F452895

General Info

Members Datasets Scaffolds Average Seq Length
484 256 483 49

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_102034731|Ga0070698_1020347311
Length 48
Sequence MIRKLPSGGYRLYSRKKDKQGKRKNLGTFPTLQAAKKQERAVQFLKRK

Samples

Sample ID Description Type Environment
1 2643221695 Lysobacter sp. Root494 Isolate Unclassified
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
194 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
195 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
200 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
250 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 0.83
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1003700 3300000532 Bacteria 1003
2 rootH1_10299069 3300003323 Bacteria 2157
3 JGI25405J52794_10034903 3300003911 Bacteria 1052
4 Ga0065712_10347866 3300005290 Bacteria 791
5 Ga0065715_10093668 3300005293 Bacteria 4603
6 Ga0065707_10067785 3300005295 Bacteria 685
7 Ga0065707_10144688 3300005295 Bacteria 1728
8 Ga0065707_10267798 3300005295 Bacteria 1079
9 Ga0065707_10511463 3300005295 Bacteria 749
10 Ga0065707_10572829 3300005295 Bacteria 707
11 Ga0070658_10003312 3300005327 Bacteria 13290
12 Ga0070676_10154187 3300005328 Bacteria 1473
13 Ga0070676_10494936 3300005328 Bacteria 867
14 Ga0070676_11369204 3300005328 Unclassified 542
15 Ga0070690_100209300 3300005330 Unclassified 1361
16 Ga0070690_100294230 3300005330 Unclassified 1162
17 Ga0070690_100330943 3300005330 Bacteria 1100
18 Ga0070670_100716934 3300005331 Bacteria 900
19 Ga0068869_102161118 3300005334 Bacteria 500
20 Ga0070680_100009958 3300005336 Bacteria 7321
21 Ga0068868_100105601 3300005338 Unclassified 2284
22 Ga0068868_100114033 3300005338 Unclassified 2198
23 Ga0070660_100090874 3300005339 Bacteria 2407
24 Ga0070660_101942718 3300005339 Unclassified 502
25 Ga0070689_100000014 3300005340 Bacteria 185640
26 Ga0070689_101592639 3300005340 Unclassified 593
27 Ga0070692_10963352 3300005345 Unclassified 594
28 Ga0070668_100041306 3300005347 Plasmid 3533
29 Ga0070668_100254219 3300005347 Bacteria 1459
30 Ga0070669_100118487 3300005353 Bacteria 2016
31 Ga0070669_100218356 3300005353 Bacteria 1507
32 Ga0070669_100335018 3300005353 Bacteria 1225
33 Ga0070669_101377380 3300005353 Bacteria 612
34 Ga0070675_100033388 3300005354 Unclassified 4172
35 Ga0070675_100501433 3300005354 Unclassified 1094
36 Ga0070675_100507863 3300005354 Unclassified 1087
37 Ga0070675_102130871 3300005354 Bacteria 517
38 Ga0070674_101976790 3300005356 Unclassified 531
39 Ga0070673_101742592 3300005364 Bacteria 590
40 Ga0070688_100734318 3300005365 Bacteria 767
41 Ga0070659_101614355 3300005366 Unclassified 579
42 Ga0070667_100590831 3300005367 Bacteria 1022
43 Ga0070667_101076704 3300005367 Bacteria 751
44 Ga0070703_10121195 3300005406 Bacteria 949
45 Ga0070709_11235160 3300005434 Unclassified 601
46 Ga0070709_11644522 3300005434 Unclassified 523
47 Ga0070714_100323162 3300005435 Unclassified 1443
48 Ga0070714_100334676 3300005435 Bacteria 1418
49 Ga0070714_101041612 3300005435 Bacteria 797
50 Ga0070713_100215134 3300005436 Bacteria 1741
51 Ga0070701_10317307 3300005438 Bacteria 963
52 Ga0070701_11358961 3300005438 Bacteria 509
53 Ga0070711_100265828 3300005439 Bacteria 1352
54 Ga0070711_101288567 3300005439 Bacteria 634
55 Ga0070705_100187461 3300005440 Bacteria 1407
56 Ga0070705_100203655 3300005440 Bacteria 1359
57 Ga0070705_100295609 3300005440 Unclassified 1158
58 Ga0070705_100476628 3300005440 Bacteria 942
59 Ga0070705_100652313 3300005440 Archaea 821
60 Ga0070705_100672719 3300005440 Bacteria 810
61 Ga0070705_101747570 3300005440 Bacteria 526
62 Ga0070694_100043322 3300005444 Bacteria 3009
63 Ga0070694_101747017 3300005444 Bacteria 530
64 Ga0070708_100053117 3300005445 Unclassified 3594
65 Ga0070708_100162535 3300005445 Bacteria 2081
66 Ga0070708_100203263 3300005445 Bacteria 1855
67 Ga0070708_100507158 3300005445 Bacteria 1138
68 Ga0070708_100564557 3300005445 Unclassified 1073
69 Ga0070708_100733137 3300005445 Bacteria 929
70 Ga0070708_101633564 3300005445 Unclassified 599
71 Ga0070663_100563044 3300005455 Bacteria 954
72 Ga0070662_100050804 3300005457 Bacteria 2991
73 Ga0070662_100057821 3300005457 Bacteria 2819
74 Ga0070681_10053889 3300005458 Bacteria 4008
75 Ga0070681_10919593 3300005458 Bacteria 793
76 Ga0068867_100434610 3300005459 Bacteria 1115
77 Ga0068867_101710096 3300005459 Unclassified 590
78 Ga0070706_100000012 3300005467 Bacteria 195040
79 Ga0070706_100001789 3300005467 Bacteria 22254
80 Ga0070706_100023631 3300005467 Bacteria 5659
81 Ga0070706_100037779 3300005467 Bacteria 4459
82 Ga0070706_100143344 3300005467 Bacteria 2230
83 Ga0070706_100193493 3300005467 Bacteria 1900
84 Ga0070706_100429457 3300005467 Bacteria 1229
85 Ga0070706_100445603 3300005467 Bacteria 1205
86 Ga0070706_100806637 3300005467 Bacteria 869
87 Ga0070707_100033444 3300005468 Bacteria 4903
88 Ga0070707_100036097 3300005468 Bacteria 4716
89 Ga0070707_100078935 3300005468 Bacteria 3176
90 Ga0070707_100235917 3300005468 Bacteria 1780
91 Ga0070707_100646612 3300005468 Bacteria 1020
92 Ga0070707_101222591 3300005468 Unclassified 717
93 Ga0070707_101599140 3300005468 Bacteria 619
94 Ga0070698_100000185 3300005471 Bacteria 59098
95 Ga0070698_100003563 3300005471 Bacteria 17109
96 Ga0070698_100072318 3300005471 Bacteria 3456
97 Ga0070698_100110391 3300005471 Bacteria 2715
98 Ga0070698_100123806 3300005471 Unclassified 2543
99 Ga0070698_100219775 3300005471 Bacteria 1834
100 Ga0070698_101413388 3300005471 Bacteria 647
101 Ga0070698_101841561 3300005471 Bacteria 558
102 Ga0070698_102034731 3300005471 Unclassified 528
103 Ga0070699_100024010 3300005518 Bacteria 5254
104 Ga0070699_100047193 3300005518 Bacteria 3726
105 Ga0070699_100112234 3300005518 Bacteria 2394
106 Ga0070699_100340182 3300005518 Bacteria 1350
107 Ga0070699_100490558 3300005518 Bacteria 1115
108 Ga0070699_101553593 3300005518 Bacteria 606
109 Ga0070679_100018909 3300005530 Bacteria 6690
110 Ga0070697_100001284 3300005536 Bacteria 18916
111 Ga0070697_100039980 3300005536 Unclassified 3793
112 Ga0070697_100157480 3300005536 Bacteria 1918
113 Ga0070697_100170574 3300005536 Bacteria 1841
114 Ga0070697_100183852 3300005536 Bacteria 1772
115 Ga0070697_100261624 3300005536 Unclassified 1481
116 Ga0070697_100268952 3300005536 Unclassified 1461
117 Ga0070697_100313308 3300005536 Bacteria 1350
118 Ga0070697_100858286 3300005536 Unclassified 804
119 Ga0070697_100956254 3300005536 Bacteria 761
120 Ga0070697_101012131 3300005536 Unclassified 739
121 Ga0068853_100501539 3300005539 Bacteria 1146
122 Ga0068853_101447909 3300005539 Bacteria 665
123 Ga0070672_100043359 3300005543 Bacteria 3468
124 Ga0070686_100010200 3300005544 Bacteria 5288
125 Ga0070686_100215032 3300005544 Bacteria 1386
126 Ga0070686_100229392 3300005544 Bacteria 1346
127 Ga0070695_100011987 3300005545 Bacteria 5193
128 Ga0070695_100287960 3300005545 Bacteria 1210
129 Ga0070695_100480351 3300005545 Bacteria 958
130 Ga0070695_100509991 3300005545 Bacteria 931
131 Ga0070696_100416340 3300005546 Bacteria 1054
132 Ga0070696_100518833 3300005546 Bacteria 950
133 Ga0070696_100753939 3300005546 Bacteria 798
134 Ga0070693_100106104 3300005547 Unclassified 1720
135 Ga0070693_100106911 3300005547 Bacteria 1714
136 Ga0070665_100201613 3300005548 Bacteria 1990
137 Ga0070665_100422822 3300005548 Bacteria 1341
138 Ga0070704_100042919 3300005549 Unclassified 3132
139 Ga0070704_100257624 3300005549 Bacteria 1436
140 Ga0070704_100270416 3300005549 Bacteria 1404
141 Ga0070704_100297328 3300005549 Bacteria 1344
142 Ga0070704_100376717 3300005549 Bacteria 1205
143 Ga0070704_101723575 3300005549 Bacteria 579
144 Ga0068855_100001388 3300005563 Bacteria 29998
145 Ga0068855_100029996 3300005563 Bacteria 6504
146 Ga0068855_101339518 3300005563 Bacteria 740
147 Ga0068854_100102938 3300005578 Bacteria 2143
148 Ga0068856_100006962 3300005614 Bacteria 11051
149 Ga0068856_100043860 3300005614 Bacteria 4400
150 Ga0068856_100196690 3300005614 Bacteria 2030
151 Ga0070702_100215628 3300005615 Unclassified 1280
152 Ga0070702_100508768 3300005615 Bacteria 886
153 Ga0068852_101377363 3300005616 Bacteria 727
154 Ga0068859_100003398 3300005617 Bacteria 16192
155 Ga0068859_100016848 3300005617 Bacteria 7337
156 Ga0068859_100041785 3300005617 Bacteria 4605
157 Ga0068859_100364329 3300005617 Bacteria 1541
158 Ga0068859_102378430 3300005617 Bacteria 584
159 Ga0068859_102673383 3300005617 Bacteria 549
160 Ga0068859_102981044 3300005617 Bacteria 517
161 Ga0068859_103061150 3300005617 Bacteria 510
162 Ga0068864_100104615 3300005618 Bacteria 2515
163 Ga0068864_100541586 3300005618 Bacteria 1124
164 Ga0068866_10102009 3300005718 Bacteria 1585
165 Ga0068861_100032582 3300005719 Bacteria 3838
166 Ga0068861_100364214 3300005719 Bacteria 1272
167 Ga0068861_100438263 3300005719 Bacteria 1168
168 Ga0068863_102755607 3300005841 Bacteria 500
169 Ga0068858_101689386 3300005842 Unclassified 625
170 Ga0068860_100035752 3300005843 Bacteria 4763
171 Ga0068860_100380762 3300005843 Bacteria 1393
172 Ga0068862_100002704 3300005844 Bacteria 15560
173 Ga0068862_100125509 3300005844 Bacteria 2266
174 Ga0068862_100422834 3300005844 Bacteria 1251
175 Ga0068862_100517599 3300005844 Bacteria 1135
176 Ga0081455_10000289 3300005937 Bacteria 66552
177 Ga0081455_10430423 3300005937 Unclassified 907
178 Ga0070717_10454546 3300006028 Bacteria 1154
179 Ga0070717_10920780 3300006028 Bacteria 796
180 Ga0075365_10080650 3300006038 Bacteria 2203
181 Ga0075432_10389893 3300006058 Bacteria 599
182 Ga0070715_10126009 3300006163 Bacteria 1227
183 Ga0070715_10629584 3300006163 Unclassified 632
184 Ga0070716_100265808 3300006173 Bacteria 1176
185 Ga0070716_101388872 3300006173 Bacteria 570
186 Ga0070712_100252696 3300006175 Bacteria 1409
187 Ga0075362_10211605 3300006177 Bacteria 946
188 Ga0075366_10012012 3300006195 Bacteria 4905
189 Ga0075366_10729550 3300006195 Bacteria 615
190 Ga0097621_100068878 3300006237 Unclassified 2920
191 Ga0097621_100255164 3300006237 Bacteria 1537
192 Ga0068871_100011447 3300006358 Bacteria 6507
193 Ga0068871_100279948 3300006358 Bacteria 1459
194 Ga0075428_101407935 3300006844 Bacteria 732
195 Ga0075431_100168819 3300006847 Unclassified 2249
196 Ga0075433_10003850 3300006852 Bacteria 11620
197 Ga0075433_10057933 3300006852 Bacteria 3387
198 Ga0075433_10262537 3300006852 Bacteria 1531
199 Ga0075433_10341887 3300006852 Bacteria 1323
200 Ga0075433_10624039 3300006852 Bacteria 946
201 Ga0075434_100017012 3300006871 Bacteria 6998
202 Ga0075434_101428093 3300006871 Unclassified 702
203 Ga0075429_100156567 3300006880 Bacteria 1995
204 Ga0075429_101296712 3300006880 Bacteria 635
205 Ga0075436_100617713 3300006914 Bacteria 799
206 Ga0097620_100003397 3300006931 Bacteria 16192
207 Ga0097620_100016849 3300006931 Bacteria 7337
208 Ga0097620_100041787 3300006931 Bacteria 4605
209 Ga0097620_100364322 3300006931 Bacteria 1541
210 Ga0097620_102379154 3300006931 Bacteria 584
211 Ga0097620_102673093 3300006931 Bacteria 549
212 Ga0097620_102981027 3300006931 Bacteria 517
213 Ga0097620_103060718 3300006931 Bacteria 510
214 Ga0075435_100508028 3300007076 Bacteria 1042
215 Ga0075435_101250528 3300007076 Bacteria 650
216 Ga0099794_10377083 3300007265 Bacteria 740
217 Ga0099795_10163029 3300007788 Bacteria 921
218 Ga0105240_10024042 3300009093 Bacteria 8046
219 Ga0105240_10606136 3300009093 Bacteria 1205
220 Ga0105240_11575823 3300009093 Bacteria 688
221 Ga0111539_10023344 3300009094 Bacteria 7599
222 Ga0105245_10110986 3300009098 Unclassified 2550
223 Ga0105245_10610978 3300009098 Bacteria 1118
224 Ga0105247_10029799 3300009101 Unclassified 3308
225 Ga0105247_10042266 3300009101 Bacteria 2791
226 Ga0105247_11019770 3300009101 Unclassified 647
227 Ga0105247_11804235 3300009101 Unclassified 509
228 Ga0114129_10000373 3300009147 Bacteria 52145
229 Ga0114129_10026896 3300009147 Bacteria 8144
230 Ga0114129_10065207 3300009147 Bacteria 5083
231 Ga0114129_10358913 3300009147 Bacteria 1929
232 Ga0114129_11794930 3300009147 Bacteria 746
233 Ga0105243_11033213 3300009148 Bacteria 826
234 Ga0105241_11764511 3300009174 Bacteria 603
235 Ga0105242_10900168 3300009176 Bacteria 885
236 Ga0105242_11100938 3300009176 Bacteria 808
237 Ga0105242_11408330 3300009176 Bacteria 725
238 Ga0105248_10073690 3300009177 Bacteria 3837
239 Ga0105248_10177485 3300009177 Bacteria 2400
240 Ga0105248_10733475 3300009177 Bacteria 1115
241 Ga0105248_11937048 3300009177 Bacteria 669
242 Ga0105237_10297780 3300009545 Bacteria 1616
243 Ga0105249_10190044 3300009553 Bacteria 2004
244 Ga0105249_10513510 3300009553 Unclassified 1245
245 Ga0105249_10612782 3300009553 Bacteria 1144
246 Ga0105249_11112122 3300009553 Bacteria 860
247 Ga0105246_11165777 3300011119 Bacteria 707
248 Ga0157327_1038906 3300012512 Bacteria 630
249 Ga0157371_10016401 3300013102 Bacteria 5529
250 Ga0157370_10036086 3300013104 Bacteria 4800
251 Ga0157370_10068249 3300013104 Bacteria 3360
252 Ga0157370_11208517 3300013104 Bacteria 682
253 Ga0157374_10157230 3300013296 Unclassified 2213
254 Ga0157378_10001895 3300013297 Bacteria 18777
255 Ga0157378_10143457 3300013297 Bacteria 2219
256 Ga0157378_10228365 3300013297 Bacteria 1772
257 Ga0157378_11857027 3300013297 Unclassified 651
258 Ga0163162_10270383 3300013306 Bacteria 1831
259 Ga0163162_12191632 3300013306 Bacteria 634
260 Ga0163162_13165098 3300013306 Unclassified 528
261 Ga0157372_10080800 3300013307 Bacteria 3679
262 Ga0157375_12109787 3300013308 Unclassified 671
263 Ga0157380_10179764 3300014326 Bacteria 1857
264 Ga0157380_10328880 3300014326 Unclassified 1420
265 Ga0157380_10933849 3300014326 Bacteria 896
266 Ga0157380_11245969 3300014326 Bacteria 789
267 Ga0157380_13520121 3300014326 Bacteria 502
268 Ga0157377_10225658 3300014745 Bacteria 1201
269 Ga0209758_1060078 3300025297 Bacteria 1261
270 Ga0207653_10096988 3300025885 Bacteria 1039
271 Ga0207653_10185986 3300025885 Bacteria 779
272 Ga0207642_10141540 3300025899 Bacteria 1269
273 Ga0207710_10070482 3300025900 Bacteria 1602
274 Ga0207699_11321126 3300025906 Bacteria 534
275 Ga0207645_10008540 3300025907 Bacteria 7137
276 Ga0207705_10018074 3300025909 Bacteria 5042
277 Ga0207684_10000028 3300025910 Bacteria 306450
278 Ga0207684_10001522 3300025910 Bacteria 24851
279 Ga0207684_10004832 3300025910 Bacteria 12610
280 Ga0207684_10097207 3300025910 Unclassified 2514
281 Ga0207684_10120776 3300025910 Bacteria 2246
282 Ga0207684_10364185 3300025910 Archaea 1244
283 Ga0207654_10884146 3300025911 Unclassified 647
284 Ga0207707_10062472 3300025912 Bacteria 3241
285 Ga0207707_10787932 3300025912 Bacteria 793
286 Ga0207695_10085478 3300025913 Bacteria 3183
287 Ga0207663_10223516 3300025916 Unclassified 1371
288 Ga0207660_10583320 3300025917 Bacteria 910
289 Ga0207657_10105791 3300025919 Bacteria 2329
290 Ga0207652_10012328 3300025921 Bacteria 6907
291 Ga0207646_10064010 3300025922 Bacteria 3283
292 Ga0207646_10100740 3300025922 Bacteria 2589
293 Ga0207646_10106335 3300025922 Bacteria 2517
294 Ga0207646_10187864 3300025922 Bacteria 1866
295 Ga0207646_10235634 3300025922 Bacteria 1654
296 Ga0207646_10338113 3300025922 Bacteria 1360
297 Ga0207646_10370679 3300025922 Bacteria 1294
298 Ga0207681_10073424 3300025923 Bacteria 2393
299 Ga0207681_10721124 3300025923 Unclassified 830
300 Ga0207659_10398519 3300025926 Unclassified 1151
301 Ga0207659_10418226 3300025926 Unclassified 1124
302 Ga0207659_10807845 3300025926 Bacteria 806
303 Ga0207659_11779112 3300025926 Bacteria 524
304 Ga0207700_10212696 3300025928 Unclassified 1636
305 Ga0207706_10050575 3300025933 Bacteria 3672
306 Ga0207706_10053360 3300025933 Bacteria 3569
307 Ga0207706_11650470 3300025933 Unclassified 518
308 Ga0207686_10064184 3300025934 Bacteria 2338
309 Ga0207670_10000834 3300025936 Bacteria 16145
310 Ga0207670_11468228 3300025936 Bacteria 579
311 Ga0207665_11076069 3300025939 Unclassified 641
312 Ga0207691_10066734 3300025940 Bacteria 3254
313 Ga0207711_10052212 3300025941 Bacteria 3503
314 Ga0207711_10137034 3300025941 Bacteria 2199
315 Ga0207711_11033611 3300025941 Bacteria 762
316 Ga0207667_10013301 3300025949 Bacteria 9425
317 Ga0207667_10302878 3300025949 Bacteria 1633
318 Ga0207667_11545981 3300025949 Bacteria 633
319 Ga0207651_10104908 3300025960 Bacteria 2107
320 Ga0207712_10377106 3300025961 Bacteria 1186
321 Ga0207712_11135088 3300025961 Bacteria 696
322 Ga0207668_10399011 3300025972 Unclassified 1162
323 Ga0207640_10082488 3300025981 Bacteria 2202
324 Ga0207658_12056438 3300025986 Bacteria 519
325 Ga0207677_11404369 3300026023 Unclassified 643
326 Ga0207639_11623971 3300026041 Unclassified 606
327 Ga0207678_11419913 3300026067 Bacteria 613
328 Ga0207708_11250566 3300026075 Bacteria 650
329 Ga0207702_10122051 3300026078 Bacteria 2333
330 Ga0207702_10150461 3300026078 Bacteria 2117
331 Ga0207641_11517850 3300026088 Bacteria 672
332 Ga0207648_11051657 3300026089 Bacteria 763
333 Ga0207648_11798281 3300026089 Bacteria 574
334 Ga0207676_12195151 3300026095 Unclassified 550
335 Ga0207676_12240839 3300026095 Unclassified 544
336 Ga0207674_10286460 3300026116 Bacteria 1596
337 Ga0207675_100005692 3300026118 Bacteria 11926
338 Ga0207675_100397628 3300026118 Bacteria 1357
339 Ga0207675_100425835 3300026118 Bacteria 1311
340 Ga0207675_100484903 3300026118 Bacteria 1229
341 Ga0207683_11622521 3300026121 Bacteria 596
342 Ga0207698_11504704 3300026142 Bacteria 688
343 Ga0207428_10018643 3300027907 Bacteria 5924
344 Ga0268266_10204155 3300028379 Bacteria 1810
345 Ga0268266_11085511 3300028379 Bacteria 774
346 Ga0268265_10018894 3300028380 Bacteria 4783
347 Ga0268265_10105694 3300028380 Bacteria 2285
348 Ga0268265_11554323 3300028380 Bacteria 666
349 Ga0268265_12248584 3300028380 Unclassified 552
350 Ga0268264_10074401 3300028381 Bacteria 2885
351 Ga0268264_10110294 3300028381 Bacteria 2409
352 Ga0265334_10118842 3300028573 Bacteria 946
353 Ga0265338_10111608 3300028800 Bacteria 2200
354 Ga0265338_10223303 3300028800 Bacteria 1406
355 Ga0265330_10019350 3300031235 Bacteria 3121
356 Ga0265325_10002344 3300031241 Bacteria 12818
357 Ga0265325_10026511 3300031241 Bacteria 3138
358 Ga0265325_10086598 3300031241 Bacteria 1550
359 Ga0265340_10011936 3300031247 Bacteria 4599
360 Ga0265339_10004696 3300031249 Bacteria 9271
361 Ga0265339_10161736 3300031249 Bacteria 1126
362 Ga0265339_10359383 3300031249 Bacteria 685
363 Ga0265331_10054558 3300031250 Bacteria 1903
364 Ga0265316_10791138 3300031344 Unclassified 665
365 Ga0307408_100312430 3300031548 Bacteria 1321
366 Ga0307408_100436310 3300031548 Bacteria 1133
367 Ga0265313_10091102 3300031595 Bacteria 1369
368 Ga0265313_10171912 3300031595 Bacteria 915
369 Ga0265314_10671340 3300031711 Bacteria 527
370 Ga0265342_10151148 3300031712 Bacteria 1289
371 Ga0307413_10039657 3300031824 Bacteria 2741
372 Ga0307413_10076628 3300031824 Bacteria 2126
373 Ga0307410_10169785 3300031852 Bacteria 1642
374 Ga0307406_10935470 3300031901 Bacteria 740
375 Ga0307407_10080584 3300031903 Bacteria 1968
376 Ga0307412_11352759 3300031911 Bacteria 643
377 Ga0307409_100079662 3300031995 Bacteria 2640
378 Ga0307409_100586482 3300031995 Bacteria 1100
379 Ga0307416_103167185 3300032002 Bacteria 550
380 Ga0307414_10188611 3300032004 Bacteria 1666
381 Ga0307411_10007362 3300032005 Bacteria 5598
382 Ga0307411_11086477 3300032005 Bacteria 720
383 Ga0307415_102048961 3300032126 Bacteria 558
384 Ga0307415_102062271 3300032126 Bacteria 556
385 Ga0373939_0373587 3300035114 Bacteria 585
386 Ga0373943_0437394 3300035170 Unclassified 759
387 Ga0373946_0057227 3300035171 Bacteria 1649
388 Ga0373946_0411329 3300035171 Bacteria 684
389 Ga0373924_0139655 3300035410 Bacteria 1057
390 Ga0373935_0122774 3300035692 Unclassified 1737
391 Ga0373947_0066280 3300035725 Bacteria 2204
392 Ga0373947_1124150 3300035725 Bacteria 535
393 Ga0373937_0087468 3300036401 Bacteria 2884
394 Ga0373937_0873408 3300036401 Bacteria 848
395 Ga0373925_0648089 3300037068 Unclassified 870
396 Ga0395905_0314502 3300037471 Unclassified 1455
397 Ga0395901_1420131 3300038443 Unclassified 652
398 Ga0436360_0716602 3300039438 Unclassified 507
399 Ga0436363_0147995 3300039450 Unclassified 515
400 Ga0439436_0031282 3300041404 Bacteria 1545
401 Ga0439436_0091080 3300041404 Unclassified 849
402 Ga0439439_0012741 3300041406 Bacteria 2035
403 Ga0439466_0211977 3300041411 Bacteria 588
404 Ga0451802_2178283 3300041460 Unclassified 980
405 Ga0451833_0429582 3300041491 Bacteria 515
406 Ga0451855_1871194 3300041511 Unclassified 678
407 Ga0451853_3665323 3300041512 Bacteria 623
408 Ga0439431_0225595 3300041997 Bacteria 551
409 Ga0439442_023198 3300042002 Bacteria 1289
410 Ga0439451_092837 3300042009 Unclassified 609
411 Ga0439457_040169 3300042014 Bacteria 1043
412 Ga0439462_0117104 3300042015 Unclassified 740
413 Ga0450890_034339 3300042127 Archaea 732
414 Ga0439446_0334396 3300042156 Bacteria 537
415 Ga0439444_0192964 3300042437 Bacteria 511
416 Ga0439464_0260747 3300042439 Bacteria 561
417 Ga0451576_0293366 3300045051 Bacteria 1700
418 Ga0451576_0604074 3300045051 Bacteria 1153
419 Ga0495580_0250266 3300046472 Bacteria 1213
420 Ga0495584_0177456 3300046491 Bacteria 1083
421 Ga0495663_0077139 3300046525 Bacteria 1068
422 Ga0495586_0581217 3300046535 Bacteria 647
423 Ga0495645_0171519 3300046543 Bacteria 1493
424 Ga0495656_0129424 3300046615 Bacteria 1200
425 Ga0495599_0505388 3300046678 Bacteria 711
426 Ga0495636_0000475 3300047318 Bacteria 14776
427 Ga0495672_0038034 3300047320 Bacteria 2939
428 Ga0495685_034935 3300047447 Bacteria 1727
429 Ga0495593_0201132 3300047673 Unclassified 1001
430 Ga0496102_0699786 3300048905 Bacteria 936
431 Ga0496111_0137898 3300048914 Bacteria 1807
432 Ga0496115_0930267 3300048918 Bacteria 669
433 Ga0501032_0896889 3300049569 Bacteria 558
434 Ga0501047_0336587 3300049581 Bacteria 1347
435 Ga0501068_0325484 3300049584 Bacteria 986
436 Ga0501069_0348824 3300049585 Bacteria 872
437 Ga0501070_0742763 3300049586 Bacteria 774
438 Ga0501072_0235662 3300049588 Bacteria 1458
439 Ga0501073_0755986 3300049589 Bacteria 670
440 Ga0501074_0258346 3300049590 Bacteria 1239
441 Ga0501076_1353838 3300049592 Bacteria 585
442 Ga0501239_011490 3300049672 Bacteria 990
443 Ga0501080_1872414 3300049742 Bacteria 503
444 Ga0501083_0334669 3300049744 Bacteria 984
445 Ga0501035_0110367 3300049822 Bacteria 2410
446 Ga0501044_0387715 3300049823 Bacteria 1311
447 nmdc:mga03683_457239_c1 3300050489 Bacteria 615
448 nmdc:mga0yw44_215784_c1 3300050492 Bacteria 1270
449 nmdc:mga0yw44_325740_c1 3300050492 Bacteria 1032
450 nmdc:mga0k408_44867_c1 3300050493 Bacteria 2550
451 nmdc:mga05p37_332_c1 3300050507 Bacteria 50703
452 nmdc:mga05p37_43906_c1 3300050507 Bacteria 5499
453 nmdc:mga05p37_61414_c1 3300050507 Bacteria 4626
454 nmdc:mga09592_1359106_c1 3300050508 Bacteria 582
455 nmdc:mga09592_523541_c1 3300050508 Bacteria 1020
456 nmdc:mga06r32_1070920_c1 3300050510 Unclassified 756
457 nmdc:mga06r32_1462691_c1 3300050510 Bacteria 624
458 nmdc:mga08y16_183562_c1 3300050511 Bacteria 2171
459 nmdc:mga08y16_8423_c1 3300050511 Bacteria 10794
460 nmdc:mga0n895_2154355_c1 3300050512 Bacteria 513
461 nmdc:mga0n895_507756_c1 3300050512 Unclassified 1214
462 nmdc:mga0n895_64263_c1 3300050512 Bacteria 3630
463 nmdc:mga0rr50_652538_c1 3300050513 Bacteria 898
464 nmdc:mga08x19_184281_c1 3300050514 Bacteria 1426
465 nmdc:mga08x19_573808_c1 3300050514 Bacteria 799
466 nmdc:mga0a205_11180_c1 3300050515 Bacteria 8261
467 nmdc:mga0a205_137193_c1 3300050515 Bacteria 2347
468 nmdc:mga0a205_150281_c1 3300050515 Bacteria 2229
469 nmdc:mga0a205_433273_c1 3300050515 Bacteria 1176
470 nmdc:mga0a205_68051_c2 3300050515 Bacteria 2209
471 nmdc:mga0a205_971002_c1 3300050515 Unclassified 696
472 Ga0495619_0345152 3300053085 Bacteria 1030
473 Ga0500583_0448929 3300053092 Bacteria 612
474 Ga0500641_0263729 3300053096 Unclassified 719
475 Ga0500617_191282 3300053124 Bacteria 761
476 Ga0500621_268249 3300053126 Unclassified 563
477 Ga0500642_0380500 3300053130 Bacteria 620
478 Ga0500658_0037047 3300053134 Bacteria 1938
479 Ga0500588_0003173 3300053146 Bacteria 3440
480 Ga0500588_0152102 3300053146 Bacteria 837
481 Ga0500616_0000271 3300053153 Bacteria 77556
482 Ga0500656_003036 3300053732 Bacteria 1548
483 Ga0530510_0887655 3300061734 Bacteria 681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_11033213 Ga0105243_110332131 43
2 3300025907 Ga0207645_10008540 Ga0207645_1000854010 44
3 3300028380 Ga0268265_12248584 Ga0268265_122485842 44
4 iso_pu_bacteria 2643221695 2644529697 46
5 3300049588 Ga0501072_0235662 Ga0501072_0235662_807_950 47
6 3300005340 Ga0070689_100000014 Ga0070689_100000014163 48
7 3300005365 Ga0070688_100734318 Ga0070688_1007343182 48
8 3300005434 Ga0070709_11235160 Ga0070709_112351601 48
9 3300005445 Ga0070708_100507158 Ga0070708_1005071581 48
10 3300005445 Ga0070708_100564557 Ga0070708_1005645573 48
11 3300005467 Ga0070706_100001789 Ga0070706_1000017898 48
12 3300005468 Ga0070707_100646612 Ga0070707_1006466121 48
13 3300005471 Ga0070698_100000185 Ga0070698_10000018529 48
14 3300005471 Ga0070698_102034731 Ga0070698_1020347311 48
15 3300005536 Ga0070697_100001284 Ga0070697_10000128417 48
16 3300005536 Ga0070697_101012131 Ga0070697_1010121312 48
17 3300005544 Ga0070686_100229392 Ga0070686_1002293922 48
18 3300006871 Ga0075434_101428093 Ga0075434_1014280932 48
19 3300009174 Ga0105241_11764511 Ga0105241_117645111 48
20 3300009545 Ga0105237_10297780 Ga0105237_102977803 48
21 3300013307 Ga0157372_10080800 Ga0157372_100808005 48
22 3300025906 Ga0207699_11321126 Ga0207699_113211262 48
23 3300025910 Ga0207684_10001522 Ga0207684_1000152217 48
24 3300025911 Ga0207654_10884146 Ga0207654_108841462 48
25 3300025922 Ga0207646_10235634 Ga0207646_102356342 48
26 3300025936 Ga0207670_10000834 Ga0207670_100008348 48
27 3300025939 Ga0207665_11076069 Ga0207665_110760692 48
28 3300026095 Ga0207676_12240839 Ga0207676_122408391 48
29 3300035171 Ga0373946_0411329 Ga0373946_0411329_442_588 48
30 3300035725 Ga0373947_1124150 Ga0373947_1124150_89_235 48
31 3300039450 Ga0436363_0147995 Ga0436363_0147995_138_284 48
32 3300003323 rootH1_10299069 rootH1_102990692 49
33 3300003911 JGI25405J52794_10034903 JGI25405J52794_100349033 49
34 3300005290 Ga0065712_10347866 Ga0065712_103478662 49
35 3300005293 Ga0065715_10093668 Ga0065715_100936684 49
36 3300005295 Ga0065707_10267798 Ga0065707_102677981 49
37 3300005295 Ga0065707_10511463 Ga0065707_105114631 49
38 3300005295 Ga0065707_10572829 Ga0065707_105728292 49
39 3300005327 Ga0070658_10003312 Ga0070658_1000331212 49
40 3300005328 Ga0070676_10154187 Ga0070676_101541872 49
41 3300005328 Ga0070676_10494936 Ga0070676_104949362 49
42 3300005330 Ga0070690_100209300 Ga0070690_1002093003 49
43 3300005330 Ga0070690_100294230 Ga0070690_1002942302 49
44 3300005331 Ga0070670_100716934 Ga0070670_1007169341 49
45 3300005334 Ga0068869_102161118 Ga0068869_1021611182 49
46 3300005336 Ga0070680_100009958 Ga0070680_1000099587 49
47 3300005338 Ga0068868_100105601 Ga0068868_1001056012 49
48 3300005338 Ga0068868_100114033 Ga0068868_1001140332 49
49 3300005339 Ga0070660_100090874 Ga0070660_1000908741 49
50 3300005339 Ga0070660_101942718 Ga0070660_1019427181 49
51 3300005340 Ga0070689_101592639 Ga0070689_1015926391 49
52 3300005345 Ga0070692_10963352 Ga0070692_109633521 49
53 3300005347 Ga0070668_100041306 Ga0070668_1000413068 49
54 3300005347 Ga0070668_100254219 Ga0070668_1002542192 49
55 3300005353 Ga0070669_100118487 Ga0070669_1001184873 49
56 3300005353 Ga0070669_100218356 Ga0070669_1002183563 49
57 3300005353 Ga0070669_101377380 Ga0070669_1013773801 49
58 3300005354 Ga0070675_100501433 Ga0070675_1005014332 49
59 3300005354 Ga0070675_100507863 Ga0070675_1005078632 49
60 3300005354 Ga0070675_102130871 Ga0070675_1021308712 49
61 3300005356 Ga0070674_101976790 Ga0070674_1019767902 49
62 3300005364 Ga0070673_101742592 Ga0070673_1017425921 49
63 3300005367 Ga0070667_100590831 Ga0070667_1005908312 49
64 3300005367 Ga0070667_101076704 Ga0070667_1010767041 49
65 3300005406 Ga0070703_10121195 Ga0070703_101211951 49
66 3300005434 Ga0070709_11644522 Ga0070709_116445222 49
67 3300005435 Ga0070714_100323162 Ga0070714_1003231622 49
68 3300005435 Ga0070714_100334676 Ga0070714_1003346762 49
69 3300005435 Ga0070714_101041612 Ga0070714_1010416122 49
70 3300005436 Ga0070713_100215134 Ga0070713_1002151341 49
71 3300005438 Ga0070701_10317307 Ga0070701_103173072 49
72 3300005438 Ga0070701_11358961 Ga0070701_113589612 49
73 3300005439 Ga0070711_100265828 Ga0070711_1002658282 49
74 3300005439 Ga0070711_101288567 Ga0070711_1012885672 49
75 3300005440 Ga0070705_100187461 Ga0070705_1001874612 49
76 3300005440 Ga0070705_100295609 Ga0070705_1002956093 49
77 3300005440 Ga0070705_100476628 Ga0070705_1004766282 49
78 3300005440 Ga0070705_100652313 Ga0070705_1006523132 49
79 3300005440 Ga0070705_100672719 Ga0070705_1006727192 49
80 3300005440 Ga0070705_101747570 Ga0070705_1017475701 49
81 3300005444 Ga0070694_100043322 Ga0070694_1000433222 49
82 3300005444 Ga0070694_101747017 Ga0070694_1017470171 49
83 3300005445 Ga0070708_100053117 Ga0070708_1000531173 49
84 3300005445 Ga0070708_100203263 Ga0070708_1002032631 49
85 3300005445 Ga0070708_100733137 Ga0070708_1007331371 49
86 3300005445 Ga0070708_101633564 Ga0070708_1016335641 49
87 3300005455 Ga0070663_100563044 Ga0070663_1005630441 49
88 3300005457 Ga0070662_100050804 Ga0070662_1000508042 49
89 3300005457 Ga0070662_100057821 Ga0070662_1000578212 49
90 3300005458 Ga0070681_10053889 Ga0070681_100538894 49
91 3300005459 Ga0068867_100434610 Ga0068867_1004346102 49
92 3300005459 Ga0068867_101710096 Ga0068867_1017100962 49
93 3300005467 Ga0070706_100000012 Ga0070706_10000001210 49
94 3300005467 Ga0070706_100023631 Ga0070706_1000236312 49
95 3300005467 Ga0070706_100037779 Ga0070706_1000377793 49
96 3300005467 Ga0070706_100143344 Ga0070706_1001433442 49
97 3300005467 Ga0070706_100429457 Ga0070706_1004294572 49
98 3300005467 Ga0070706_100445603 Ga0070706_1004456033 49
99 3300005467 Ga0070706_100806637 Ga0070706_1008066372 49
100 3300005468 Ga0070707_100033444 Ga0070707_1000334445 49
101 3300005468 Ga0070707_100036097 Ga0070707_1000360973 49
102 3300005468 Ga0070707_100078935 Ga0070707_1000789353 49
103 3300005468 Ga0070707_100235917 Ga0070707_1002359172 49
104 3300005468 Ga0070707_101599140 Ga0070707_1015991402 49
105 3300005471 Ga0070698_100003563 Ga0070698_1000035639 49
106 3300005471 Ga0070698_100072318 Ga0070698_1000723183 49
107 3300005471 Ga0070698_100110391 Ga0070698_1001103912 49
108 3300005471 Ga0070698_101413388 Ga0070698_1014133882 49
109 3300005471 Ga0070698_101841561 Ga0070698_1018415611 49
110 3300005518 Ga0070699_100024010 Ga0070699_1000240106 49
111 3300005518 Ga0070699_100047193 Ga0070699_1000471934 49
112 3300005518 Ga0070699_100340182 Ga0070699_1003401822 49
113 3300005518 Ga0070699_100490558 Ga0070699_1004905582 49
114 3300005530 Ga0070679_100018909 Ga0070679_1000189094 49
115 3300005536 Ga0070697_100157480 Ga0070697_1001574802 49
116 3300005536 Ga0070697_100170574 Ga0070697_1001705742 49
117 3300005536 Ga0070697_100183852 Ga0070697_1001838522 49
118 3300005536 Ga0070697_100261624 Ga0070697_1002616242 49
119 3300005536 Ga0070697_100268952 Ga0070697_1002689522 49
120 3300005536 Ga0070697_100313308 Ga0070697_1003133082 49
121 3300005536 Ga0070697_100858286 Ga0070697_1008582862 49
122 3300005536 Ga0070697_100956254 Ga0070697_1009562541 49
123 3300005539 Ga0068853_100501539 Ga0068853_1005015392 49
124 3300005539 Ga0068853_101447909 Ga0068853_1014479092 49
125 3300005544 Ga0070686_100010200 Ga0070686_1000102005 49
126 3300005544 Ga0070686_100215032 Ga0070686_1002150322 49
127 3300005545 Ga0070695_100011987 Ga0070695_1000119874 49
128 3300005545 Ga0070695_100287960 Ga0070695_1002879601 49
129 3300005546 Ga0070696_100416340 Ga0070696_1004163402 49
130 3300005546 Ga0070696_100518833 Ga0070696_1005188332 49
131 3300005547 Ga0070693_100106104 Ga0070693_1001061041 49
132 3300005547 Ga0070693_100106911 Ga0070693_1001069113 49
133 3300005548 Ga0070665_100201613 Ga0070665_1002016133 49
134 3300005548 Ga0070665_100422822 Ga0070665_1004228222 49
135 3300005549 Ga0070704_100042919 Ga0070704_1000429194 49
136 3300005549 Ga0070704_100257624 Ga0070704_1002576242 49
137 3300005549 Ga0070704_100270416 Ga0070704_1002704163 49
138 3300005549 Ga0070704_100297328 Ga0070704_1002973281 49
139 3300005549 Ga0070704_100376717 Ga0070704_1003767172 49
140 3300005549 Ga0070704_101723575 Ga0070704_1017235752 49
141 3300005563 Ga0068855_100001388 Ga0068855_1000013886 49
142 3300005563 Ga0068855_100029996 Ga0068855_1000299965 49
143 3300005563 Ga0068855_101339518 Ga0068855_1013395183 49
144 3300005578 Ga0068854_100102938 Ga0068854_1001029383 49
145 3300005614 Ga0068856_100006962 Ga0068856_1000069623 49
146 3300005614 Ga0068856_100043860 Ga0068856_1000438605 49
147 3300005614 Ga0068856_100196690 Ga0068856_1001966902 49
148 3300005615 Ga0070702_100508768 Ga0070702_1005087682 49
149 3300005616 Ga0068852_101377363 Ga0068852_1013773632 49
150 3300005617 Ga0068859_100003398 Ga0068859_10000339818 49
151 3300005617 Ga0068859_100016848 Ga0068859_1000168482 49
152 3300005617 Ga0068859_100041785 Ga0068859_1000417852 49
153 3300005617 Ga0068859_100364329 Ga0068859_1003643292 49
154 3300005617 Ga0068859_102378430 Ga0068859_1023784302 49
155 3300005617 Ga0068859_102673383 Ga0068859_1026733831 49
156 3300005617 Ga0068859_102981044 Ga0068859_1029810441 49
157 3300005617 Ga0068859_103061150 Ga0068859_1030611502 49
158 3300005618 Ga0068864_100104615 Ga0068864_1001046153 49
159 3300005618 Ga0068864_100541586 Ga0068864_1005415862 49
160 3300005719 Ga0068861_100032582 Ga0068861_1000325823 49
161 3300005719 Ga0068861_100364214 Ga0068861_1003642142 49
162 3300005719 Ga0068861_100438263 Ga0068861_1004382632 49
163 3300005841 Ga0068863_102755607 Ga0068863_1027556072 49
164 3300005842 Ga0068858_101689386 Ga0068858_1016893862 49
165 3300005843 Ga0068860_100035752 Ga0068860_1000357523 49
166 3300005843 Ga0068860_100380762 Ga0068860_1003807623 49
167 3300005844 Ga0068862_100002704 Ga0068862_10000270417 49
168 3300005844 Ga0068862_100422834 Ga0068862_1004228341 49
169 3300005844 Ga0068862_100517599 Ga0068862_1005175993 49
170 3300005937 Ga0081455_10000289 Ga0081455_1000028947 49
171 3300005937 Ga0081455_10430423 Ga0081455_104304232 49
172 3300006028 Ga0070717_10454546 Ga0070717_104545462 49
173 3300006028 Ga0070717_10920780 Ga0070717_109207802 49
174 3300006038 Ga0075365_10080650 Ga0075365_100806504 49
175 3300006163 Ga0070715_10126009 Ga0070715_101260092 49
176 3300006163 Ga0070715_10629584 Ga0070715_106295842 49
177 3300006173 Ga0070716_100265808 Ga0070716_1002658083 49
178 3300006173 Ga0070716_101388872 Ga0070716_1013888722 49
179 3300006175 Ga0070712_100252696 Ga0070712_1002526962 49
180 3300006844 Ga0075428_101407935 Ga0075428_1014079352 49
181 3300006852 Ga0075433_10003850 Ga0075433_100038504 49
182 3300006852 Ga0075433_10262537 Ga0075433_102625372 49
183 3300006852 Ga0075433_10341887 Ga0075433_103418872 49
184 3300006852 Ga0075433_10624039 Ga0075433_106240392 49
185 3300006871 Ga0075434_100017012 Ga0075434_1000170125 49
186 3300006880 Ga0075429_101296712 Ga0075429_1012967122 49
187 3300006914 Ga0075436_100617713 Ga0075436_1006177131 49
188 3300006931 Ga0097620_100003397 Ga0097620_10000339718 49
189 3300006931 Ga0097620_100016849 Ga0097620_1000168492 49
190 3300006931 Ga0097620_100041787 Ga0097620_1000417872 49
191 3300006931 Ga0097620_100364322 Ga0097620_1003643222 49
192 3300006931 Ga0097620_102379154 Ga0097620_1023791542 49
193 3300006931 Ga0097620_102673093 Ga0097620_1026730932 49
194 3300006931 Ga0097620_102981027 Ga0097620_1029810271 49
195 3300006931 Ga0097620_103060718 Ga0097620_1030607182 49
196 3300007076 Ga0075435_100508028 Ga0075435_1005080282 49
197 3300007265 Ga0099794_10377083 Ga0099794_103770832 49
198 3300007788 Ga0099795_10163029 Ga0099795_101630292 49
199 3300009093 Ga0105240_10024042 Ga0105240_100240426 49
200 3300009093 Ga0105240_10606136 Ga0105240_106061362 49
201 3300009093 Ga0105240_11575823 Ga0105240_115758232 49
202 3300009098 Ga0105245_10110986 Ga0105245_101109862 49
203 3300009098 Ga0105245_10610978 Ga0105245_106109782 49
204 3300009101 Ga0105247_10042266 Ga0105247_100422664 49
205 3300009101 Ga0105247_11019770 Ga0105247_110197702 49
206 3300009147 Ga0114129_10026896 Ga0114129_100268969 49
207 3300009147 Ga0114129_10065207 Ga0114129_100652073 49
208 3300009176 Ga0105242_10900168 Ga0105242_109001682 49
209 3300009176 Ga0105242_11100938 Ga0105242_111009382 49
210 3300009176 Ga0105242_11408330 Ga0105242_114083302 49
211 3300009177 Ga0105248_10073690 Ga0105248_100736904 49
212 3300009177 Ga0105248_10177485 Ga0105248_101774853 49
213 3300009177 Ga0105248_10733475 Ga0105248_107334752 49
214 3300009177 Ga0105248_11937048 Ga0105248_119370482 49
215 3300009553 Ga0105249_10190044 Ga0105249_101900443 49
216 3300009553 Ga0105249_10513510 Ga0105249_105135102 49
217 3300009553 Ga0105249_10612782 Ga0105249_106127822 49
218 3300011119 Ga0105246_11165777 Ga0105246_111657772 49
219 3300012512 Ga0157327_1038906 Ga0157327_10389062 49
220 3300013102 Ga0157371_10016401 Ga0157371_100164015 49
221 3300013104 Ga0157370_10036086 Ga0157370_100360863 49
222 3300013104 Ga0157370_10068249 Ga0157370_100682494 49
223 3300013104 Ga0157370_11208517 Ga0157370_112085171 49
224 3300013296 Ga0157374_10157230 Ga0157374_101572302 49
225 3300013297 Ga0157378_10143457 Ga0157378_101434572 49
226 3300013297 Ga0157378_10228365 Ga0157378_102283653 49
227 3300013306 Ga0163162_10270383 Ga0163162_102703833 49
228 3300013306 Ga0163162_12191632 Ga0163162_121916321 49
229 3300013306 Ga0163162_13165098 Ga0163162_131650982 49
230 3300013308 Ga0157375_12109787 Ga0157375_121097871 49
231 3300014326 Ga0157380_10328880 Ga0157380_103288802 49
232 3300014326 Ga0157380_10933849 Ga0157380_109338492 49
233 3300014326 Ga0157380_13520121 Ga0157380_135201212 49
234 3300014745 Ga0157377_10225658 Ga0157377_102256582 49
235 3300025297 Ga0209758_1060078 Ga0209758_10600783 49
236 3300025885 Ga0207653_10096988 Ga0207653_100969882 49
237 3300025885 Ga0207653_10185986 Ga0207653_101859861 49
238 3300025909 Ga0207705_10018074 Ga0207705_100180745 49
239 3300025910 Ga0207684_10000028 Ga0207684_10000028140 49
240 3300025910 Ga0207684_10004832 Ga0207684_100048325 49
241 3300025910 Ga0207684_10097207 Ga0207684_100972072 49
242 3300025910 Ga0207684_10120776 Ga0207684_101207762 49
243 3300025910 Ga0207684_10364185 Ga0207684_103641852 49
244 3300025912 Ga0207707_10062472 Ga0207707_100624724 49
245 3300025913 Ga0207695_10085478 Ga0207695_100854784 49
246 3300025916 Ga0207663_10223516 Ga0207663_102235162 49
247 3300025917 Ga0207660_10583320 Ga0207660_105833202 49
248 3300025919 Ga0207657_10105791 Ga0207657_101057914 49
249 3300025921 Ga0207652_10012328 Ga0207652_100123286 49
250 3300025922 Ga0207646_10064010 Ga0207646_100640102 49
251 3300025922 Ga0207646_10100740 Ga0207646_101007403 49
252 3300025922 Ga0207646_10106335 Ga0207646_101063353 49
253 3300025922 Ga0207646_10338113 Ga0207646_103381132 49
254 3300025922 Ga0207646_10370679 Ga0207646_103706792 49
255 3300025923 Ga0207681_10073424 Ga0207681_100734242 49
256 3300025926 Ga0207659_10398519 Ga0207659_103985192 49
257 3300025926 Ga0207659_10418226 Ga0207659_104182262 49
258 3300025926 Ga0207659_10807845 Ga0207659_108078452 49
259 3300025926 Ga0207659_11779112 Ga0207659_117791121 49
260 3300025933 Ga0207706_10050575 Ga0207706_100505756 49
261 3300025933 Ga0207706_10053360 Ga0207706_100533602 49
262 3300025933 Ga0207706_11650470 Ga0207706_116504701 49
263 3300025934 Ga0207686_10064184 Ga0207686_100641841 49
264 3300025936 Ga0207670_11468228 Ga0207670_114682282 49
265 3300025941 Ga0207711_10052212 Ga0207711_100522122 49
266 3300025941 Ga0207711_10137034 Ga0207711_101370344 49
267 3300025941 Ga0207711_11033611 Ga0207711_110336112 49
268 3300025949 Ga0207667_10013301 Ga0207667_100133014 49
269 3300025949 Ga0207667_10302878 Ga0207667_103028782 49
270 3300025949 Ga0207667_11545981 Ga0207667_115459812 49
271 3300025960 Ga0207651_10104908 Ga0207651_101049082 49
272 3300025961 Ga0207712_10377106 Ga0207712_103771062 49
273 3300025972 Ga0207668_10399011 Ga0207668_103990113 49
274 3300025981 Ga0207640_10082488 Ga0207640_100824882 49
275 3300025986 Ga0207658_12056438 Ga0207658_120564382 49
276 3300026023 Ga0207677_11404369 Ga0207677_114043692 49
277 3300026041 Ga0207639_11623971 Ga0207639_116239712 49
278 3300026067 Ga0207678_11419913 Ga0207678_114199132 49
279 3300026075 Ga0207708_11250566 Ga0207708_112505662 49
280 3300026078 Ga0207702_10122051 Ga0207702_101220513 49
281 3300026078 Ga0207702_10150461 Ga0207702_101504612 49
282 3300026088 Ga0207641_11517850 Ga0207641_115178502 49
283 3300026089 Ga0207648_11051657 Ga0207648_110516573 49
284 3300026089 Ga0207648_11798281 Ga0207648_117982812 49
285 3300026095 Ga0207676_12195151 Ga0207676_121951512 49
286 3300026116 Ga0207674_10286460 Ga0207674_102864603 49
287 3300026118 Ga0207675_100005692 Ga0207675_1000056929 49
288 3300026118 Ga0207675_100397628 Ga0207675_1003976282 49
289 3300026118 Ga0207675_100425835 Ga0207675_1004258353 49
290 3300026121 Ga0207683_11622521 Ga0207683_116225212 49
291 3300026142 Ga0207698_11504704 Ga0207698_115047042 49
292 3300028379 Ga0268266_10204155 Ga0268266_102041552 49
293 3300028379 Ga0268266_11085511 Ga0268266_110855112 49
294 3300028380 Ga0268265_10018894 Ga0268265_100188942 49
295 3300028380 Ga0268265_11554323 Ga0268265_115543231 49
296 3300028381 Ga0268264_10074401 Ga0268264_100744014 49
297 3300028381 Ga0268264_10110294 Ga0268264_101102943 49
298 3300028573 Ga0265334_10118842 Ga0265334_101188422 49
299 3300028800 Ga0265338_10111608 Ga0265338_101116083 49
300 3300031235 Ga0265330_10019350 Ga0265330_100193504 49
301 3300031241 Ga0265325_10002344 Ga0265325_1000234412 49
302 3300031241 Ga0265325_10026511 Ga0265325_100265114 49
303 3300031247 Ga0265340_10011936 Ga0265340_100119364 49
304 3300031249 Ga0265339_10004696 Ga0265339_100046969 49
305 3300031249 Ga0265339_10359383 Ga0265339_103593832 49
306 3300031548 Ga0307408_100312430 Ga0307408_1003124302 49
307 3300031595 Ga0265313_10091102 Ga0265313_100911021 49
308 3300031711 Ga0265314_10671340 Ga0265314_106713402 49
309 3300031712 Ga0265342_10151148 Ga0265342_101511483 49
310 3300031901 Ga0307406_10935470 Ga0307406_109354701 49
311 3300031911 Ga0307412_11352759 Ga0307412_113527592 49
312 3300032126 Ga0307415_102048961 Ga0307415_1020489612 49
313 3300035114 Ga0373939_0373587 Ga0373939_0373587_12_161 49
314 3300035170 Ga0373943_0437394 Ga0373943_0437394_219_368 49
315 3300035692 Ga0373935_0122774 Ga0373935_0122774_1137_1286 49
316 3300036401 Ga0373937_0087468 Ga0373937_0087468_1268_1417 49
317 3300036401 Ga0373937_0873408 Ga0373937_0873408_268_417 49
318 3300037068 Ga0373925_0648089 Ga0373925_0648089_326_475 49
319 3300037471 Ga0395905_0314502 Ga0395905_0314502_1252_1401 49
320 3300039438 Ga0436360_0716602 Ga0436360_0716602_115_264 49
321 3300041404 Ga0439436_0031282 Ga0439436_0031282_115_264 49
322 3300041404 Ga0439436_0091080 Ga0439436_0091080_409_558 49
323 3300041406 Ga0439439_0012741 Ga0439439_0012741_1820_1969 49
324 3300041411 Ga0439466_0211977 Ga0439466_0211977_119_268 49
325 3300041460 Ga0451802_2178283 Ga0451802_2178283_68_217 49
326 3300041491 Ga0451833_0429582 Ga0451833_0429582_211_360 49
327 3300041511 Ga0451855_1871194 Ga0451855_1871194_492_641 49
328 3300041512 Ga0451853_3665323 Ga0451853_3665323_176_325 49
329 3300041997 Ga0439431_0225595 Ga0439431_0225595_184_333 49
330 3300042002 Ga0439442_023198 Ga0439442_023198_963_1112 49
331 3300042009 Ga0439451_092837 Ga0439451_092837_103_252 49
332 3300042014 Ga0439457_040169 Ga0439457_040169_324_473 49
333 3300042015 Ga0439462_0117104 Ga0439462_0117104_257_406 49
334 3300042127 Ga0450890_034339 Ga0450890_034339_210_359 49
335 3300042156 Ga0439446_0334396 Ga0439446_0334396_371_520 49
336 3300042437 Ga0439444_0192964 Ga0439444_0192964_327_476 49
337 3300042439 Ga0439464_0260747 Ga0439464_0260747_237_386 49
338 3300045051 Ga0451576_0293366 Ga0451576_0293366_590_751 49
339 3300046472 Ga0495580_0250266 Ga0495580_0250266_476_625 49
340 3300046491 Ga0495584_0177456 Ga0495584_0177456_844_993 49
341 3300046525 Ga0495663_0077139 Ga0495663_0077139_101_250 49
342 3300046543 Ga0495645_0171519 Ga0495645_0171519_1028_1177 49
343 3300046615 Ga0495656_0129424 Ga0495656_0129424_948_1097 49
344 3300046678 Ga0495599_0505388 Ga0495599_0505388_422_571 49
345 3300047318 Ga0495636_0000475 Ga0495636_0000475_14004_14153 49
346 3300047320 Ga0495672_0038034 Ga0495672_0038034_652_801 49
347 3300047447 Ga0495685_034935 Ga0495685_034935_1348_1497 49
348 3300048905 Ga0496102_0699786 Ga0496102_0699786_281_430 49
349 3300048918 Ga0496115_0930267 Ga0496115_0930267_382_531 49
350 3300049569 Ga0501032_0896889 Ga0501032_0896889_211_360 49
351 3300049581 Ga0501047_0336587 Ga0501047_0336587_202_351 49
352 3300049584 Ga0501068_0325484 Ga0501068_0325484_228_377 49
353 3300049585 Ga0501069_0348824 Ga0501069_0348824_479_628 49
354 3300049586 Ga0501070_0742763 Ga0501070_0742763_348_497 49
355 3300049590 Ga0501074_0258346 Ga0501074_0258346_1020_1169 49
356 3300049592 Ga0501076_1353838 Ga0501076_1353838_128_277 49
357 3300049744 Ga0501083_0334669 Ga0501083_0334669_157_306 49
358 3300049822 Ga0501035_0110367 Ga0501035_0110367_179_328 49
359 3300049823 Ga0501044_0387715 Ga0501044_0387715_849_998 49
360 3300050492 nmdc:mga0yw44_215784_c1 nmdc:mga0yw44_215784_c1_236_385 49
361 3300050492 nmdc:mga0yw44_325740_c1 nmdc:mga0yw44_325740_c1_328_477 49
362 3300050507 nmdc:mga05p37_43906_c1 nmdc:mga05p37_43906_c1_3785_3934 49
363 3300050507 nmdc:mga05p37_61414_c1 nmdc:mga05p37_61414_c1_4064_4213 49
364 3300050512 nmdc:mga0n895_2154355_c1 nmdc:mga0n895_2154355_c1_129_278 49
365 3300050512 nmdc:mga0n895_507756_c1 nmdc:mga0n895_507756_c1_764_913 49
366 3300050512 nmdc:mga0n895_64263_c1 nmdc:mga0n895_64263_c1_2155_2304 49
367 3300050513 nmdc:mga0rr50_652538_c1 nmdc:mga0rr50_652538_c1_233_382 49
368 3300050514 nmdc:mga08x19_573808_c1 nmdc:mga08x19_573808_c1_613_762 49
369 3300050515 nmdc:mga0a205_11180_c1 nmdc:mga0a205_11180_c1_6719_6868 49
370 3300050515 nmdc:mga0a205_150281_c1 nmdc:mga0a205_150281_c1_1423_1572 49
371 3300050515 nmdc:mga0a205_433273_c1 nmdc:mga0a205_433273_c1_326_475 49
372 3300050515 nmdc:mga0a205_68051_c2 nmdc:mga0a205_68051_c2_1917_2066 49
373 3300053092 Ga0500583_0448929 Ga0500583_0448929_146_295 49
374 3300053096 Ga0500641_0263729 Ga0500641_0263729_31_180 49
375 3300053124 Ga0500617_191282 Ga0500617_191282_339_488 49
376 3300053126 Ga0500621_268249 Ga0500621_268249_25_174 49
377 3300053130 Ga0500642_0380500 Ga0500642_0380500_157_306 49
378 3300053134 Ga0500658_0037047 Ga0500658_0037047_1607_1756 49
379 3300053146 Ga0500588_0003173 Ga0500588_0003173_1074_1223 49
380 3300053146 Ga0500588_0152102 Ga0500588_0152102_365_514 49
381 3300053153 Ga0500616_0000271 Ga0500616_0000271_25995_26144 49
382 3300053732 Ga0500656_003036 Ga0500656_003036_900_1049 49
383 3300061734 Ga0530510_0887655 Ga0530510_0887655_173_322 49
384 3300005295 Ga0065707_10067785 Ga0065707_100677852 50
385 3300005295 Ga0065707_10144688 Ga0065707_101446882 50
386 3300005330 Ga0070690_100330943 Ga0070690_1003309431 50
387 3300005353 Ga0070669_100335018 Ga0070669_1003350182 50
388 3300005366 Ga0070659_101614355 Ga0070659_1016143551 50
389 3300005440 Ga0070705_100203655 Ga0070705_1002036553 50
390 3300005445 Ga0070708_100162535 Ga0070708_1001625353 50
391 3300005458 Ga0070681_10919593 Ga0070681_109195931 50
392 3300005467 Ga0070706_100193493 Ga0070706_1001934932 50
393 3300005468 Ga0070707_101222591 Ga0070707_1012225911 50
394 3300005471 Ga0070698_100123806 Ga0070698_1001238062 50
395 3300005471 Ga0070698_100219775 Ga0070698_1002197752 50
396 3300005518 Ga0070699_100112234 Ga0070699_1001122343 50
397 3300005518 Ga0070699_101553593 Ga0070699_1015535932 50
398 3300005536 Ga0070697_100039980 Ga0070697_1000399802 50
399 3300005545 Ga0070695_100480351 Ga0070695_1004803512 50
400 3300005545 Ga0070695_100509991 Ga0070695_1005099912 50
401 3300005615 Ga0070702_100215628 Ga0070702_1002156284 50
402 3300005718 Ga0068866_10102009 Ga0068866_101020092 50
403 3300005844 Ga0068862_100125509 Ga0068862_1001255092 50
404 3300006058 Ga0075432_10389893 Ga0075432_103898932 50
405 3300006177 Ga0075362_10211605 Ga0075362_102116051 50
406 3300006195 Ga0075366_10012012 Ga0075366_100120125 50
407 3300006195 Ga0075366_10729550 Ga0075366_107295502 50
408 3300006237 Ga0097621_100068878 Ga0097621_1000688783 50
409 3300006237 Ga0097621_100255164 Ga0097621_1002551643 50
410 3300006358 Ga0068871_100011447 Ga0068871_1000114474 50
411 3300006358 Ga0068871_100279948 Ga0068871_1002799482 50
412 3300006847 Ga0075431_100168819 Ga0075431_1001688192 50
413 3300006852 Ga0075433_10057933 Ga0075433_100579336 50
414 3300006880 Ga0075429_100156567 Ga0075429_1001565671 50
415 3300007076 Ga0075435_101250528 Ga0075435_1012505282 50
416 3300009094 Ga0111539_10023344 Ga0111539_100233447 50
417 3300009101 Ga0105247_10029799 Ga0105247_100297993 50
418 3300009101 Ga0105247_11804235 Ga0105247_118042352 50
419 3300009147 Ga0114129_10000373 Ga0114129_1000037325 50
420 3300009147 Ga0114129_10358913 Ga0114129_103589132 50
421 3300009147 Ga0114129_11794930 Ga0114129_117949302 50
422 3300009553 Ga0105249_11112122 Ga0105249_111121222 50
423 3300013297 Ga0157378_10001895 Ga0157378_1000189521 50
424 3300013297 Ga0157378_11857027 Ga0157378_118570271 50
425 3300014326 Ga0157380_10179764 Ga0157380_101797642 50
426 3300014326 Ga0157380_11245969 Ga0157380_112459692 50
427 3300025899 Ga0207642_10141540 Ga0207642_101415401 50
428 3300025900 Ga0207710_10070482 Ga0207710_100704822 50
429 3300025912 Ga0207707_10787932 Ga0207707_107879322 50
430 3300025922 Ga0207646_10187864 Ga0207646_101878644 50
431 3300025923 Ga0207681_10721124 Ga0207681_107211242 50
432 3300025961 Ga0207712_11135088 Ga0207712_111350882 50
433 3300026118 Ga0207675_100484903 Ga0207675_1004849032 50
434 3300027907 Ga0207428_10018643 Ga0207428_100186432 50
435 3300028380 Ga0268265_10105694 Ga0268265_101056942 50
436 3300028800 Ga0265338_10223303 Ga0265338_102233033 50
437 3300031241 Ga0265325_10086598 Ga0265325_100865982 50
438 3300031249 Ga0265339_10161736 Ga0265339_101617362 50
439 3300031250 Ga0265331_10054558 Ga0265331_100545582 50
440 3300031344 Ga0265316_10791138 Ga0265316_107911382 50
441 3300031548 Ga0307408_100436310 Ga0307408_1004363102 50
442 3300031595 Ga0265313_10171912 Ga0265313_101719123 50
443 3300031824 Ga0307413_10039657 Ga0307413_100396573 50
444 3300031824 Ga0307413_10076628 Ga0307413_100766283 50
445 3300031852 Ga0307410_10169785 Ga0307410_101697853 50
446 3300031903 Ga0307407_10080584 Ga0307407_100805842 50
447 3300031995 Ga0307409_100079662 Ga0307409_1000796624 50
448 3300031995 Ga0307409_100586482 Ga0307409_1005864822 50
449 3300032002 Ga0307416_103167185 Ga0307416_1031671852 50
450 3300032004 Ga0307414_10188611 Ga0307414_101886112 50
451 3300032005 Ga0307411_10007362 Ga0307411_100073625 50
452 3300032005 Ga0307411_11086477 Ga0307411_110864772 50
453 3300032126 Ga0307415_102062271 Ga0307415_1020622712 50
454 3300035171 Ga0373946_0057227 Ga0373946_0057227_317_469 50
455 3300035410 Ga0373924_0139655 Ga0373924_0139655_225_377 50
456 3300035725 Ga0373947_0066280 Ga0373947_0066280_250_402 50
457 3300038443 Ga0395901_1420131 Ga0395901_1420131_423_575 50
458 3300045051 Ga0451576_0604074 Ga0451576_0604074_703_855 50
459 3300046535 Ga0495586_0581217 Ga0495586_0581217_397_549 50
460 3300047673 Ga0495593_0201132 Ga0495593_0201132_558_710 50
461 3300048914 Ga0496111_0137898 Ga0496111_0137898_229_381 50
462 3300049589 Ga0501073_0755986 Ga0501073_0755986_204_356 50
463 3300049672 Ga0501239_011490 Ga0501239_011490_34_186 50
464 3300049742 Ga0501080_1872414 Ga0501080_1872414_189_341 50
465 3300050489 nmdc:mga03683_457239_c1 nmdc:mga03683_457239_c1_260_412 50
466 3300050493 nmdc:mga0k408_44867_c1 nmdc:mga0k408_44867_c1_1498_1650 50
467 3300050507 nmdc:mga05p37_332_c1 nmdc:mga05p37_332_c1_33409_33561 50
468 3300050508 nmdc:mga09592_1359106_c1 nmdc:mga09592_1359106_c1_39_191 50
469 3300050508 nmdc:mga09592_523541_c1 nmdc:mga09592_523541_c1_778_930 50
470 3300050510 nmdc:mga06r32_1070920_c1 nmdc:mga06r32_1070920_c1_494_646 50
471 3300050510 nmdc:mga06r32_1462691_c1 nmdc:mga06r32_1462691_c1_409_561 50
472 3300050511 nmdc:mga08y16_8423_c1 nmdc:mga08y16_8423_c1_1756_1908 50
473 3300050514 nmdc:mga08x19_184281_c1 nmdc:mga08x19_184281_c1_531_683 50
474 3300050515 nmdc:mga0a205_137193_c1 nmdc:mga0a205_137193_c1_913_1065 50
475 3300053085 Ga0495619_0345152 Ga0495619_0345152_27_179 50
476 3300000532 CNAas_1003700 CNAas_10037002 51
477 3300005328 Ga0070676_11369204 Ga0070676_113692042 51
478 3300005354 Ga0070675_100033388 Ga0070675_1000333884 51
479 3300005543 Ga0070672_100043359 Ga0070672_1000433594 51
480 3300005546 Ga0070696_100753939 Ga0070696_1007539391 51
481 3300025928 Ga0207700_10212696 Ga0207700_102126962 51
482 3300025940 Ga0207691_10066734 Ga0207691_100667343 51
483 3300050511 nmdc:mga08y16_183562_c1 nmdc:mga08y16_183562_c1_403_558 51
484 3300050515 nmdc:mga0a205_971002_c1 nmdc:mga0a205_971002_c1_528_686 51

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k8e-assembly1.cif.gz_A solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. 0.734 2 38
1gcc-assembly1.cif.gz_A solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure 0.7257 2 51
1gcc-assembly1.cif.gz_A solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure 0.6926 2 51
7p4l-assembly1.cif.gz_B crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.6842 1 29
7wq5-assembly1.cif.gz_A crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6741 2 36
ID Description Score Start End Superfamily
af_Q2G1Z8_221_321_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9282 1 13 2.40.50.140
af_P76389_435_515_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9017 1 13 3.30.465.10
2dt8A02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3; 0.823 9 50 3.30.1180.10
af_A0A1D6KJ58_29_91_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7847 2 36 3.30.730.10
af_C0P9B0_100_150_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7811 2 46 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A2V5YM63-F1-model_v4 Uncharacterized protein 1.013 1 39
AF-A0A2V7LIK5-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.009 1 51
AF-A0A3S3V9N4-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.008 1 48
AF-A0A7R7BKA7-F1-model_v4 deleted 1.007 1 48
AF-A0A2V7EQ65-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.007 1 50

Feature Viewer

pLDDT pTM Quality
92.65 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map