | 585 |
| 442 | Ga0501239_011490 | 3300049672 | Bacteria | 990 |
| 443 | Ga0501080_1872414 | 3300049742 | Bacteria | 503 |
| 444 | Ga0501083_0334669 | 3300049744 | Bacteria | 984 |
| 445 | Ga0501035_0110367 | 3300049822 | Bacteria | 2410 |
| 446 | Ga0501044_0387715 | 3300049823 | Bacteria | 1311 |
| 447 | nmdc:mga03683_457239_c1 | 3300050489 | Bacteria | 615 |
| 448 | nmdc:mga0yw44_215784_c1 | 3300050492 | Bacteria | 1270 |
| 449 | nmdc:mga0yw44_325740_c1 | 3300050492 | Bacteria | 1032 |
| 450 | nmdc:mga0k408_44867_c1 | 3300050493 | Bacteria | 2550 |
| 451 | nmdc:mga05p37_332_c1 | 3300050507 | Bacteria | 50703 |
| 452 | nmdc:mga05p37_43906_c1 | 3300050507 | Bacteria | 5499 |
| 453 | nmdc:mga05p37_61414_c1 | 3300050507 | Bacteria | 4626 |
| 454 | nmdc:mga09592_1359106_c1 | 3300050508 | Bacteria | 582 |
| 455 | nmdc:mga09592_523541_c1 | 3300050508 | Bacteria | 1020 |
| 456 | nmdc:mga06r32_1070920_c1 | 3300050510 | Unclassified | 756 |
| 457 | nmdc:mga06r32_1462691_c1 | 3300050510 | Bacteria | 624 |
| 458 | nmdc:mga08y16_183562_c1 | 3300050511 | Bacteria | 2171 |
| 459 | nmdc:mga08y16_8423_c1 | 3300050511 | Bacteria | 10794 |
| 460 | nmdc:mga0n895_2154355_c1 | 3300050512 | Bacteria | 513 |
| 461 | nmdc:mga0n895_507756_c1 | 3300050512 | Unclassified | 1214 |
| 462 | nmdc:mga0n895_64263_c1 | 3300050512 | Bacteria | 3630 |
| 463 | nmdc:mga0rr50_652538_c1 | 3300050513 | Bacteria | 898 |
| 464 | nmdc:mga08x19_184281_c1 | 3300050514 | Bacteria | 1426 |
| 465 | nmdc:mga08x19_573808_c1 | 3300050514 | Bacteria | 799 |
| 466 | nmdc:mga0a205_11180_c1 | 3300050515 | Bacteria | 8261 |
| 467 | nmdc:mga0a205_137193_c1 | 3300050515 | Bacteria | 2347 |
| 468 | nmdc:mga0a205_150281_c1 | 3300050515 | Bacteria | 2229 |
| 469 | nmdc:mga0a205_433273_c1 | 3300050515 | Bacteria | 1176 |
| 470 | nmdc:mga0a205_68051_c2 | 3300050515 | Bacteria | 2209 |
| 471 | nmdc:mga0a205_971002_c1 | 3300050515 | Unclassified | 696 |
| 472 | Ga0495619_0345152 | 3300053085 | Bacteria | 1030 |
| 473 | Ga0500583_0448929 | 3300053092 | Bacteria | 612 |
| 474 | Ga0500641_0263729 | 3300053096 | Unclassified | 719 |
| 475 | Ga0500617_191282 | 3300053124 | Bacteria | 761 |
| 476 | Ga0500621_268249 | 3300053126 | Unclassified | 563 |
| 477 | Ga0500642_0380500 | 3300053130 | Bacteria | 620 |
| 478 | Ga0500658_0037047 | 3300053134 | Bacteria | 1938 |
| 479 | Ga0500588_0003173 | 3300053146 | Bacteria | 3440 |
| 480 | Ga0500588_0152102 | 3300053146 | Bacteria | 837 |
| 481 | Ga0500616_0000271 | 3300053153 | Bacteria | 77556 |
| 482 | Ga0500656_003036 | 3300053732 | Bacteria | 1548 |
| 483 | Ga0530510_0887655 | 3300061734 | Bacteria | 681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_11033213 | Ga0105243_110332131 | 43 |
| 2 | 3300025907 | Ga0207645_10008540 | Ga0207645_1000854010 | 44 |
| 3 | 3300028380 | Ga0268265_12248584 | Ga0268265_122485842 | 44 |
| 4 | iso_pu_bacteria | 2643221695 | 2644529697 | 46 |
| 5 | 3300049588 | Ga0501072_0235662 | Ga0501072_0235662_807_950 | 47 |
| 6 | 3300005340 | Ga0070689_100000014 | Ga0070689_100000014163 | 48 |
| 7 | 3300005365 | Ga0070688_100734318 | Ga0070688_1007343182 | 48 |
| 8 | 3300005434 | Ga0070709_11235160 | Ga0070709_112351601 | 48 |
| 9 | 3300005445 | Ga0070708_100507158 | Ga0070708_1005071581 | 48 |
| 10 | 3300005445 | Ga0070708_100564557 | Ga0070708_1005645573 | 48 |
| 11 | 3300005467 | Ga0070706_100001789 | Ga0070706_1000017898 | 48 |
| 12 | 3300005468 | Ga0070707_100646612 | Ga0070707_1006466121 | 48 |
| 13 | 3300005471 | Ga0070698_100000185 | Ga0070698_10000018529 | 48 |
| 14 | 3300005471 | Ga0070698_102034731 | Ga0070698_1020347311 | 48 |
| 15 | 3300005536 | Ga0070697_100001284 | Ga0070697_10000128417 | 48 |
| 16 | 3300005536 | Ga0070697_101012131 | Ga0070697_1010121312 | 48 |
| 17 | 3300005544 | Ga0070686_100229392 | Ga0070686_1002293922 | 48 |
| 18 | 3300006871 | Ga0075434_101428093 | Ga0075434_1014280932 | 48 |
| 19 | 3300009174 | Ga0105241_11764511 | Ga0105241_117645111 | 48 |
| 20 | 3300009545 | Ga0105237_10297780 | Ga0105237_102977803 | 48 |
| 21 | 3300013307 | Ga0157372_10080800 | Ga0157372_100808005 | 48 |
| 22 | 3300025906 | Ga0207699_11321126 | Ga0207699_113211262 | 48 |
| 23 | 3300025910 | Ga0207684_10001522 | Ga0207684_1000152217 | 48 |
| 24 | 3300025911 | Ga0207654_10884146 | Ga0207654_108841462 | 48 |
| 25 | 3300025922 | Ga0207646_10235634 | Ga0207646_102356342 | 48 |
| 26 | 3300025936 | Ga0207670_10000834 | Ga0207670_100008348 | 48 |
| 27 | 3300025939 | Ga0207665_11076069 | Ga0207665_110760692 | 48 |
| 28 | 3300026095 | Ga0207676_12240839 | Ga0207676_122408391 | 48 |
| 29 | 3300035171 | Ga0373946_0411329 | Ga0373946_0411329_442_588 | 48 |
| 30 | 3300035725 | Ga0373947_1124150 | Ga0373947_1124150_89_235 | 48 |
| 31 | 3300039450 | Ga0436363_0147995 | Ga0436363_0147995_138_284 | 48 |
| 32 | 3300003323 | rootH1_10299069 | rootH1_102990692 | 49 |
| 33 | 3300003911 | JGI25405J52794_10034903 | JGI25405J52794_100349033 | 49 |
| 34 | 3300005290 | Ga0065712_10347866 | Ga0065712_103478662 | 49 |
| 35 | 3300005293 | Ga0065715_10093668 | Ga0065715_100936684 | 49 |
| 36 | 3300005295 | Ga0065707_10267798 | Ga0065707_102677981 | 49 |
| 37 | 3300005295 | Ga0065707_10511463 | Ga0065707_105114631 | 49 |
| 38 | 3300005295 | Ga0065707_10572829 | Ga0065707_105728292 | 49 |
| 39 | 3300005327 | Ga0070658_10003312 | Ga0070658_1000331212 | 49 |
| 40 | 3300005328 | Ga0070676_10154187 | Ga0070676_101541872 | 49 |
| 41 | 3300005328 | Ga0070676_10494936 | Ga0070676_104949362 | 49 |
| 42 | 3300005330 | Ga0070690_100209300 | Ga0070690_1002093003 | 49 |
| 43 | 3300005330 | Ga0070690_100294230 | Ga0070690_1002942302 | 49 |
| 44 | 3300005331 | Ga0070670_100716934 | Ga0070670_1007169341 | 49 |
| 45 | 3300005334 | Ga0068869_102161118 | Ga0068869_1021611182 | 49 |
| 46 | 3300005336 | Ga0070680_100009958 | Ga0070680_1000099587 | 49 |
| 47 | 3300005338 | Ga0068868_100105601 | Ga0068868_1001056012 | 49 |
| 48 | 3300005338 | Ga0068868_100114033 | Ga0068868_1001140332 | 49 |
| 49 | 3300005339 | Ga0070660_100090874 | Ga0070660_1000908741 | 49 |
| 50 | 3300005339 | Ga0070660_101942718 | Ga0070660_1019427181 | 49 |
| 51 | 3300005340 | Ga0070689_101592639 | Ga0070689_1015926391 | 49 |
| 52 | 3300005345 | Ga0070692_10963352 | Ga0070692_109633521 | 49 |
| 53 | 3300005347 | Ga0070668_100041306 | Ga0070668_1000413068 | 49 |
| 54 | 3300005347 | Ga0070668_100254219 | Ga0070668_1002542192 | 49 |
| 55 | 3300005353 | Ga0070669_100118487 | Ga0070669_1001184873 | 49 |
| 56 | 3300005353 | Ga0070669_100218356 | Ga0070669_1002183563 | 49 |
| 57 | 3300005353 | Ga0070669_101377380 | Ga0070669_1013773801 | 49 |
| 58 | 3300005354 | Ga0070675_100501433 | Ga0070675_1005014332 | 49 |
| 59 | 3300005354 | Ga0070675_100507863 | Ga0070675_1005078632 | 49 |
| 60 | 3300005354 | Ga0070675_102130871 | Ga0070675_1021308712 | 49 |
| 61 | 3300005356 | Ga0070674_101976790 | Ga0070674_1019767902 | 49 |
| 62 | 3300005364 | Ga0070673_101742592 | Ga0070673_1017425921 | 49 |
| 63 | 3300005367 | Ga0070667_100590831 | Ga0070667_1005908312 | 49 |
| 64 | 3300005367 | Ga0070667_101076704 | Ga0070667_1010767041 | 49 |
| 65 | 3300005406 | Ga0070703_10121195 | Ga0070703_101211951 | 49 |
| 66 | 3300005434 | Ga0070709_11644522 | Ga0070709_116445222 | 49 |
| 67 | 3300005435 | Ga0070714_100323162 | Ga0070714_1003231622 | 49 |
| 68 | 3300005435 | Ga0070714_100334676 | Ga0070714_1003346762 | 49 |
| 69 | 3300005435 | Ga0070714_101041612 | Ga0070714_1010416122 | 49 |
| 70 | 3300005436 | Ga0070713_100215134 | Ga0070713_1002151341 | 49 |
| 71 | 3300005438 | Ga0070701_10317307 | Ga0070701_103173072 | 49 |
| 72 | 3300005438 | Ga0070701_11358961 | Ga0070701_113589612 | 49 |
| 73 | 3300005439 | Ga0070711_100265828 | Ga0070711_1002658282 | 49 |
| 74 | 3300005439 | Ga0070711_101288567 | Ga0070711_1012885672 | 49 |
| 75 | 3300005440 | Ga0070705_100187461 | Ga0070705_1001874612 | 49 |
| 76 | 3300005440 | Ga0070705_100295609 | Ga0070705_1002956093 | 49 |
| 77 | 3300005440 | Ga0070705_100476628 | Ga0070705_1004766282 | 49 |
| 78 | 3300005440 | Ga0070705_100652313 | Ga0070705_1006523132 | 49 |
| 79 | 3300005440 | Ga0070705_100672719 | Ga0070705_1006727192 | 49 |
| 80 | 3300005440 | Ga0070705_101747570 | Ga0070705_1017475701 | 49 |
| 81 | 3300005444 | Ga0070694_100043322 | Ga0070694_1000433222 | 49 |
| 82 | 3300005444 | Ga0070694_101747017 | Ga0070694_1017470171 | 49 |
| 83 | 3300005445 | Ga0070708_100053117 | Ga0070708_1000531173 | 49 |
| 84 | 3300005445 | Ga0070708_100203263 | Ga0070708_1002032631 | 49 |
| 85 | 3300005445 | Ga0070708_100733137 | Ga0070708_1007331371 | 49 |
| 86 | 3300005445 | Ga0070708_101633564 | Ga0070708_1016335641 | 49 |
| 87 | 3300005455 | Ga0070663_100563044 | Ga0070663_1005630441 | 49 |
| 88 | 3300005457 | Ga0070662_100050804 | Ga0070662_1000508042 | 49 |
| 89 | 3300005457 | Ga0070662_100057821 | Ga0070662_1000578212 | 49 |
| 90 | 3300005458 | Ga0070681_10053889 | Ga0070681_100538894 | 49 |
| 91 | 3300005459 | Ga0068867_100434610 | Ga0068867_1004346102 | 49 |
| 92 | 3300005459 | Ga0068867_101710096 | Ga0068867_1017100962 | 49 |
| 93 | 3300005467 | Ga0070706_100000012 | Ga0070706_10000001210 | 49 |
| 94 | 3300005467 | Ga0070706_100023631 | Ga0070706_1000236312 | 49 |
| 95 | 3300005467 | Ga0070706_100037779 | Ga0070706_1000377793 | 49 |
| 96 | 3300005467 | Ga0070706_100143344 | Ga0070706_1001433442 | 49 |
| 97 | 3300005467 | Ga0070706_100429457 | Ga0070706_1004294572 | 49 |
| 98 | 3300005467 | Ga0070706_100445603 | Ga0070706_1004456033 | 49 |
| 99 | 3300005467 | Ga0070706_100806637 | Ga0070706_1008066372 | 49 |
| 100 | 3300005468 | Ga0070707_100033444 | Ga0070707_1000334445 | 49 |
| 101 | 3300005468 | Ga0070707_100036097 | Ga0070707_1000360973 | 49 |
| 102 | 3300005468 | Ga0070707_100078935 | Ga0070707_1000789353 | 49 |
| 103 | 3300005468 | Ga0070707_100235917 | Ga0070707_1002359172 | 49 |
| 104 | 3300005468 | Ga0070707_101599140 | Ga0070707_1015991402 | 49 |
| 105 | 3300005471 | Ga0070698_100003563 | Ga0070698_1000035639 | 49 |
| 106 | 3300005471 | Ga0070698_100072318 | Ga0070698_1000723183 | 49 |
| 107 | 3300005471 | Ga0070698_100110391 | Ga0070698_1001103912 | 49 |
| 108 | 3300005471 | Ga0070698_101413388 | Ga0070698_1014133882 | 49 |
| 109 | 3300005471 | Ga0070698_101841561 | Ga0070698_1018415611 | 49 |
| 110 | 3300005518 | Ga0070699_100024010 | Ga0070699_1000240106 | 49 |
| 111 | 3300005518 | Ga0070699_100047193 | Ga0070699_1000471934 | 49 |
| 112 | 3300005518 | Ga0070699_100340182 | Ga0070699_1003401822 | 49 |
| 113 | 3300005518 | Ga0070699_100490558 | Ga0070699_1004905582 | 49 |
| 114 | 3300005530 | Ga0070679_100018909 | Ga0070679_1000189094 | 49 |
| 115 | 3300005536 | Ga0070697_100157480 | Ga0070697_1001574802 | 49 |
| 116 | 3300005536 | Ga0070697_100170574 | Ga0070697_1001705742 | 49 |
| 117 | 3300005536 | Ga0070697_100183852 | Ga0070697_1001838522 | 49 |
| 118 | 3300005536 | Ga0070697_100261624 | Ga0070697_1002616242 | 49 |
| 119 | 3300005536 | Ga0070697_100268952 | Ga0070697_1002689522 | 49 |
| 120 | 3300005536 | Ga0070697_100313308 | Ga0070697_1003133082 | 49 |
| 121 | 3300005536 | Ga0070697_100858286 | Ga0070697_1008582862 | 49 |
| 122 | 3300005536 | Ga0070697_100956254 | Ga0070697_1009562541 | 49 |
| 123 | 3300005539 | Ga0068853_100501539 | Ga0068853_1005015392 | 49 |
| 124 | 3300005539 | Ga0068853_101447909 | Ga0068853_1014479092 | 49 |
| 125 | 3300005544 | Ga0070686_100010200 | Ga0070686_1000102005 | 49 |
| 126 | 3300005544 | Ga0070686_100215032 | Ga0070686_1002150322 | 49 |
| 127 | 3300005545 | Ga0070695_100011987 | Ga0070695_1000119874 | 49 |
| 128 | 3300005545 | Ga0070695_100287960 | Ga0070695_1002879601 | 49 |
| 129 | 3300005546 | Ga0070696_100416340 | Ga0070696_1004163402 | 49 |
| 130 | 3300005546 | Ga0070696_100518833 | Ga0070696_1005188332 | 49 |
| 131 | 3300005547 | Ga0070693_100106104 | Ga0070693_1001061041 | 49 |
| 132 | 3300005547 | Ga0070693_100106911 | Ga0070693_1001069113 | 49 |
| 133 | 3300005548 | Ga0070665_100201613 | Ga0070665_1002016133 | 49 |
| 134 | 3300005548 | Ga0070665_100422822 | Ga0070665_1004228222 | 49 |
| 135 | 3300005549 | Ga0070704_100042919 | Ga0070704_1000429194 | 49 |
| 136 | 3300005549 | Ga0070704_100257624 | Ga0070704_1002576242 | 49 |
| 137 | 3300005549 | Ga0070704_100270416 | Ga0070704_1002704163 | 49 |
| 138 | 3300005549 | Ga0070704_100297328 | Ga0070704_1002973281 | 49 |
| 139 | 3300005549 | Ga0070704_100376717 | Ga0070704_1003767172 | 49 |
| 140 | 3300005549 | Ga0070704_101723575 | Ga0070704_1017235752 | 49 |
| 141 | 3300005563 | Ga0068855_100001388 | Ga0068855_1000013886 | 49 |
| 142 | 3300005563 | Ga0068855_100029996 | Ga0068855_1000299965 | 49 |
| 143 | 3300005563 | Ga0068855_101339518 | Ga0068855_1013395183 | 49 |
| 144 | 3300005578 | Ga0068854_100102938 | Ga0068854_1001029383 | 49 |
| 145 | 3300005614 | Ga0068856_100006962 | Ga0068856_1000069623 | 49 |
| 146 | 3300005614 | Ga0068856_100043860 | Ga0068856_1000438605 | 49 |
| 147 | 3300005614 | Ga0068856_100196690 | Ga0068856_1001966902 | 49 |
| 148 | 3300005615 | Ga0070702_100508768 | Ga0070702_1005087682 | 49 |
| 149 | 3300005616 | Ga0068852_101377363 | Ga0068852_1013773632 | 49 |
| 150 | 3300005617 | Ga0068859_100003398 | Ga0068859_10000339818 | 49 |
| 151 | 3300005617 | Ga0068859_100016848 | Ga0068859_1000168482 | 49 |
| 152 | 3300005617 | Ga0068859_100041785 | Ga0068859_1000417852 | 49 |
| 153 | 3300005617 | Ga0068859_100364329 | Ga0068859_1003643292 | 49 |
| 154 | 3300005617 | Ga0068859_102378430 | Ga0068859_1023784302 | 49 |
| 155 | 3300005617 | Ga0068859_102673383 | Ga0068859_1026733831 | 49 |
| 156 | 3300005617 | Ga0068859_102981044 | Ga0068859_1029810441 | 49 |
| 157 | 3300005617 | Ga0068859_103061150 | Ga0068859_1030611502 | 49 |
| 158 | 3300005618 | Ga0068864_100104615 | Ga0068864_1001046153 | 49 |
| 159 | 3300005618 | Ga0068864_100541586 | Ga0068864_1005415862 | 49 |
| 160 | 3300005719 | Ga0068861_100032582 | Ga0068861_1000325823 | 49 |
| 161 | 3300005719 | Ga0068861_100364214 | Ga0068861_1003642142 | 49 |
| 162 | 3300005719 | Ga0068861_100438263 | Ga0068861_1004382632 | 49 |
| 163 | 3300005841 | Ga0068863_102755607 | Ga0068863_1027556072 | 49 |
| 164 | 3300005842 | Ga0068858_101689386 | Ga0068858_1016893862 | 49 |
| 165 | 3300005843 | Ga0068860_100035752 | Ga0068860_1000357523 | 49 |
| 166 | 3300005843 | Ga0068860_100380762 | Ga0068860_1003807623 | 49 |
| 167 | 3300005844 | Ga0068862_100002704 | Ga0068862_10000270417 | 49 |
| 168 | 3300005844 | Ga0068862_100422834 | Ga0068862_1004228341 | 49 |
| 169 | 3300005844 | Ga0068862_100517599 | Ga0068862_1005175993 | 49 |
| 170 | 3300005937 | Ga0081455_10000289 | Ga0081455_1000028947 | 49 |
| 171 | 3300005937 | Ga0081455_10430423 | Ga0081455_104304232 | 49 |
| 172 | 3300006028 | Ga0070717_10454546 | Ga0070717_104545462 | 49 |
| 173 | 3300006028 | Ga0070717_10920780 | Ga0070717_109207802 | 49 |
| 174 | 3300006038 | Ga0075365_10080650 | Ga0075365_100806504 | 49 |
| 175 | 3300006163 | Ga0070715_10126009 | Ga0070715_101260092 | 49 |
| 176 | 3300006163 | Ga0070715_10629584 | Ga0070715_106295842 | 49 |
| 177 | 3300006173 | Ga0070716_100265808 | Ga0070716_1002658083 | 49 |
| 178 | 3300006173 | Ga0070716_101388872 | Ga0070716_1013888722 | 49 |
| 179 | 3300006175 | Ga0070712_100252696 | Ga0070712_1002526962 | 49 |
| 180 | 3300006844 | Ga0075428_101407935 | Ga0075428_1014079352 | 49 |
| 181 | 3300006852 | Ga0075433_10003850 | Ga0075433_100038504 | 49 |
| 182 | 3300006852 | Ga0075433_10262537 | Ga0075433_102625372 | 49 |
| 183 | 3300006852 | Ga0075433_10341887 | Ga0075433_103418872 | 49 |
| 184 | 3300006852 | Ga0075433_10624039 | Ga0075433_106240392 | 49 |
| 185 | 3300006871 | Ga0075434_100017012 | Ga0075434_1000170125 | 49 |
| 186 | 3300006880 | Ga0075429_101296712 | Ga0075429_1012967122 | 49 |
| 187 | 3300006914 | Ga0075436_100617713 | Ga0075436_1006177131 | 49 |
| 188 | 3300006931 | Ga0097620_100003397 | Ga0097620_10000339718 | 49 |
| 189 | 3300006931 | Ga0097620_100016849 | Ga0097620_1000168492 | 49 |
| 190 | 3300006931 | Ga0097620_100041787 | Ga0097620_1000417872 | 49 |
| 191 | 3300006931 | Ga0097620_100364322 | Ga0097620_1003643222 | 49 |
| 192 | 3300006931 | Ga0097620_102379154 | Ga0097620_1023791542 | 49 |
| 193 | 3300006931 | Ga0097620_102673093 | Ga0097620_1026730932 | 49 |
| 194 | 3300006931 | Ga0097620_102981027 | Ga0097620_1029810271 | 49 |
| 195 | 3300006931 | Ga0097620_103060718 | Ga0097620_1030607182 | 49 |
| 196 | 3300007076 | Ga0075435_100508028 | Ga0075435_1005080282 | 49 |
| 197 | 3300007265 | Ga0099794_10377083 | Ga0099794_103770832 | 49 |
| 198 | 3300007788 | Ga0099795_10163029 | Ga0099795_101630292 | 49 |
| 199 | 3300009093 | Ga0105240_10024042 | Ga0105240_100240426 | 49 |
| 200 | 3300009093 | Ga0105240_10606136 | Ga0105240_106061362 | 49 |
| 201 | 3300009093 | Ga0105240_11575823 | Ga0105240_115758232 | 49 |
| 202 | 3300009098 | Ga0105245_10110986 | Ga0105245_101109862 | 49 |
| 203 | 3300009098 | Ga0105245_10610978 | Ga0105245_106109782 | 49 |
| 204 | 3300009101 | Ga0105247_10042266 | Ga0105247_100422664 | 49 |
| 205 | 3300009101 | Ga0105247_11019770 | Ga0105247_110197702 | 49 |
| 206 | 3300009147 | Ga0114129_10026896 | Ga0114129_100268969 | 49 |
| 207 | 3300009147 | Ga0114129_10065207 | Ga0114129_100652073 | 49 |
| 208 | 3300009176 | Ga0105242_10900168 | Ga0105242_109001682 | 49 |
| 209 | 3300009176 | Ga0105242_11100938 | Ga0105242_111009382 | 49 |
| 210 | 3300009176 | Ga0105242_11408330 | Ga0105242_114083302 | 49 |
| 211 | 3300009177 | Ga0105248_10073690 | Ga0105248_100736904 | 49 |
| 212 | 3300009177 | Ga0105248_10177485 | Ga0105248_101774853 | 49 |
| 213 | 3300009177 | Ga0105248_10733475 | Ga0105248_107334752 | 49 |
| 214 | 3300009177 | Ga0105248_11937048 | Ga0105248_119370482 | 49 |
| 215 | 3300009553 | Ga0105249_10190044 | Ga0105249_101900443 | 49 |
| 216 | 3300009553 | Ga0105249_10513510 | Ga0105249_105135102 | 49 |
| 217 | 3300009553 | Ga0105249_10612782 | Ga0105249_106127822 | 49 |
| 218 | 3300011119 | Ga0105246_11165777 | Ga0105246_111657772 | 49 |
| 219 | 3300012512 | Ga0157327_1038906 | Ga0157327_10389062 | 49 |
| 220 | 3300013102 | Ga0157371_10016401 | Ga0157371_100164015 | 49 |
| 221 | 3300013104 | Ga0157370_10036086 | Ga0157370_100360863 | 49 |
| 222 | 3300013104 | Ga0157370_10068249 | Ga0157370_100682494 | 49 |
| 223 | 3300013104 | Ga0157370_11208517 | Ga0157370_112085171 | 49 |
| 224 | 3300013296 | Ga0157374_10157230 | Ga0157374_101572302 | 49 |
| 225 | 3300013297 | Ga0157378_10143457 | Ga0157378_101434572 | 49 |
| 226 | 3300013297 | Ga0157378_10228365 | Ga0157378_102283653 | 49 |
| 227 | 3300013306 | Ga0163162_10270383 | Ga0163162_102703833 | 49 |
| 228 | 3300013306 | Ga0163162_12191632 | Ga0163162_121916321 | 49 |
| 229 | 3300013306 | Ga0163162_13165098 | Ga0163162_131650982 | 49 |
| 230 | 3300013308 | Ga0157375_12109787 | Ga0157375_121097871 | 49 |
| 231 | 3300014326 | Ga0157380_10328880 | Ga0157380_103288802 | 49 |
| 232 | 3300014326 | Ga0157380_10933849 | Ga0157380_109338492 | 49 |
| 233 | 3300014326 | Ga0157380_13520121 | Ga0157380_135201212 | 49 |
| 234 | 3300014745 | Ga0157377_10225658 | Ga0157377_102256582 | 49 |
| 235 | 3300025297 | Ga0209758_1060078 | Ga0209758_10600783 | 49 |
| 236 | 3300025885 | Ga0207653_10096988 | Ga0207653_100969882 | 49 |
| 237 | 3300025885 | Ga0207653_10185986 | Ga0207653_101859861 | 49 |
| 238 | 3300025909 | Ga0207705_10018074 | Ga0207705_100180745 | 49 |
| 239 | 3300025910 | Ga0207684_10000028 | Ga0207684_10000028140 | 49 |
| 240 | 3300025910 | Ga0207684_10004832 | Ga0207684_100048325 | 49 |
| 241 | 3300025910 | Ga0207684_10097207 | Ga0207684_100972072 | 49 |
| 242 | 3300025910 | Ga0207684_10120776 | Ga0207684_101207762 | 49 |
| 243 | 3300025910 | Ga0207684_10364185 | Ga0207684_103641852 | 49 |
| 244 | 3300025912 | Ga0207707_10062472 | Ga0207707_100624724 | 49 |
| 245 | 3300025913 | Ga0207695_10085478 | Ga0207695_100854784 | 49 |
| 246 | 3300025916 | Ga0207663_10223516 | Ga0207663_102235162 | 49 |
| 247 | 3300025917 | Ga0207660_10583320 | Ga0207660_105833202 | 49 |
| 248 | 3300025919 | Ga0207657_10105791 | Ga0207657_101057914 | 49 |
| 249 | 3300025921 | Ga0207652_10012328 | Ga0207652_100123286 | 49 |
| 250 | 3300025922 | Ga0207646_10064010 | Ga0207646_100640102 | 49 |
| 251 | 3300025922 | Ga0207646_10100740 | Ga0207646_101007403 | 49 |
| 252 | 3300025922 | Ga0207646_10106335 | Ga0207646_101063353 | 49 |
| 253 | 3300025922 | Ga0207646_10338113 | Ga0207646_103381132 | 49 |
| 254 | 3300025922 | Ga0207646_10370679 | Ga0207646_103706792 | 49 |
| 255 | 3300025923 | Ga0207681_10073424 | Ga0207681_100734242 | 49 |
| 256 | 3300025926 | Ga0207659_10398519 | Ga0207659_103985192 | 49 |
| 257 | 3300025926 | Ga0207659_10418226 | Ga0207659_104182262 | 49 |
| 258 | 3300025926 | Ga0207659_10807845 | Ga0207659_108078452 | 49 |
| 259 | 3300025926 | Ga0207659_11779112 | Ga0207659_117791121 | 49 |
| 260 | 3300025933 | Ga0207706_10050575 | Ga0207706_100505756 | 49 |
| 261 | 3300025933 | Ga0207706_10053360 | Ga0207706_100533602 | 49 |
| 262 | 3300025933 | Ga0207706_11650470 | Ga0207706_116504701 | 49 |
| 263 | 3300025934 | Ga0207686_10064184 | Ga0207686_100641841 | 49 |
| 264 | 3300025936 | Ga0207670_11468228 | Ga0207670_114682282 | 49 |
| 265 | 3300025941 | Ga0207711_10052212 | Ga0207711_100522122 | 49 |
| 266 | 3300025941 | Ga0207711_10137034 | Ga0207711_101370344 | 49 |
| 267 | 3300025941 | Ga0207711_11033611 | Ga0207711_110336112 | 49 |
| 268 | 3300025949 | Ga0207667_10013301 | Ga0207667_100133014 | 49 |
| 269 | 3300025949 | Ga0207667_10302878 | Ga0207667_103028782 | 49 |
| 270 | 3300025949 | Ga0207667_11545981 | Ga0207667_115459812 | 49 |
| 271 | 3300025960 | Ga0207651_10104908 | Ga0207651_101049082 | 49 |
| 272 | 3300025961 | Ga0207712_10377106 | Ga0207712_103771062 | 49 |
| 273 | 3300025972 | Ga0207668_10399011 | Ga0207668_103990113 | 49 |
| 274 | 3300025981 | Ga0207640_10082488 | Ga0207640_100824882 | 49 |
| 275 | 3300025986 | Ga0207658_12056438 | Ga0207658_120564382 | 49 |
| 276 | 3300026023 | Ga0207677_11404369 | Ga0207677_114043692 | 49 |
| 277 | 3300026041 | Ga0207639_11623971 | Ga0207639_116239712 | 49 |
| 278 | 3300026067 | Ga0207678_11419913 | Ga0207678_114199132 | 49 |
| 279 | 3300026075 | Ga0207708_11250566 | Ga0207708_112505662 | 49 |
| 280 | 3300026078 | Ga0207702_10122051 | Ga0207702_101220513 | 49 |
| 281 | 3300026078 | Ga0207702_10150461 | Ga0207702_101504612 | 49 |
| 282 | 3300026088 | Ga0207641_11517850 | Ga0207641_115178502 | 49 |
| 283 | 3300026089 | Ga0207648_11051657 | Ga0207648_110516573 | 49 |
| 284 | 3300026089 | Ga0207648_11798281 | Ga0207648_117982812 | 49 |
| 285 | 3300026095 | Ga0207676_12195151 | Ga0207676_121951512 | 49 |
| 286 | 3300026116 | Ga0207674_10286460 | Ga0207674_102864603 | 49 |
| 287 | 3300026118 | Ga0207675_100005692 | Ga0207675_1000056929 | 49 |
| 288 | 3300026118 | Ga0207675_100397628 | Ga0207675_1003976282 | 49 |
| 289 | 3300026118 | Ga0207675_100425835 | Ga0207675_1004258353 | 49 |
| 290 | 3300026121 | Ga0207683_11622521 | Ga0207683_116225212 | 49 |
| 291 | 3300026142 | Ga0207698_11504704 | Ga0207698_115047042 | 49 |
| 292 | 3300028379 | Ga0268266_10204155 | Ga0268266_102041552 | 49 |
| 293 | 3300028379 | Ga0268266_11085511 | Ga0268266_110855112 | 49 |
| 294 | 3300028380 | Ga0268265_10018894 | Ga0268265_100188942 | 49 |
| 295 | 3300028380 | Ga0268265_11554323 | Ga0268265_115543231 | 49 |
| 296 | 3300028381 | Ga0268264_10074401 | Ga0268264_100744014 | 49 |
| 297 | 3300028381 | Ga0268264_10110294 | Ga0268264_101102943 | 49 |
| 298 | 3300028573 | Ga0265334_10118842 | Ga0265334_101188422 | 49 |
| 299 | 3300028800 | Ga0265338_10111608 | Ga0265338_101116083 | 49 |
| 300 | 3300031235 | Ga0265330_10019350 | Ga0265330_100193504 | 49 |
| 301 | 3300031241 | Ga0265325_10002344 | Ga0265325_1000234412 | 49 |
| 302 | 3300031241 | Ga0265325_10026511 | Ga0265325_100265114 | 49 |
| 303 | 3300031247 | Ga0265340_10011936 | Ga0265340_100119364 | 49 |
| 304 | 3300031249 | Ga0265339_10004696 | Ga0265339_100046969 | 49 |
| 305 | 3300031249 | Ga0265339_10359383 | Ga0265339_103593832 | 49 |
| 306 | 3300031548 | Ga0307408_100312430 | Ga0307408_1003124302 | 49 |
| 307 | 3300031595 | Ga0265313_10091102 | Ga0265313_100911021 | 49 |
| 308 | 3300031711 | Ga0265314_10671340 | Ga0265314_106713402 | 49 |
| 309 | 3300031712 | Ga0265342_10151148 | Ga0265342_101511483 | 49 |
| 310 | 3300031901 | Ga0307406_10935470 | Ga0307406_109354701 | 49 |
| 311 | 3300031911 | Ga0307412_11352759 | Ga0307412_113527592 | 49 |
| 312 | 3300032126 | Ga0307415_102048961 | Ga0307415_1020489612 | 49 |
| 313 | 3300035114 | Ga0373939_0373587 | Ga0373939_0373587_12_161 | 49 |
| 314 | 3300035170 | Ga0373943_0437394 | Ga0373943_0437394_219_368 | 49 |
| 315 | 3300035692 | Ga0373935_0122774 | Ga0373935_0122774_1137_1286 | 49 |
| 316 | 3300036401 | Ga0373937_0087468 | Ga0373937_0087468_1268_1417 | 49 |
| 317 | 3300036401 | Ga0373937_0873408 | Ga0373937_0873408_268_417 | 49 |
| 318 | 3300037068 | Ga0373925_0648089 | Ga0373925_0648089_326_475 | 49 |
| 319 | 3300037471 | Ga0395905_0314502 | Ga0395905_0314502_1252_1401 | 49 |
| 320 | 3300039438 | Ga0436360_0716602 | Ga0436360_0716602_115_264 | 49 |
| 321 | 3300041404 | Ga0439436_0031282 | Ga0439436_0031282_115_264 | 49 |
| 322 | 3300041404 | Ga0439436_0091080 | Ga0439436_0091080_409_558 | 49 |
| 323 | 3300041406 | Ga0439439_0012741 | Ga0439439_0012741_1820_1969 | 49 |
| 324 | 3300041411 | Ga0439466_0211977 | Ga0439466_0211977_119_268 | 49 |
| 325 | 3300041460 | Ga0451802_2178283 | Ga0451802_2178283_68_217 | 49 |
| 326 | 3300041491 | Ga0451833_0429582 | Ga0451833_0429582_211_360 | 49 |
| 327 | 3300041511 | Ga0451855_1871194 | Ga0451855_1871194_492_641 | 49 |
| 328 | 3300041512 | Ga0451853_3665323 | Ga0451853_3665323_176_325 | 49 |
| 329 | 3300041997 | Ga0439431_0225595 | Ga0439431_0225595_184_333 | 49 |
| 330 | 3300042002 | Ga0439442_023198 | Ga0439442_023198_963_1112 | 49 |
| 331 | 3300042009 | Ga0439451_092837 | Ga0439451_092837_103_252 | 49 |
| 332 | 3300042014 | Ga0439457_040169 | Ga0439457_040169_324_473 | 49 |
| 333 | 3300042015 | Ga0439462_0117104 | Ga0439462_0117104_257_406 | 49 |
| 334 | 3300042127 | Ga0450890_034339 | Ga0450890_034339_210_359 | 49 |
| 335 | 3300042156 | Ga0439446_0334396 | Ga0439446_0334396_371_520 | 49 |
| 336 | 3300042437 | Ga0439444_0192964 | Ga0439444_0192964_327_476 | 49 |
| 337 | 3300042439 | Ga0439464_0260747 | Ga0439464_0260747_237_386 | 49 |
| 338 | 3300045051 | Ga0451576_0293366 | Ga0451576_0293366_590_751 | 49 |
| 339 | 3300046472 | Ga0495580_0250266 | Ga0495580_0250266_476_625 | 49 |
| 340 | 3300046491 | Ga0495584_0177456 | Ga0495584_0177456_844_993 | 49 |
| 341 | 3300046525 | Ga0495663_0077139 | Ga0495663_0077139_101_250 | 49 |
| 342 | 3300046543 | Ga0495645_0171519 | Ga0495645_0171519_1028_1177 | 49 |
| 343 | 3300046615 | Ga0495656_0129424 | Ga0495656_0129424_948_1097 | 49 |
| 344 | 3300046678 | Ga0495599_0505388 | Ga0495599_0505388_422_571 | 49 |
| 345 | 3300047318 | Ga0495636_0000475 | Ga0495636_0000475_14004_14153 | 49 |
| 346 | 3300047320 | Ga0495672_0038034 | Ga0495672_0038034_652_801 | 49 |
| 347 | 3300047447 | Ga0495685_034935 | Ga0495685_034935_1348_1497 | 49 |
| 348 | 3300048905 | Ga0496102_0699786 | Ga0496102_0699786_281_430 | 49 |
| 349 | 3300048918 | Ga0496115_0930267 | Ga0496115_0930267_382_531 | 49 |
| 350 | 3300049569 | Ga0501032_0896889 | Ga0501032_0896889_211_360 | 49 |
| 351 | 3300049581 | Ga0501047_0336587 | Ga0501047_0336587_202_351 | 49 |
| 352 | 3300049584 | Ga0501068_0325484 | Ga0501068_0325484_228_377 | 49 |
| 353 | 3300049585 | Ga0501069_0348824 | Ga0501069_0348824_479_628 | 49 |
| 354 | 3300049586 | Ga0501070_0742763 | Ga0501070_0742763_348_497 | 49 |
| 355 | 3300049590 | Ga0501074_0258346 | Ga0501074_0258346_1020_1169 | 49 |
| 356 | 3300049592 | Ga0501076_1353838 | Ga0501076_1353838_128_277 | 49 |
| 357 | 3300049744 | Ga0501083_0334669 | Ga0501083_0334669_157_306 | 49 |
| 358 | 3300049822 | Ga0501035_0110367 | Ga0501035_0110367_179_328 | 49 |
| 359 | 3300049823 | Ga0501044_0387715 | Ga0501044_0387715_849_998 | 49 |
| 360 | 3300050492 | nmdc:mga0yw44_215784_c1 | nmdc:mga0yw44_215784_c1_236_385 | 49 |
| 361 | 3300050492 | nmdc:mga0yw44_325740_c1 | nmdc:mga0yw44_325740_c1_328_477 | 49 |
| 362 | 3300050507 | nmdc:mga05p37_43906_c1 | nmdc:mga05p37_43906_c1_3785_3934 | 49 |
| 363 | 3300050507 | nmdc:mga05p37_61414_c1 | nmdc:mga05p37_61414_c1_4064_4213 | 49 |
| 364 | 3300050512 | nmdc:mga0n895_2154355_c1 | nmdc:mga0n895_2154355_c1_129_278 | 49 |
| 365 | 3300050512 | nmdc:mga0n895_507756_c1 | nmdc:mga0n895_507756_c1_764_913 | 49 |
| 366 | 3300050512 | nmdc:mga0n895_64263_c1 | nmdc:mga0n895_64263_c1_2155_2304 | 49 |
| 367 | 3300050513 | nmdc:mga0rr50_652538_c1 | nmdc:mga0rr50_652538_c1_233_382 | 49 |
| 368 | 3300050514 | nmdc:mga08x19_573808_c1 | nmdc:mga08x19_573808_c1_613_762 | 49 |
| 369 | 3300050515 | nmdc:mga0a205_11180_c1 | nmdc:mga0a205_11180_c1_6719_6868 | 49 |
| 370 | 3300050515 | nmdc:mga0a205_150281_c1 | nmdc:mga0a205_150281_c1_1423_1572 | 49 |
| 371 | 3300050515 | nmdc:mga0a205_433273_c1 | nmdc:mga0a205_433273_c1_326_475 | 49 |
| 372 | 3300050515 | nmdc:mga0a205_68051_c2 | nmdc:mga0a205_68051_c2_1917_2066 | 49 |
| 373 | 3300053092 | Ga0500583_0448929 | Ga0500583_0448929_146_295 | 49 |
| 374 | 3300053096 | Ga0500641_0263729 | Ga0500641_0263729_31_180 | 49 |
| 375 | 3300053124 | Ga0500617_191282 | Ga0500617_191282_339_488 | 49 |
| 376 | 3300053126 | Ga0500621_268249 | Ga0500621_268249_25_174 | 49 |
| 377 | 3300053130 | Ga0500642_0380500 | Ga0500642_0380500_157_306 | 49 |
| 378 | 3300053134 | Ga0500658_0037047 | Ga0500658_0037047_1607_1756 | 49 |
| 379 | 3300053146 | Ga0500588_0003173 | Ga0500588_0003173_1074_1223 | 49 |
| 380 | 3300053146 | Ga0500588_0152102 | Ga0500588_0152102_365_514 | 49 |
| 381 | 3300053153 | Ga0500616_0000271 | Ga0500616_0000271_25995_26144 | 49 |
| 382 | 3300053732 | Ga0500656_003036 | Ga0500656_003036_900_1049 | 49 |
| 383 | 3300061734 | Ga0530510_0887655 | Ga0530510_0887655_173_322 | 49 |
| 384 | 3300005295 | Ga0065707_10067785 | Ga0065707_100677852 | 50 |
| 385 | 3300005295 | Ga0065707_10144688 | Ga0065707_101446882 | 50 |
| 386 | 3300005330 | Ga0070690_100330943 | Ga0070690_1003309431 | 50 |
| 387 | 3300005353 | Ga0070669_100335018 | Ga0070669_1003350182 | 50 |
| 388 | 3300005366 | Ga0070659_101614355 | Ga0070659_1016143551 | 50 |
| 389 | 3300005440 | Ga0070705_100203655 | Ga0070705_1002036553 | 50 |
| 390 | 3300005445 | Ga0070708_100162535 | Ga0070708_1001625353 | 50 |
| 391 | 3300005458 | Ga0070681_10919593 | Ga0070681_109195931 | 50 |
| 392 | 3300005467 | Ga0070706_100193493 | Ga0070706_1001934932 | 50 |
| 393 | 3300005468 | Ga0070707_101222591 | Ga0070707_1012225911 | 50 |
| 394 | 3300005471 | Ga0070698_100123806 | Ga0070698_1001238062 | 50 |
| 395 | 3300005471 | Ga0070698_100219775 | Ga0070698_1002197752 | 50 |
| 396 | 3300005518 | Ga0070699_100112234 | Ga0070699_1001122343 | 50 |
| 397 | 3300005518 | Ga0070699_101553593 | Ga0070699_1015535932 | 50 |
| 398 | 3300005536 | Ga0070697_100039980 | Ga0070697_1000399802 | 50 |
| 399 | 3300005545 | Ga0070695_100480351 | Ga0070695_1004803512 | 50 |
| 400 | 3300005545 | Ga0070695_100509991 | Ga0070695_1005099912 | 50 |
| 401 | 3300005615 | Ga0070702_100215628 | Ga0070702_1002156284 | 50 |
| 402 | 3300005718 | Ga0068866_10102009 | Ga0068866_101020092 | 50 |
| 403 | 3300005844 | Ga0068862_100125509 | Ga0068862_1001255092 | 50 |
| 404 | 3300006058 | Ga0075432_10389893 | Ga0075432_103898932 | 50 |
| 405 | 3300006177 | Ga0075362_10211605 | Ga0075362_102116051 | 50 |
| 406 | 3300006195 | Ga0075366_10012012 | Ga0075366_100120125 | 50 |
| 407 | 3300006195 | Ga0075366_10729550 | Ga0075366_107295502 | 50 |
| 408 | 3300006237 | Ga0097621_100068878 | Ga0097621_1000688783 | 50 |
| 409 | 3300006237 | Ga0097621_100255164 | Ga0097621_1002551643 | 50 |
| 410 | 3300006358 | Ga0068871_100011447 | Ga0068871_1000114474 | 50 |
| 411 | 3300006358 | Ga0068871_100279948 | Ga0068871_1002799482 | 50 |
| 412 | 3300006847 | Ga0075431_100168819 | Ga0075431_1001688192 | 50 |
| 413 | 3300006852 | Ga0075433_10057933 | Ga0075433_100579336 | 50 |
| 414 | 3300006880 | Ga0075429_100156567 | Ga0075429_1001565671 | 50 |
| 415 | 3300007076 | Ga0075435_101250528 | Ga0075435_1012505282 | 50 |
| 416 | 3300009094 | Ga0111539_10023344 | Ga0111539_100233447 | 50 |
| 417 | 3300009101 | Ga0105247_10029799 | Ga0105247_100297993 | 50 |
| 418 | 3300009101 | Ga0105247_11804235 | Ga0105247_118042352 | 50 |
| 419 | 3300009147 | Ga0114129_10000373 | Ga0114129_1000037325 | 50 |
| 420 | 3300009147 | Ga0114129_10358913 | Ga0114129_103589132 | 50 |
| 421 | 3300009147 | Ga0114129_11794930 | Ga0114129_117949302 | 50 |
| 422 | 3300009553 | Ga0105249_11112122 | Ga0105249_111121222 | 50 |
| 423 | 3300013297 | Ga0157378_10001895 | Ga0157378_1000189521 | 50 |
| 424 | 3300013297 | Ga0157378_11857027 | Ga0157378_118570271 | 50 |
| 425 | 3300014326 | Ga0157380_10179764 | Ga0157380_101797642 | 50 |
| 426 | 3300014326 | Ga0157380_11245969 | Ga0157380_112459692 | 50 |
| 427 | 3300025899 | Ga0207642_10141540 | Ga0207642_101415401 | 50 |
| 428 | 3300025900 | Ga0207710_10070482 | Ga0207710_100704822 | 50 |
| 429 | 3300025912 | Ga0207707_10787932 | Ga0207707_107879322 | 50 |
| 430 | 3300025922 | Ga0207646_10187864 | Ga0207646_101878644 | 50 |
| 431 | 3300025923 | Ga0207681_10721124 | Ga0207681_107211242 | 50 |
| 432 | 3300025961 | Ga0207712_11135088 | Ga0207712_111350882 | 50 |
| 433 | 3300026118 | Ga0207675_100484903 | Ga0207675_1004849032 | 50 |
| 434 | 3300027907 | Ga0207428_10018643 | Ga0207428_100186432 | 50 |
| 435 | 3300028380 | Ga0268265_10105694 | Ga0268265_101056942 | 50 |
| 436 | 3300028800 | Ga0265338_10223303 | Ga0265338_102233033 | 50 |
| 437 | 3300031241 | Ga0265325_10086598 | Ga0265325_100865982 | 50 |
| 438 | 3300031249 | Ga0265339_10161736 | Ga0265339_101617362 | 50 |
| 439 | 3300031250 | Ga0265331_10054558 | Ga0265331_100545582 | 50 |
| 440 | 3300031344 | Ga0265316_10791138 | Ga0265316_107911382 | 50 |
| 441 | 3300031548 | Ga0307408_100436310 | Ga0307408_1004363102 | 50 |
| 442 | 3300031595 | Ga0265313_10171912 | Ga0265313_101719123 | 50 |
| 443 | 3300031824 | Ga0307413_10039657 | Ga0307413_100396573 | 50 |
| 444 | 3300031824 | Ga0307413_10076628 | Ga0307413_100766283 | 50 |
| 445 | 3300031852 | Ga0307410_10169785 | Ga0307410_101697853 | 50 |
| 446 | 3300031903 | Ga0307407_10080584 | Ga0307407_100805842 | 50 |
| 447 | 3300031995 | Ga0307409_100079662 | Ga0307409_1000796624 | 50 |
| 448 | 3300031995 | Ga0307409_100586482 | Ga0307409_1005864822 | 50 |
| 449 | 3300032002 | Ga0307416_103167185 | Ga0307416_1031671852 | 50 |
| 450 | 3300032004 | Ga0307414_10188611 | Ga0307414_101886112 | 50 |
| 451 | 3300032005 | Ga0307411_10007362 | Ga0307411_100073625 | 50 |
| 452 | 3300032005 | Ga0307411_11086477 | Ga0307411_110864772 | 50 |
| 453 | 3300032126 | Ga0307415_102062271 | Ga0307415_1020622712 | 50 |
| 454 | 3300035171 | Ga0373946_0057227 | Ga0373946_0057227_317_469 | 50 |
| 455 | 3300035410 | Ga0373924_0139655 | Ga0373924_0139655_225_377 | 50 |
| 456 | 3300035725 | Ga0373947_0066280 | Ga0373947_0066280_250_402 | 50 |
| 457 | 3300038443 | Ga0395901_1420131 | Ga0395901_1420131_423_575 | 50 |
| 458 | 3300045051 | Ga0451576_0604074 | Ga0451576_0604074_703_855 | 50 |
| 459 | 3300046535 | Ga0495586_0581217 | Ga0495586_0581217_397_549 | 50 |
| 460 | 3300047673 | Ga0495593_0201132 | Ga0495593_0201132_558_710 | 50 |
| 461 | 3300048914 | Ga0496111_0137898 | Ga0496111_0137898_229_381 | 50 |
| 462 | 3300049589 | Ga0501073_0755986 | Ga0501073_0755986_204_356 | 50 |
| 463 | 3300049672 | Ga0501239_011490 | Ga0501239_011490_34_186 | 50 |
| 464 | 3300049742 | Ga0501080_1872414 | Ga0501080_1872414_189_341 | 50 |
| 465 | 3300050489 | nmdc:mga03683_457239_c1 | nmdc:mga03683_457239_c1_260_412 | 50 |
| 466 | 3300050493 | nmdc:mga0k408_44867_c1 | nmdc:mga0k408_44867_c1_1498_1650 | 50 |
| 467 | 3300050507 | nmdc:mga05p37_332_c1 | nmdc:mga05p37_332_c1_33409_33561 | 50 |
| 468 | 3300050508 | nmdc:mga09592_1359106_c1 | nmdc:mga09592_1359106_c1_39_191 | 50 |
| 469 | 3300050508 | nmdc:mga09592_523541_c1 | nmdc:mga09592_523541_c1_778_930 | 50 |
| 470 | 3300050510 | nmdc:mga06r32_1070920_c1 | nmdc:mga06r32_1070920_c1_494_646 | 50 |
| 471 | 3300050510 | nmdc:mga06r32_1462691_c1 | nmdc:mga06r32_1462691_c1_409_561 | 50 |
| 472 | 3300050511 | nmdc:mga08y16_8423_c1 | nmdc:mga08y16_8423_c1_1756_1908 | 50 |
| 473 | 3300050514 | nmdc:mga08x19_184281_c1 | nmdc:mga08x19_184281_c1_531_683 | 50 |
| 474 | 3300050515 | nmdc:mga0a205_137193_c1 | nmdc:mga0a205_137193_c1_913_1065 | 50 |
| 475 | 3300053085 | Ga0495619_0345152 | Ga0495619_0345152_27_179 | 50 |
| 476 | 3300000532 | CNAas_1003700 | CNAas_10037002 | 51 |
| 477 | 3300005328 | Ga0070676_11369204 | Ga0070676_113692042 | 51 |
| 478 | 3300005354 | Ga0070675_100033388 | Ga0070675_1000333884 | 51 |
| 479 | 3300005543 | Ga0070672_100043359 | Ga0070672_1000433594 | 51 |
| 480 | 3300005546 | Ga0070696_100753939 | Ga0070696_1007539391 | 51 |
| 481 | 3300025928 | Ga0207700_10212696 | Ga0207700_102126962 | 51 |
| 482 | 3300025940 | Ga0207691_10066734 | Ga0207691_100667343 | 51 |
| 483 | 3300050511 | nmdc:mga08y16_183562_c1 | nmdc:mga08y16_183562_c1_403_558 | 51 |
| 484 | 3300050515 | nmdc:mga0a205_971002_c1 | nmdc:mga0a205_971002_c1_528_686 | 51 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2k8e-assembly1.cif.gz_A | solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. | 0.734 | 2 | 38 |
| 1gcc-assembly1.cif.gz_A | solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure | 0.7257 | 2 | 51 |
| 1gcc-assembly1.cif.gz_A | solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure | 0.6926 | 2 | 51 |
| 7p4l-assembly1.cif.gz_B | crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) | 0.6842 | 1 | 29 |
| 7wq5-assembly1.cif.gz_A | crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna | 0.6741 | 2 | 36 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1Z8_221_321_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9282 | 1 | 13 | 2.40.50.140 |
| af_P76389_435_515_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9017 | 1 | 13 | 3.30.465.10 |
| 2dt8A02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3; | 0.823 | 9 | 50 | 3.30.1180.10 |
| af_A0A1D6KJ58_29_91_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7847 | 2 | 36 | 3.30.730.10 |
| af_C0P9B0_100_150_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7811 | 2 | 46 | 3.30.730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5YM63-F1-model_v4 | Uncharacterized protein | 1.013 | 1 | 39 |
|
| AF-A0A2V7LIK5-F1-model_v4 | AP2-like integrase N-terminal domain-containing protein | 1.009 | 1 | 51 |
|
| AF-A0A3S3V9N4-F1-model_v4 | AP2-like integrase N-terminal domain-containing protein | 1.008 | 1 | 48 |
|
| AF-A0A7R7BKA7-F1-model_v4 | deleted | 1.007 | 1 | 48 |
|
| AF-A0A2V7EQ65-F1-model_v4 | AP2-like integrase N-terminal domain-containing protein | 1.007 | 1 | 50 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar