F452875

General Info

Members Datasets Scaffolds Average Seq Length
484 282 481 302

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10013296|Ga0065707_100132963
Length 330
Sequence LNGPRCCAWWRDATRASAIDPEKVSQLSGKAVLVTGAGGGIGRDFALAMAAAGASVLVNDIGTSVKGEGSXAGPAQKVADEINKTFEAAGARAVANTDSVAQWESANRIVTNALDAFGRIDVVINNAGILRDRFFFNMSVEEWRAVIDVHLNGSFYVARAAAPHFKSQESGCYIHMTSTSGLIGNLGQANYSAAKLGVAGLSKSIALDMAKFRVRSNCISPFAWSRMIGSIPTETDDQKARVEKLKSMETAKIAPLAVYLASDHGKEVSGQIFAVRANEIFLMGQSRPLRSVHRAEGWTPETIGAHAIPALRAHFYPLERSQDVFSWDPL

Samples

Sample ID Description Type Environment
1 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
2 2842677519 Variovorax sp. R-72495 Isolate Unclassified
3 2929520902 Variovorax beijingensis 502 Isolate Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
138 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
139 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0.41
Rhizoplane 0.41
Rhizosphere 92.77
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000775 3300003187 Bacteria 25895
2 JGI25406J46586_10022242 3300003203 Bacteria 2531
3 Ga0055536_1004919 3300003781 Bacteria 6658
4 Ga0055540_1020404 3300003792 Bacteria 1752
5 Ga0065707_10002391 3300005295 Bacteria 5639
6 Ga0065707_10013296 3300005295 Bacteria 2863
7 Ga0070690_100001335 3300005330 Bacteria 12819
8 Ga0070677_10099363 3300005333 Bacteria 1280
9 Ga0068869_100002111 3300005334 Bacteria 11951
10 Ga0070680_100001466 3300005336 Bacteria 17116
11 Ga0070680_100052982 3300005336 Bacteria 3311
12 Ga0070682_100007419 3300005337 Bacteria 6185
13 Ga0068868_100007062 3300005338 Bacteria 7982
14 Ga0070689_100001640 3300005340 Bacteria 14310
15 Ga0070689_100040634 3300005340 Bacteria 3567
16 Ga0070687_100000392 3300005343 Bacteria 14882
17 Ga0070692_10012504 3300005345 Bacteria 3930
18 Ga0070692_10017056 3300005345 Bacteria 3465
19 Ga0070669_100021278 3300005353 Bacteria 4636
20 Ga0070669_100101101 3300005353 Bacteria 2175
21 Ga0070675_100113004 3300005354 Bacteria 2300
22 Ga0070675_100374206 3300005354 Bacteria 1267
23 Ga0070703_10006581 3300005406 Bacteria 3257
24 Ga0070701_10001104 3300005438 Bacteria 9860
25 Ga0070705_100000198 3300005440 Bacteria 35654
26 Ga0070705_100007580 3300005440 Bacteria 5346
27 Ga0070705_100118894 3300005440 Bacteria 1703
28 Ga0070705_100262462 3300005440 Bacteria 1219
29 Ga0070700_100000336 3300005441 Bacteria 24375
30 Ga0070700_100000389 3300005441 Bacteria 22607
31 Ga0070694_100003027 3300005444 Bacteria 10010
32 Ga0070694_100007226 3300005444 Bacteria 6762
33 Ga0070694_100056234 3300005444 Bacteria 2672
34 Ga0070681_10000676 3300005458 Bacteria 28267
35 Ga0068867_100000780 3300005459 Bacteria 21510
36 Ga0068867_100024393 3300005459 Bacteria 4333
37 Ga0070707_100178057 3300005468 Bacteria 2073
38 Ga0070698_100063760 3300005471 Bacteria 3715
39 Ga0070699_100070943 3300005518 Bacteria 3029
40 Ga0070699_100143102 3300005518 Bacteria 2113
41 Ga0070679_100012766 3300005530 Bacteria 8037
42 Ga0070672_100344751 3300005543 Bacteria 1269
43 Ga0070686_100001108 3300005544 Bacteria 15487
44 Ga0070695_100000292 3300005545 Bacteria 25201
45 Ga0070695_100003027 3300005545 Bacteria 9794
46 Ga0070695_100184673 3300005545 Bacteria 1480
47 Ga0070696_100000489 3300005546 Bacteria 24889
48 Ga0070696_100015085 3300005546 Bacteria 5188
49 Ga0070696_100093320 3300005546 Bacteria 2146
50 Ga0070696_100100523 3300005546 Bacteria 2072
51 Ga0070696_100222879 3300005546 Bacteria 1415
52 Ga0070693_100000126 3300005547 Bacteria 34382
53 Ga0070693_100314639 3300005547 Bacteria 1060
54 Ga0070704_100001261 3300005549 Bacteria 13342
55 Ga0070704_100002806 3300005549 Bacteria 9865
56 Ga0070704_100041955 3300005549 Bacteria 3162
57 Ga0070704_100065499 3300005549 Bacteria 2616
58 Ga0070704_100213573 3300005549 Bacteria 1565
59 Ga0068855_100026989 3300005563 Bacteria 6871
60 Ga0068857_100409470 3300005577 Bacteria 1263
61 Ga0068854_100005630 3300005578 Bacteria 7912
62 Ga0068854_100013930 3300005578 Bacteria 5289
63 Ga0068856_100031945 3300005614 Bacteria 5151
64 Ga0068856_100132085 3300005614 Bacteria 2502
65 Ga0070702_100001105 3300005615 Bacteria 10801
66 Ga0070702_100090832 3300005615 Bacteria 1852
67 Ga0068852_100095314 3300005616 Bacteria 2672
68 Ga0068852_100489358 3300005616 Bacteria 1223
69 Ga0068859_100010604 3300005617 Bacteria 9274
70 Ga0068859_100288531 3300005617 Bacteria 1734
71 Ga0068864_100037077 3300005618 Bacteria 4159
72 Ga0068866_10003537 3300005718 Bacteria 6399
73 Ga0068866_10006743 3300005718 Bacteria 4787
74 Ga0068861_100000316 3300005719 Bacteria 27077
75 Ga0068861_100006140 3300005719 Bacteria 8174
76 Ga0068870_10061354 3300005840 Bacteria 2021
77 Ga0068863_100002399 3300005841 Bacteria 18633
78 Ga0068863_100021294 3300005841 Bacteria 6188
79 Ga0068863_100106776 3300005841 Bacteria 2664
80 Ga0068863_100497046 3300005841 Bacteria 1201
81 Ga0068858_100018197 3300005842 Bacteria 6579
82 Ga0068860_100008921 3300005843 Bacteria 9991
83 Ga0068862_100002813 3300005844 Bacteria 15253
84 Ga0068862_100006610 3300005844 Bacteria 9617
85 Ga0081539_10006772 3300005985 Bacteria 10754
86 Ga0075362_10001585 3300006177 Bacteria 7366
87 Ga0075366_10025280 3300006195 Bacteria 3467
88 Ga0097621_100002057 3300006237 Bacteria 13759
89 Ga0075370_10003457 3300006353 Bacteria 7524
90 Ga0068871_100004146 3300006358 Bacteria 10029
91 Ga0075428_100001001 3300006844 Bacteria 29943
92 Ga0075428_100033666 3300006844 Bacteria 5656
93 Ga0075428_100214360 3300006844 Bacteria 2080
94 Ga0075428_100427312 3300006844 Bacteria 1419
95 Ga0075430_100000318 3300006846 Bacteria 34303
96 Ga0075430_100009635 3300006846 Bacteria 8163
97 Ga0075430_100118227 3300006846 Bacteria 2209
98 Ga0075430_100241071 3300006846 Bacteria 1498
99 Ga0075431_100050300 3300006847 Bacteria 4297
100 Ga0075431_100426171 3300006847 Bacteria 1325
101 Ga0075433_10000441 3300006852 Bacteria 26831
102 Ga0075434_100013244 3300006871 Bacteria 7838
103 Ga0075434_100022149 3300006871 Bacteria 6189
104 Ga0075434_100031718 3300006871 Bacteria 5210
105 Ga0075429_100000363 3300006880 Bacteria 33387
106 Ga0075429_100019170 3300006880 Bacteria 5927
107 Ga0075429_100193940 3300006880 Bacteria 1779
108 Ga0075429_100370617 3300006880 Bacteria 1254
109 Ga0068865_100001740 3300006881 Bacteria 12775
110 Ga0068865_100003157 3300006881 Bacteria 9864
111 Ga0075436_100001646 3300006914 Bacteria 15264
112 Ga0075436_100003099 3300006914 Bacteria 11396
113 Ga0097620_100010604 3300006931 Bacteria 9274
114 Ga0097620_100288550 3300006931 Bacteria 1734
115 Ga0099822_1019647 3300006943 Bacteria 6839
116 Ga0075435_100008938 3300007076 Bacteria 7220
117 Ga0075435_100029975 3300007076 Bacteria 4275
118 Ga0075435_100306769 3300007076 Bacteria 1358
119 Ga0099794_10016869 3300007265 Bacteria 3245
120 Ga0105244_10107821 3300009036 Bacteria 1358
121 Ga0105240_10312357 3300009093 Bacteria 1794
122 Ga0111539_10025413 3300009094 Bacteria 7260
123 Ga0111539_10046079 3300009094 Bacteria 5218
124 Ga0111539_10101418 3300009094 Bacteria 3379
125 Ga0111539_10227637 3300009094 Bacteria 2171
126 Ga0111539_10276391 3300009094 Bacteria 1954
127 Ga0114129_10001363 3300009147 Bacteria 32838
128 Ga0114129_10049369 3300009147 Bacteria 5912
129 Ga0114129_10483905 3300009147 Bacteria 1619
130 Ga0105243_10001362 3300009148 Bacteria 21682
131 Ga0105243_10003557 3300009148 Bacteria 12582
132 Ga0105243_10004111 3300009148 Bacteria 11567
133 Ga0105242_10009425 3300009176 Bacteria 7483
134 Ga0105248_10000080 3300009177 Bacteria 111519
135 Ga0105237_10381542 3300009545 Bacteria 1414
136 Ga0105249_10011474 3300009553 Bacteria 7782
137 Ga0157374_10086939 3300013296 Bacteria 2975
138 Ga0157378_10001643 3300013297 Bacteria 20215
139 Ga0163162_10514382 3300013306 Bacteria 1327
140 Ga0157375_10139409 3300013308 Bacteria 2551
141 Ga0157380_10001588 3300014326 Bacteria 14979
142 Ga0157377_10006333 3300014745 Bacteria 5637
143 Ga0157379_10057756 3300014968 Bacteria 3468
144 Ga0157376_10025135 3300014969 Bacteria 4688
145 Ga0163161_10079405 3300017792 Bacteria 2413
146 Ga0213875_10008932 3300021388 Bacteria 5105
147 Ga0209129_1005606 3300025258 Bacteria 4368
148 Ga0209676_1000173 3300025292 Bacteria 153411
149 Ga0209025_1000122 3300025294 Bacteria 206064
150 Ga0209051_1000282 3300025303 Bacteria 82787
151 Ga0207653_10019749 3300025885 Bacteria 2126
152 Ga0207682_10064255 3300025893 Bacteria 1542
153 Ga0207642_10000598 3300025899 Bacteria 11081
154 Ga0207642_10042479 3300025899 Bacteria 1998
155 Ga0207688_10008796 3300025901 Bacteria 5493
156 Ga0207643_10054465 3300025908 Bacteria 2274
157 Ga0207643_10111980 3300025908 Bacteria 1609
158 Ga0207707_10001702 3300025912 Bacteria 20238
159 Ga0207662_10001169 3300025918 Bacteria 12456
160 Ga0207662_10051326 3300025918 Bacteria 2454
161 Ga0207652_10006354 3300025921 Bacteria 9542
162 Ga0207646_10161258 3300025922 Bacteria 2024
163 Ga0207681_10009570 3300025923 Bacteria 5923
164 Ga0207681_10074228 3300025923 Bacteria 2382
165 Ga0207659_10264597 3300025926 Bacteria 1400
166 Ga0207687_10013680 3300025927 Bacteria 5298
167 Ga0207706_10008024 3300025933 Bacteria 9741
168 Ga0207706_10049025 3300025933 Bacteria 3733
169 Ga0207686_10024001 3300025934 Bacteria 3527
170 Ga0207709_10000285 3300025935 Bacteria 57630
171 Ga0207709_10001943 3300025935 Bacteria 13531
172 Ga0207709_10002633 3300025935 Bacteria 11161
173 Ga0207670_10001333 3300025936 Bacteria 13035
174 Ga0207669_10032730 3300025937 Bacteria 2924
175 Ga0207704_10002408 3300025938 Bacteria 8412
176 Ga0207704_10010636 3300025938 Bacteria 4496
177 Ga0207691_10308439 3300025940 Bacteria 1359
178 Ga0207689_10003864 3300025942 Bacteria 13653
179 Ga0207667_10026105 3300025949 Bacteria 6387
180 Ga0207712_10058912 3300025961 Bacteria 2716
181 Ga0207712_10060628 3300025961 Bacteria 2683
182 Ga0207640_10015619 3300025981 Bacteria 4400
183 Ga0207677_10005202 3300026023 Bacteria 7042
184 Ga0207703_10018476 3300026035 Bacteria 5444
185 Ga0207708_10001410 3300026075 Bacteria 18034
186 Ga0207708_10011960 3300026075 Bacteria 6465
187 Ga0207702_10094050 3300026078 Bacteria 2630
188 Ga0207702_10564736 3300026078 Bacteria 1114
189 Ga0207641_10002789 3300026088 Bacteria 15906
190 Ga0207641_10010788 3300026088 Bacteria 7490
191 Ga0207641_10110716 3300026088 Bacteria 2434
192 Ga0207648_10000359 3300026089 Bacteria 50214
193 Ga0207648_10004228 3300026089 Bacteria 14837
194 Ga0207674_10198208 3300026116 Bacteria 1957
195 Ga0207674_10344607 3300026116 Bacteria 1441
196 Ga0207675_100006845 3300026118 Bacteria 10795
197 Ga0207675_100022734 3300026118 Bacteria 5834
198 Ga0207675_100412789 3300026118 Bacteria 1332
199 Ga0209969_1001779 3300027360 Bacteria 2965
200 Ga0209967_1000362 3300027364 Bacteria 6026
201 Ga0209981_1001593 3300027378 Bacteria 2872
202 Ga0209996_1002375 3300027395 Bacteria 2330
203 Ga0210000_1002987 3300027462 Bacteria 2419
204 Ga0210000_1003453 3300027462 Bacteria 2277
205 Ga0210000_1017807 3300027462 Bacteria 1078
206 Ga0209995_1002504 3300027471 Bacteria 2907
207 Ga0209995_1007846 3300027471 Bacteria 1721
208 Ga0209968_1001234 3300027526 Bacteria 3906
209 Ga0209999_1010737 3300027543 Bacteria 1655
210 Ga0207428_10001380 3300027907 Bacteria 25677
211 Ga0207428_10029000 3300027907 Bacteria 4592
212 Ga0207428_10073712 3300027907 Bacteria 2678
213 Ga0207428_10100876 3300027907 Bacteria 2231
214 Ga0268265_10002908 3300028380 Bacteria 12578
215 Ga0268265_10014302 3300028380 Bacteria 5405
216 Ga0268264_10011730 3300028381 Bacteria 7226
217 Ga0307517_10000634 3300028786 Bacteria 60194
218 Ga0307515_10006012 3300028794 Bacteria 24419
219 Ga0316176_1099358 3300030732 Bacteria 1653
220 Ga0314311_1100549 3300030733 Bacteria 7564
221 Ga0316183_1052990 3300030742 Bacteria 1264
222 Ga0316183_1066259 3300030742 Bacteria 10511
223 Ga0265327_10000186 3300031251 Bacteria 131420
224 Ga0265327_10002083 3300031251 Bacteria 22333
225 Ga0307513_10087432 3300031456 Bacteria 3190
226 Ga0307408_100021136 3300031548 Bacteria 4401
227 Ga0307408_100026766 3300031548 Bacteria 3966
228 Ga0307408_100052489 3300031548 Bacteria 2940
229 Ga0307408_100242580 3300031548 Bacteria 1482
230 Ga0307408_100275514 3300031548 Bacteria 1399
231 Ga0307516_10000095 3300031730 Bacteria 99115
232 Ga0307516_10000099 3300031730 Bacteria 97472
233 Ga0307516_10096212 3300031730 Unclassified 2782
234 Ga0307405_10140624 3300031731 Bacteria 1682
235 Ga0307413_10173798 3300031824 Bacteria 1528
236 Ga0307412_10051021 3300031911 Bacteria 2732
237 Ga0307416_100080689 3300032002 Bacteria 2747
238 Ga0307416_100105440 3300032002 Bacteria 2467
239 Ga0307411_10007321 3300032005 Bacteria 5607
240 Ga0307415_100129780 3300032126 Bacteria 1906
241 Ga0307510_10054817 3300033180 Bacteria 4171
242 Ga0373950_0009707 3300034818 Bacteria 1542
243 Ga0373959_0003430 3300034820 Bacteria 2524
244 Ga0373938_0020408 3300034957 Bacteria 1334
245 Ga0373926_0001812 3300035083 Bacteria 6630
246 Ga0373928_0001984 3300035084 Bacteria 3987
247 Ga0373929_0006228 3300035085 Bacteria 2155
248 Ga0373934_0002883 3300035086 Bacteria 6288
249 Ga0373940_0064212 3300035088 Bacteria 1056
250 Ga0373944_0002250 3300035089 Bacteria 4909
251 Ga0373932_0004217 3300035112 Bacteria 3414
252 Ga0373936_0060804 3300035113 Bacteria 1541
253 Ga0373939_0015992 3300035114 Bacteria 1972
254 Ga0373945_0008885 3300035116 Bacteria 3283
255 Ga0373943_0021735 3300035170 Bacteria 2965
256 Ga0373955_0185223 3300035172 Bacteria 1236
257 Ga0373942_0001086 3300035207 Bacteria 7288
258 Ga0316574_0126592 3300035398 Bacteria 1642
259 Ga0373931_0000352 3300035691 Bacteria 18923
260 Ga0373931_0022874 3300035691 Bacteria 3149
261 Ga0373935_0019277 3300035692 Bacteria 4160
262 Ga0373927_0133562 3300035695 Bacteria 1621
263 Ga0373933_0003079 3300035724 Bacteria 9300
264 Ga0373933_0042632 3300035724 Bacteria 2683
265 Ga0373933_0240571 3300035724 Bacteria 1164
266 Ga0373947_0122875 3300035725 Bacteria 1650
267 Ga0373937_0021997 3300036401 Bacteria 5726
268 Ga0373937_0066211 3300036401 Bacteria 3326
269 Ga0373937_0264835 3300036401 Bacteria 1621
270 Ga0373925_0024962 3300037068 Bacteria 4365
271 Ga0373925_0132039 3300037068 Bacteria 1948
272 Ga0436364_0624342 3300037853 Bacteria 7200
273 Ga0436364_0912133 3300037853 Bacteria 2151
274 Ga0439453_0011083 3300041408 Bacteria 1498
275 Ga0439441_021667 3300042001 Bacteria 1188
276 Ga0439442_006848 3300042002 Bacteria 2287
277 Ga0450923_010947 3300042125 Bacteria 1621
278 Ga0450896_003533 3300042133 Bacteria 2084
279 Ga0439434_0001312 3300042435 Bacteria 7160
280 Ga0439434_0008759 3300042435 Bacteria 2973
281 Ga0439435_0000387 3300042436 Bacteria 6792
282 Ga0439435_0029824 3300042436 Bacteria 1475
283 Ga0451577_0487950 3300042876 Bacteria 1119
284 Ga0451576_0002819 3300045051 Bacteria 25036
285 Ga0451576_0003913 3300045051 Bacteria 19889
286 Ga0451576_0005813 3300045051 Bacteria 15340
287 Ga0451576_0103848 3300045051 Bacteria 2956
288 Ga0451576_0106051 3300045051 Bacteria 2924
289 Ga0451576_0129878 3300045051 Bacteria 2626
290 Ga0466958_0167448 3300045836 Bacteria 1391
291 Ga0466967_0031196 3300045976 Bacteria 4484
292 Ga0495592_0027699 3300046454 Bacteria 4293
293 Ga0495603_0005435 3300046455 Bacteria 7605
294 Ga0495629_0013426 3300046459 Bacteria 5909
295 Ga0495629_0090170 3300046459 Bacteria 2139
296 Ga0495651_0020240 3300046462 Bacteria 5164
297 Ga0495580_0000006 3300046472 Bacteria 105024
298 Ga0495580_0015061 3300046472 Bacteria 5850
299 Ga0495582_0046589 3300046473 Bacteria 2388
300 Ga0495639_0054678 3300046475 Bacteria 1820
301 Ga0495662_0004705 3300046476 Bacteria 6835
302 Ga0495584_0086116 3300046491 Bacteria 1583
303 Ga0495584_0164209 3300046491 Bacteria 1129
304 Ga0495594_0043563 3300046499 Bacteria 2460
305 Ga0495596_0009787 3300046500 Bacteria 4204
306 Ga0495608_0004765 3300046511 Bacteria 9704
307 Ga0495628_0094427 3300046516 Bacteria 2312
308 Ga0495628_0127253 3300046516 Bacteria 1951
309 Ga0495630_0047049 3300046517 Bacteria 3226
310 Ga0495630_0129844 3300046517 Bacteria 1913
311 Ga0495648_0005025 3300046524 Bacteria 11115
312 Ga0495666_0040068 3300046526 Bacteria 2272
313 Ga0495652_0022681 3300046529 Bacteria 5570
314 Ga0495665_0065218 3300046531 Bacteria 1922
315 Ga0495640_0037176 3300046533 Bacteria 3436
316 Ga0495640_0067732 3300046533 Bacteria 2404
317 Ga0495586_0012607 3300046535 Bacteria 4484
318 Ga0495587_0003760 3300046536 Bacteria 10066
319 Ga0495621_0025194 3300046539 Bacteria 1997
320 Ga0495656_0082281 3300046615 Bacteria 1455
321 Ga0495668_0022663 3300046616 Bacteria 3588
322 Ga0495635_0092872 3300046663 Bacteria 2064
323 Ga0495657_0069390 3300046675 Bacteria 2307
324 Ga0495646_0017709 3300046680 Bacteria 4516
325 Ga0495647_0006502 3300046681 Bacteria 3874
326 Ga0495658_0001994 3300046683 Bacteria 10406
327 Ga0495669_0003283 3300046684 Bacteria 6659
328 Ga0495669_0015769 3300046684 Bacteria 3235
329 Ga0495613_0001914 3300046689 Bacteria 15792
330 Ga0495624_0056135 3300046690 Bacteria 2479
331 Ga0495671_0006751 3300046692 Bacteria 6607
332 Ga0495589_0000671 3300046794 Bacteria 22395
333 Ga0495600_0017517 3300046809 Bacteria 4558
334 Ga0495581_0142785 3300047315 Bacteria 1397
335 Ga0495604_0026636 3300047317 Bacteria 4601
336 Ga0495604_0071789 3300047317 Bacteria 2618
337 Ga0495636_0002675 3300047318 Bacteria 6880
338 Ga0495636_0076523 3300047318 Bacteria 1435
339 Ga0495674_0112009 3300047319 Bacteria 2312
340 Ga0495676_0026508 3300047321 Bacteria 4988
341 Ga0495676_0039551 3300047321 Bacteria 3905
342 Ga0495683_0001150 3300047323 Bacteria 18197
343 Ga0495675_0000759 3300047444 Bacteria 20203
344 Ga0495679_035729 3300047446 Bacteria 1573
345 Ga0495673_0001825 3300047469 Bacteria 16081
346 Ga0495593_0001429 3300047673 Bacteria 14014
347 Ga0495602_0003332 3300048088 Bacteria 16585
348 Ga0496106_0134480 3300048909 Bacteria 1941
349 Ga0496115_0068674 3300048918 Bacteria 2870
350 Ga0496125_0005953 3300048928 Bacteria 13355
351 Ga0501031_0016698 3300049568 Bacteria 4769
352 Ga0501032_0000024 3300049569 Bacteria 143876
353 Ga0501033_0000090 3300049570 Bacteria 86596
354 Ga0501033_0002540 3300049570 Bacteria 15451
355 Ga0501034_0000140 3300049571 Bacteria 134996
356 Ga0501034_0017653 3300049571 Bacteria 7316
357 Ga0501034_0073343 3300049571 Bacteria 3432
358 Ga0501036_0003542 3300049572 Bacteria 12488
359 Ga0501036_0003547 3300049572 Bacteria 12480
360 Ga0501037_0000024 3300049573 Bacteria 146046
361 Ga0501037_0010375 3300049573 Bacteria 6834
362 Ga0501038_0000197 3300049574 Bacteria 51975
363 Ga0501038_0198924 3300049574 Bacteria 1609
364 Ga0501039_0000017 3300049575 Bacteria 189412
365 Ga0501039_0000199 3300049575 Bacteria 43314
366 Ga0501039_0010321 3300049575 Bacteria 7124
367 Ga0501039_0016516 3300049575 Bacteria 5654
368 Ga0501039_0043849 3300049575 Bacteria 3455
369 Ga0501039_0056452 3300049575 Bacteria 3042
370 Ga0501039_0296228 3300049575 Bacteria 1272
371 Ga0501040_0000082 3300049576 Bacteria 46447
372 Ga0501040_0011783 3300049576 Bacteria 5721
373 Ga0501040_0256025 3300049576 Bacteria 1249
374 Ga0501041_0000410 3300049577 Bacteria 21637
375 Ga0501041_0028889 3300049577 Bacteria 3346
376 Ga0501042_0003570 3300049578 Bacteria 9797
377 Ga0501042_0020484 3300049578 Bacteria 4603
378 Ga0501042_0024125 3300049578 Bacteria 4264
379 Ga0501042_0044025 3300049578 Bacteria 3180
380 Ga0501043_0000004 3300049579 Bacteria 291085
381 Ga0501043_0004093 3300049579 Bacteria 11913
382 Ga0501043_0008049 3300049579 Bacteria 8323
383 Ga0501043_0224322 3300049579 Bacteria 1453
384 Ga0501046_0000016 3300049580 Bacteria 234374
385 Ga0501046_0006832 3300049580 Bacteria 10066
386 Ga0501047_0000012 3300049581 Bacteria 368824
387 Ga0501047_0010304 3300049581 Bacteria 8839
388 Ga0501047_0107094 3300049581 Bacteria 2677
389 Ga0501047_0261245 3300049581 Bacteria 1579
390 Ga0501048_0000414 3300049582 Bacteria 29908
391 Ga0501048_0001243 3300049582 Bacteria 19319
392 Ga0501048_0033077 3300049582 Bacteria 3737
393 Ga0501048_0046217 3300049582 Bacteria 3108
394 Ga0501048_0059112 3300049582 Bacteria 2717
395 Ga0501048_0072281 3300049582 Bacteria 2435
396 Ga0501071_0008661 3300049587 Bacteria 6729
397 Ga0501071_0014198 3300049587 Bacteria 5446
398 Ga0501072_0002099 3300049588 Bacteria 14843
399 Ga0501072_0007920 3300049588 Bacteria 8067
400 Ga0501072_0046888 3300049588 Bacteria 3402
401 Ga0501072_0097956 3300049588 Bacteria 2331
402 Ga0501074_0001772 3300049590 Bacteria 14753
403 Ga0501075_0000696 3300049591 Bacteria 20851
404 Ga0501075_0001299 3300049591 Bacteria 16201
405 Ga0501075_0009119 3300049591 Bacteria 6931
406 Ga0501075_0065318 3300049591 Bacteria 2745
407 Ga0501076_0000856 3300049592 Bacteria 19728
408 Ga0501076_0000922 3300049592 Bacteria 19182
409 Ga0501077_0022401 3300049593 Bacteria 4001
410 Ga0501079_0000165 3300049741 Bacteria 36937
411 Ga0501079_0006707 3300049741 Bacteria 8660
412 Ga0501079_0042767 3300049741 Bacteria 3498
413 Ga0501079_0108637 3300049741 Bacteria 2154
414 Ga0501080_0029215 3300049742 Bacteria 5132
415 Ga0501080_0036464 3300049742 Bacteria 4590
416 Ga0501080_0273878 3300049742 Bacteria 1536
417 Ga0501081_0001217 3300049743 Bacteria 15671
418 Ga0501081_0002100 3300049743 Bacteria 12452
419 Ga0501081_0020447 3300049743 Bacteria 4412
420 Ga0501081_0032760 3300049743 Bacteria 3527
421 Ga0501081_0101061 3300049743 Bacteria 2039
422 Ga0501035_0000021 3300049822 Bacteria 209085
423 Ga0501035_0076614 3300049822 Bacteria 2957
424 Ga0501035_0126425 3300049822 Bacteria 2232
425 Ga0501044_0122190 3300049823 Bacteria 2604
426 Ga0501045_0000012 3300049824 Bacteria 74001
427 Ga0501045_0000154 3300049824 Bacteria 36954
428 Ga0501045_0011996 3300049824 Bacteria 6093
429 Ga0501045_0026584 3300049824 Bacteria 4165
430 Ga0501045_0106335 3300049824 Bacteria 2079
431 nmdc:mga07m45_4268_c1 3300050496 Bacteria 6992
432 nmdc:mga07m45_58766_c1 3300050496 Bacteria 2176
433 nmdc:mga05p37_113855_c1 3300050507 Bacteria 3326
434 nmdc:mga05p37_150198_c1 3300050507 Bacteria 2850
435 nmdc:mga05p37_623_c1 3300050507 Bacteria 39191
436 nmdc:mga09592_1081_c1 3300050508 Bacteria 21649
437 nmdc:mga09592_139675_c1 3300050508 Bacteria 2088
438 nmdc:mga09592_2644_c1 3300050508 Bacteria 14481
439 nmdc:mga0qj67_101644_c1 3300050509 Bacteria 2318
440 nmdc:mga0qj67_10939_c1 3300050509 Bacteria 6791
441 nmdc:mga0qj67_147671_c1 3300050509 Bacteria 1906
442 nmdc:mga0qj67_58315_c1 3300050509 Bacteria 3061
443 nmdc:mga0qj67_60784_c1 3300050509 Bacteria 2999
444 nmdc:mga0qj67_851_c1 3300050509 Bacteria 20946
445 nmdc:mga06r32_12986_c1 3300050510 Bacteria 7532
446 nmdc:mga06r32_143478_c1 3300050510 Bacteria 2365
447 nmdc:mga06r32_204832_c1 3300050510 Bacteria 1961
448 nmdc:mga06r32_216119_c1 3300050510 Bacteria 1905
449 nmdc:mga06r32_358230_c1 3300050510 Bacteria 1443
450 nmdc:mga08y16_11393_c1 3300050511 Bacteria 9344
451 nmdc:mga08y16_165879_c1 3300050511 Bacteria 2294
452 nmdc:mga08y16_18821_c1 3300050511 Bacteria 7276
453 nmdc:mga08y16_23213_c1 3300050511 Bacteria 6549
454 nmdc:mga08y16_293350_c1 3300050511 Bacteria 1677
455 nmdc:mga08y16_39231_c1 3300050511 Bacteria 4969
456 nmdc:mga08y16_91355_c1 3300050511 Bacteria 3173
457 nmdc:mga0n895_29872_c1 3300050512 Bacteria 5203
458 nmdc:mga0n895_3455_c1 3300050512 Bacteria 12748
459 nmdc:mga0n895_37363_c1 3300050512 Bacteria 4697
460 nmdc:mga0rr50_10819_c1 3300050513 Bacteria 5816
461 nmdc:mga0rr50_2773_c1 3300050513 Bacteria 9956
462 nmdc:mga08x19_21311_c1 3300050514 Bacteria 3999
463 nmdc:mga08x19_2340_c1 3300050514 Bacteria 11503
464 nmdc:mga08x19_3542_c1 3300050514 Bacteria 9284
465 nmdc:mga08x19_4566_c1 3300050514 Bacteria 8218
466 nmdc:mga0a205_956_c1 3300050515 Bacteria 23838
467 Ga0495601_0152613 3300053077 Bacteria 1508
468 Ga0500610_0001230 3300053079 Bacteria 8543
469 Ga0495619_0242512 3300053085 Bacteria 1249
470 Ga0500562_000576 3300053108 Bacteria 8804
471 Ga0500562_030382 3300053108 Bacteria 1423
472 Ga0500608_092181 3300053122 Bacteria 1414
473 Ga0500559_0012754 3300053136 Bacteria 3568
474 Ga0500627_0162720 3300053158 Bacteria 1006
475 Ga0501084_0000200 3300054114 Bacteria 46374
476 Ga0501084_0022056 3300054114 Bacteria 5311
477 Ga0501082_0022004 3300060353 Bacteria 5497
478 Ga0501082_0030307 3300060353 Bacteria 4662
479 Ga0530510_0000977 3300061734 Bacteria 18901
480 Ga0530510_0003503 3300061734 Bacteria 10788
481 Ga0530510_0040875 3300061734 Bacteria 3347

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005333 Ga0070677_10099363 Ga0070677_100993632 263
2 3300005578 Ga0068854_100013930 Ga0068854_1000139304 263
3 3300025893 Ga0207682_10064255 Ga0207682_100642551 263
4 3300025933 Ga0207706_10008024 Ga0207706_100080245 263
5 3300025981 Ga0207640_10015619 Ga0207640_100156193 263
6 3300045976 Ga0466967_0031196 Ga0466967_0031196_1721_2635 265
7 3300006943 Ga0099822_1019647 Ga0099822_10196473 267
8 3300009177 Ga0105248_10000080 Ga0105248_1000008064 267
9 3300042133 Ga0450896_003533 Ga0450896_003533_561_1448 269
10 3300048928 Ga0496125_0005953 Ga0496125_0005953_2975_3880 269
11 3300035724 Ga0373933_0042632 Ga0373933_0042632_1050_1964 271
12 3300036401 Ga0373937_0066211 Ga0373937_0066211_1596_2510 271
13 3300037068 Ga0373925_0132039 Ga0373925_0132039_531_1445 271
14 3300037853 Ga0436364_0912133 Ga0436364_0912133_593_1507 271
15 3300046615 Ga0495656_0082281 Ga0495656_0082281_471_1385 272
16 3300053108 Ga0500562_030382 Ga0500562_030382_53_967 272
17 3300046684 Ga0495669_0015769 Ga0495669_0015769_931_1827 273
18 3300009093 Ga0105240_10312357 Ga0105240_103123572 274
19 3300031251 Ga0265327_10002083 Ga0265327_100020836 274
20 3300005841 Ga0068863_100021294 Ga0068863_1000212944 278
21 3300026088 Ga0207641_10010788 Ga0207641_100107885 278
22 3300031251 Ga0265327_10000186 Ga0265327_1000018656 278
23 3300046491 Ga0495584_0086116 Ga0495584_0086116_737_1573 278
24 3300049741 Ga0501079_0108637 Ga0501079_0108637_1295_2131 278
25 3300005577 Ga0068857_100409470 Ga0068857_1004094701 279
26 3300006195 Ga0075366_10025280 Ga0075366_100252802 279
27 3300006353 Ga0075370_10003457 Ga0075370_100034573 279
28 3300009148 Ga0105243_10001362 Ga0105243_1000136219 279
29 3300025935 Ga0207709_10000285 Ga0207709_1000028516 279
30 3300026116 Ga0207674_10198208 Ga0207674_101982082 279
31 3300046616 Ga0495668_0022663 Ga0495668_0022663_124_1044 279
32 3300050496 nmdc:mga07m45_4268_c1 nmdc:mga07m45_4268_c1_1627_2544 279
33 3300053158 Ga0500627_0162720 Ga0500627_0162720_72_992 279
34 3300003781 Ga0055536_1004919 Ga0055536_10049192 281
35 3300003792 Ga0055540_1020404 Ga0055540_10204042 281
36 3300025292 Ga0209676_1000173 Ga0209676_100017395 281
37 3300025303 Ga0209051_1000282 Ga0209051_100028241 281
38 3300005616 Ga0068852_100489358 Ga0068852_1004893582 282
39 3300017792 Ga0163161_10079405 Ga0163161_100794052 282
40 3300033180 Ga0307510_10054817 Ga0307510_100548173 282
41 3300053085 Ga0495619_0242512 Ga0495619_0242512_58_972 282
42 3300028786 Ga0307517_10000634 Ga0307517_1000063434 283
43 3300028794 Ga0307515_10006012 Ga0307515_100060122 283
44 3300049575 Ga0501039_0296228 Ga0501039_0296228_270_1229 283
45 3300030742 Ga0316183_1052990 Ga0316183_10529902 284
46 3300006177 Ga0075362_10001585 Ga0075362_100015854 286
47 3300049579 Ga0501043_0000004 Ga0501043_0000004_174911_175843 286
48 3300049580 Ga0501046_0000016 Ga0501046_0000016_115993_116925 286
49 3300049581 Ga0501047_0000012 Ga0501047_0000012_115673_116605 286
50 3300049582 Ga0501048_0000414 Ga0501048_0000414_23452_24384 286
51 3300049823 Ga0501044_0122190 Ga0501044_0122190_671_1603 286
52 3300049824 Ga0501045_0011996 Ga0501045_0011996_1401_2333 286
53 3300031548 Ga0307408_100052489 Ga0307408_1000524894 287
54 3300032002 Ga0307416_100080689 Ga0307416_1000806892 287
55 3300042002 Ga0439442_006848 Ga0439442_006848_676_1581 287
56 3300042125 Ga0450923_010947 Ga0450923_010947_549_1454 287
57 3300042435 Ga0439434_0008759 Ga0439434_0008759_1862_2767 287
58 3300031456 Ga0307513_10087432 Ga0307513_100874323 289
59 3300030732 Ga0316176_1099358 Ga0316176_10993582 291
60 3300030733 Ga0314311_1100549 Ga0314311_11005492 291
61 3300030742 Ga0316183_1066259 Ga0316183_10662599 291
62 3300005841 Ga0068863_100106776 Ga0068863_1001067762 292
63 3300006871 Ga0075434_100022149 Ga0075434_1000221492 292
64 3300007076 Ga0075435_100306769 Ga0075435_1003067692 292
65 3300026088 Ga0207641_10110716 Ga0207641_101107162 292
66 3300048918 Ga0496115_0068674 Ga0496115_0068674_62_1036 292
67 3300050512 nmdc:mga0n895_37363_c1 nmdc:mga0n895_37363_c1_1529_2434 292
68 3300053108 Ga0500562_000576 Ga0500562_000576_637_1578 292
69 3300025926 Ga0207659_10264597 Ga0207659_102645972 294
70 3300050510 nmdc:mga06r32_358230_c1 nmdc:mga06r32_358230_c1_542_1426 294
71 3300031731 Ga0307405_10140624 Ga0307405_101406242 295
72 3300032126 Ga0307415_100129780 Ga0307415_1001297802 295
73 3300031548 Ga0307408_100021136 Ga0307408_1000211363 296
74 3300032002 Ga0307416_100105440 Ga0307416_1001054403 296
75 3300046692 Ga0495671_0006751 Ga0495671_0006751_4168_5061 297
76 3300025908 Ga0207643_10111980 Ga0207643_101119802 298
77 3300027462 Ga0210000_1002987 Ga0210000_10029872 298
78 3300031730 Ga0307516_10096212 Ga0307516_100962123 298
79 3300005549 Ga0070704_100213573 Ga0070704_1002135731 299
80 3300006846 Ga0075430_100000318 Ga0075430_10000031819 299
81 3300025918 Ga0207662_10051326 Ga0207662_100513263 299
82 3300027462 Ga0210000_1017807 Ga0210000_10178071 299
83 3300031824 Ga0307413_10173798 Ga0307413_101737981 299
84 3300046476 Ga0495662_0004705 Ga0495662_0004705_5349_6248 299
85 3300049574 Ga0501038_0198924 Ga0501038_0198924_390_1295 299
86 3300049578 Ga0501042_0044025 Ga0501042_0044025_1879_2784 299
87 3300049582 Ga0501048_0059112 Ga0501048_0059112_698_1603 299
88 3300050509 nmdc:mga0qj67_60784_c1 nmdc:mga0qj67_60784_c1_789_1694 299
89 3300050509 nmdc:mga0qj67_851_c1 nmdc:mga0qj67_851_c1_19437_20342 299
90 3300050510 nmdc:mga06r32_12986_c1 nmdc:mga06r32_12986_c1_2702_3607 299
91 3300005354 Ga0070675_100374206 Ga0070675_1003742062 300
92 3300006844 Ga0075428_100033666 Ga0075428_1000336662 300
93 3300006846 Ga0075430_100241071 Ga0075430_1002410712 300
94 3300007265 Ga0099794_10016869 Ga0099794_100168691 300
95 3300009094 Ga0111539_10227637 Ga0111539_102276372 300
96 3300036401 Ga0373937_0264835 Ga0373937_0264835_243_1145 300
97 3300046472 Ga0495580_0000006 Ga0495580_0000006_56081_56983 300
98 3300046516 Ga0495628_0127253 Ga0495628_0127253_719_1627 300
99 3300050509 nmdc:mga0qj67_147671_c1 nmdc:mga0qj67_147671_c1_348_1286 300
100 3300050511 nmdc:mga08y16_91355_c1 nmdc:mga08y16_91355_c1_2243_3145 300
101 3300003203 JGI25406J46586_10022242 JGI25406J46586_100222422 301
102 3300005295 Ga0065707_10002391 Ga0065707_100023912 301
103 3300005295 Ga0065707_10013296 Ga0065707_100132963 301
104 3300005330 Ga0070690_100001335 Ga0070690_1000013353 301
105 3300005334 Ga0068869_100002111 Ga0068869_1000021119 301
106 3300005336 Ga0070680_100001466 Ga0070680_1000014666 301
107 3300005336 Ga0070680_100052982 Ga0070680_1000529823 301
108 3300005337 Ga0070682_100007419 Ga0070682_1000074192 301
109 3300005338 Ga0068868_100007062 Ga0068868_1000070623 301
110 3300005340 Ga0070689_100001640 Ga0070689_1000016403 301
111 3300005340 Ga0070689_100040634 Ga0070689_1000406343 301
112 3300005343 Ga0070687_100000392 Ga0070687_1000003924 301
113 3300005345 Ga0070692_10012504 Ga0070692_100125044 301
114 3300005345 Ga0070692_10017056 Ga0070692_100170564 301
115 3300005353 Ga0070669_100021278 Ga0070669_1000212782 301
116 3300005353 Ga0070669_100101101 Ga0070669_1001011012 301
117 3300005354 Ga0070675_100113004 Ga0070675_1001130043 301
118 3300005406 Ga0070703_10006581 Ga0070703_100065812 301
119 3300005438 Ga0070701_10001104 Ga0070701_100011048 301
120 3300005440 Ga0070705_100000198 Ga0070705_1000001987 301
121 3300005440 Ga0070705_100007580 Ga0070705_1000075802 301
122 3300005440 Ga0070705_100118894 Ga0070705_1001188942 301
123 3300005440 Ga0070705_100262462 Ga0070705_1002624622 301
124 3300005441 Ga0070700_100000336 Ga0070700_10000033614 301
125 3300005441 Ga0070700_100000389 Ga0070700_10000038915 301
126 3300005444 Ga0070694_100003027 Ga0070694_10000302710 301
127 3300005444 Ga0070694_100007226 Ga0070694_1000072262 301
128 3300005444 Ga0070694_100056234 Ga0070694_1000562342 301
129 3300005458 Ga0070681_10000676 Ga0070681_1000067610 301
130 3300005459 Ga0068867_100000780 Ga0068867_10000078010 301
131 3300005459 Ga0068867_100024393 Ga0068867_1000243932 301
132 3300005468 Ga0070707_100178057 Ga0070707_1001780573 301
133 3300005471 Ga0070698_100063760 Ga0070698_1000637603 301
134 3300005518 Ga0070699_100070943 Ga0070699_1000709432 301
135 3300005518 Ga0070699_100143102 Ga0070699_1001431023 301
136 3300005530 Ga0070679_100012766 Ga0070679_1000127666 301
137 3300005543 Ga0070672_100344751 Ga0070672_1003447512 301
138 3300005544 Ga0070686_100001108 Ga0070686_1000011083 301
139 3300005545 Ga0070695_100000292 Ga0070695_10000029217 301
140 3300005545 Ga0070695_100003027 Ga0070695_1000030278 301
141 3300005545 Ga0070695_100184673 Ga0070695_1001846731 301
142 3300005546 Ga0070696_100000489 Ga0070696_10000048912 301
143 3300005546 Ga0070696_100015085 Ga0070696_1000150853 301
144 3300005546 Ga0070696_100093320 Ga0070696_1000933203 301
145 3300005546 Ga0070696_100100523 Ga0070696_1001005232 301
146 3300005546 Ga0070696_100222879 Ga0070696_1002228792 301
147 3300005547 Ga0070693_100000126 Ga0070693_10000012623 301
148 3300005547 Ga0070693_100314639 Ga0070693_1003146392 301
149 3300005549 Ga0070704_100001261 Ga0070704_1000012612 301
150 3300005549 Ga0070704_100002806 Ga0070704_1000028068 301
151 3300005549 Ga0070704_100041955 Ga0070704_1000419553 301
152 3300005549 Ga0070704_100065499 Ga0070704_1000654992 301
153 3300005563 Ga0068855_100026989 Ga0068855_1000269893 301
154 3300005578 Ga0068854_100005630 Ga0068854_1000056303 301
155 3300005614 Ga0068856_100031945 Ga0068856_1000319453 301
156 3300005614 Ga0068856_100132085 Ga0068856_1001320852 301
157 3300005615 Ga0070702_100001105 Ga0070702_10000110511 301
158 3300005615 Ga0070702_100090832 Ga0070702_1000908322 301
159 3300005616 Ga0068852_100095314 Ga0068852_1000953142 301
160 3300005617 Ga0068859_100010604 Ga0068859_10001060411 301
161 3300005617 Ga0068859_100288531 Ga0068859_1002885312 301
162 3300005618 Ga0068864_100037077 Ga0068864_1000370773 301
163 3300005718 Ga0068866_10003537 Ga0068866_100035373 301
164 3300005718 Ga0068866_10006743 Ga0068866_100067433 301
165 3300005719 Ga0068861_100000316 Ga0068861_1000003165 301
166 3300005719 Ga0068861_100006140 Ga0068861_1000061409 301
167 3300005840 Ga0068870_10061354 Ga0068870_100613542 301
168 3300005841 Ga0068863_100002399 Ga0068863_1000023997 301
169 3300005841 Ga0068863_100497046 Ga0068863_1004970462 301
170 3300005842 Ga0068858_100018197 Ga0068858_1000181976 301
171 3300005843 Ga0068860_100008921 Ga0068860_1000089213 301
172 3300005844 Ga0068862_100002813 Ga0068862_1000028132 301
173 3300005844 Ga0068862_100006610 Ga0068862_1000066103 301
174 3300005985 Ga0081539_10006772 Ga0081539_100067725 301
175 3300006237 Ga0097621_100002057 Ga0097621_1000020573 301
176 3300006358 Ga0068871_100004146 Ga0068871_1000041468 301
177 3300006844 Ga0075428_100001001 Ga0075428_10000100119 301
178 3300006844 Ga0075428_100214360 Ga0075428_1002143602 301
179 3300006844 Ga0075428_100427312 Ga0075428_1004273122 301
180 3300006846 Ga0075430_100009635 Ga0075430_1000096357 301
181 3300006846 Ga0075430_100118227 Ga0075430_1001182274 301
182 3300006847 Ga0075431_100050300 Ga0075431_1000503002 301
183 3300006847 Ga0075431_100426171 Ga0075431_1004261711 301
184 3300006852 Ga0075433_10000441 Ga0075433_1000044116 301
185 3300006871 Ga0075434_100013244 Ga0075434_1000132443 301
186 3300006871 Ga0075434_100031718 Ga0075434_1000317183 301
187 3300006880 Ga0075429_100000363 Ga0075429_10000036319 301
188 3300006880 Ga0075429_100019170 Ga0075429_1000191701 301
189 3300006880 Ga0075429_100193940 Ga0075429_1001939402 301
190 3300006880 Ga0075429_100370617 Ga0075429_1003706172 301
191 3300006881 Ga0068865_100001740 Ga0068865_1000017408 301
192 3300006881 Ga0068865_100003157 Ga0068865_1000031575 301
193 3300006914 Ga0075436_100001646 Ga0075436_1000016469 301
194 3300006914 Ga0075436_100003099 Ga0075436_1000030992 301
195 3300006931 Ga0097620_100010604 Ga0097620_1000106043 301
196 3300006931 Ga0097620_100288550 Ga0097620_1002885502 301
197 3300007076 Ga0075435_100008938 Ga0075435_1000089383 301
198 3300007076 Ga0075435_100029975 Ga0075435_1000299752 301
199 3300009094 Ga0111539_10025413 Ga0111539_100254137 301
200 3300009094 Ga0111539_10046079 Ga0111539_100460796 301
201 3300009094 Ga0111539_10101418 Ga0111539_101014183 301
202 3300009094 Ga0111539_10276391 Ga0111539_102763912 301
203 3300009147 Ga0114129_10001363 Ga0114129_100013635 301
204 3300009147 Ga0114129_10049369 Ga0114129_100493691 301
205 3300009147 Ga0114129_10483905 Ga0114129_104839052 301
206 3300009148 Ga0105243_10003557 Ga0105243_100035572 301
207 3300009148 Ga0105243_10004111 Ga0105243_1000411112 301
208 3300009176 Ga0105242_10009425 Ga0105242_100094253 301
209 3300009545 Ga0105237_10381542 Ga0105237_103815422 301
210 3300009553 Ga0105249_10011474 Ga0105249_100114749 301
211 3300013296 Ga0157374_10086939 Ga0157374_100869393 301
212 3300013297 Ga0157378_10001643 Ga0157378_1000164312 301
213 3300013306 Ga0163162_10514382 Ga0163162_105143821 301
214 3300013308 Ga0157375_10139409 Ga0157375_101394093 301
215 3300014326 Ga0157380_10001588 Ga0157380_1000158811 301
216 3300014745 Ga0157377_10006333 Ga0157377_100063334 301
217 3300014968 Ga0157379_10057756 Ga0157379_100577564 301
218 3300014969 Ga0157376_10025135 Ga0157376_100251353 301
219 3300021388 Ga0213875_10008932 Ga0213875_100089322 301
220 3300025885 Ga0207653_10019749 Ga0207653_100197492 301
221 3300025899 Ga0207642_10000598 Ga0207642_100005987 301
222 3300025899 Ga0207642_10042479 Ga0207642_100424793 301
223 3300025901 Ga0207688_10008796 Ga0207688_100087963 301
224 3300025908 Ga0207643_10054465 Ga0207643_100544652 301
225 3300025912 Ga0207707_10001702 Ga0207707_100017023 301
226 3300025918 Ga0207662_10001169 Ga0207662_100011692 301
227 3300025921 Ga0207652_10006354 Ga0207652_100063544 301
228 3300025922 Ga0207646_10161258 Ga0207646_101612581 301
229 3300025923 Ga0207681_10009570 Ga0207681_100095702 301
230 3300025923 Ga0207681_10074228 Ga0207681_100742283 301
231 3300025927 Ga0207687_10013680 Ga0207687_100136804 301
232 3300025933 Ga0207706_10049025 Ga0207706_100490253 301
233 3300025934 Ga0207686_10024001 Ga0207686_100240012 301
234 3300025935 Ga0207709_10001943 Ga0207709_100019437 301
235 3300025935 Ga0207709_10002633 Ga0207709_100026338 301
236 3300025936 Ga0207670_10001333 Ga0207670_1000133312 301
237 3300025937 Ga0207669_10032730 Ga0207669_100327303 301
238 3300025938 Ga0207704_10002408 Ga0207704_100024088 301
239 3300025938 Ga0207704_10010636 Ga0207704_100106364 301
240 3300025940 Ga0207691_10308439 Ga0207691_103084392 301
241 3300025942 Ga0207689_10003864 Ga0207689_100038644 301
242 3300025949 Ga0207667_10026105 Ga0207667_100261054 301
243 3300025961 Ga0207712_10058912 Ga0207712_100589122 301
244 3300025961 Ga0207712_10060628 Ga0207712_100606282 301
245 3300026023 Ga0207677_10005202 Ga0207677_100052026 301
246 3300026035 Ga0207703_10018476 Ga0207703_100184764 301
247 3300026075 Ga0207708_10001410 Ga0207708_100014107 301
248 3300026075 Ga0207708_10011960 Ga0207708_100119605 301
249 3300026078 Ga0207702_10094050 Ga0207702_100940501 301
250 3300026078 Ga0207702_10564736 Ga0207702_105647361 301
251 3300026088 Ga0207641_10002789 Ga0207641_1000278910 301
252 3300026089 Ga0207648_10000359 Ga0207648_1000035929 301
253 3300026089 Ga0207648_10004228 Ga0207648_100042285 301
254 3300026116 Ga0207674_10344607 Ga0207674_103446072 301
255 3300026118 Ga0207675_100006845 Ga0207675_10000684511 301
256 3300026118 Ga0207675_100022734 Ga0207675_1000227342 301
257 3300026118 Ga0207675_100412789 Ga0207675_1004127892 301
258 3300027360 Ga0209969_1001779 Ga0209969_10017793 301
259 3300027364 Ga0209967_1000362 Ga0209967_10003623 301
260 3300027378 Ga0209981_1001593 Ga0209981_10015933 301
261 3300027395 Ga0209996_1002375 Ga0209996_10023752 301
262 3300027462 Ga0210000_1003453 Ga0210000_10034532 301
263 3300027471 Ga0209995_1002504 Ga0209995_10025042 301
264 3300027471 Ga0209995_1007846 Ga0209995_10078462 301
265 3300027526 Ga0209968_1001234 Ga0209968_10012343 301
266 3300027543 Ga0209999_1010737 Ga0209999_10107372 301
267 3300027907 Ga0207428_10001380 Ga0207428_100013807 301
268 3300027907 Ga0207428_10029000 Ga0207428_100290003 301
269 3300027907 Ga0207428_10073712 Ga0207428_100737123 301
270 3300027907 Ga0207428_10100876 Ga0207428_101008762 301
271 3300028380 Ga0268265_10002908 Ga0268265_100029085 301
272 3300028380 Ga0268265_10014302 Ga0268265_100143026 301
273 3300028381 Ga0268264_10011730 Ga0268264_100117306 301
274 3300031548 Ga0307408_100026766 Ga0307408_1000267665 301
275 3300031548 Ga0307408_100242580 Ga0307408_1002425802 301
276 3300031548 Ga0307408_100275514 Ga0307408_1002755142 301
277 3300031730 Ga0307516_10000095 Ga0307516_1000009523 301
278 3300031730 Ga0307516_10000099 Ga0307516_1000009941 301
279 3300031911 Ga0307412_10051021 Ga0307412_100510214 301
280 3300032005 Ga0307411_10007321 Ga0307411_100073215 301
281 3300034818 Ga0373950_0009707 Ga0373950_0009707_101_1024 301
282 3300034820 Ga0373959_0003430 Ga0373959_0003430_359_1282 301
283 3300034957 Ga0373938_0020408 Ga0373938_0020408_125_1048 301
284 3300035083 Ga0373926_0001812 Ga0373926_0001812_4824_5747 301
285 3300035084 Ga0373928_0001984 Ga0373928_0001984_2273_3196 301
286 3300035085 Ga0373929_0006228 Ga0373929_0006228_585_1490 301
287 3300035086 Ga0373934_0002883 Ga0373934_0002883_4361_5266 301
288 3300035088 Ga0373940_0064212 Ga0373940_0064212_72_995 301
289 3300035089 Ga0373944_0002250 Ga0373944_0002250_3335_4258 301
290 3300035112 Ga0373932_0004217 Ga0373932_0004217_971_1894 301
291 3300035113 Ga0373936_0060804 Ga0373936_0060804_585_1508 301
292 3300035114 Ga0373939_0015992 Ga0373939_0015992_870_1793 301
293 3300035116 Ga0373945_0008885 Ga0373945_0008885_981_1904 301
294 3300035170 Ga0373943_0021735 Ga0373943_0021735_1542_2465 301
295 3300035172 Ga0373955_0185223 Ga0373955_0185223_222_1127 301
296 3300035207 Ga0373942_0001086 Ga0373942_0001086_1641_2546 301
297 3300035398 Ga0316574_0126592 Ga0316574_0126592_710_1624 301
298 3300035691 Ga0373931_0000352 Ga0373931_0000352_12021_12944 301
299 3300035691 Ga0373931_0022874 Ga0373931_0022874_1560_2483 301
300 3300035692 Ga0373935_0019277 Ga0373935_0019277_3080_4021 301
301 3300035695 Ga0373927_0133562 Ga0373927_0133562_198_1121 301
302 3300035724 Ga0373933_0003079 Ga0373933_0003079_4604_5509 301
303 3300035724 Ga0373933_0240571 Ga0373933_0240571_105_1010 301
304 3300035725 Ga0373947_0122875 Ga0373947_0122875_501_1424 301
305 3300036401 Ga0373937_0021997 Ga0373937_0021997_4508_5413 301
306 3300037068 Ga0373925_0024962 Ga0373925_0024962_2514_3455 301
307 3300037853 Ga0436364_0624342 Ga0436364_0624342_5354_6304 301
308 3300041408 Ga0439453_0011083 Ga0439453_0011083_52_963 301
309 3300042001 Ga0439441_021667 Ga0439441_021667_12_923 301
310 3300042435 Ga0439434_0001312 Ga0439434_0001312_962_1873 301
311 3300042436 Ga0439435_0000387 Ga0439435_0000387_451_1362 301
312 3300042436 Ga0439435_0029824 Ga0439435_0029824_517_1428 301
313 3300042876 Ga0451577_0487950 Ga0451577_0487950_24_929 301
314 3300045051 Ga0451576_0002819 Ga0451576_0002819_8513_9436 301
315 3300045051 Ga0451576_0003913 Ga0451576_0003913_1954_2877 301
316 3300045051 Ga0451576_0005813 Ga0451576_0005813_5371_6294 301
317 3300045051 Ga0451576_0103848 Ga0451576_0103848_2016_2921 301
318 3300045051 Ga0451576_0106051 Ga0451576_0106051_100_1005 301
319 3300045051 Ga0451576_0129878 Ga0451576_0129878_264_1169 301
320 3300045836 Ga0466958_0167448 Ga0466958_0167448_409_1314 301
321 3300046454 Ga0495592_0027699 Ga0495592_0027699_2657_3577 301
322 3300046455 Ga0495603_0005435 Ga0495603_0005435_1151_2074 301
323 3300046459 Ga0495629_0013426 Ga0495629_0013426_65_985 301
324 3300046459 Ga0495629_0090170 Ga0495629_0090170_881_1786 301
325 3300046462 Ga0495651_0020240 Ga0495651_0020240_4180_5100 301
326 3300046472 Ga0495580_0015061 Ga0495580_0015061_1467_2387 301
327 3300046473 Ga0495582_0046589 Ga0495582_0046589_95_1018 301
328 3300046475 Ga0495639_0054678 Ga0495639_0054678_732_1637 301
329 3300046491 Ga0495584_0164209 Ga0495584_0164209_98_1003 301
330 3300046499 Ga0495594_0043563 Ga0495594_0043563_1305_2228 301
331 3300046500 Ga0495596_0009787 Ga0495596_0009787_993_1913 301
332 3300046511 Ga0495608_0004765 Ga0495608_0004765_7917_8837 301
333 3300046516 Ga0495628_0094427 Ga0495628_0094427_1390_2295 301
334 3300046517 Ga0495630_0047049 Ga0495630_0047049_720_1625 301
335 3300046517 Ga0495630_0129844 Ga0495630_0129844_668_1588 301
336 3300046524 Ga0495648_0005025 Ga0495648_0005025_7666_8586 301
337 3300046526 Ga0495666_0040068 Ga0495666_0040068_354_1277 301
338 3300046529 Ga0495652_0022681 Ga0495652_0022681_3184_4104 301
339 3300046531 Ga0495665_0065218 Ga0495665_0065218_504_1424 301
340 3300046533 Ga0495640_0037176 Ga0495640_0037176_922_1842 301
341 3300046533 Ga0495640_0067732 Ga0495640_0067732_329_1234 301
342 3300046535 Ga0495586_0012607 Ga0495586_0012607_2827_3750 301
343 3300046536 Ga0495587_0003760 Ga0495587_0003760_7680_8600 301
344 3300046539 Ga0495621_0025194 Ga0495621_0025194_785_1690 301
345 3300046663 Ga0495635_0092872 Ga0495635_0092872_424_1344 301
346 3300046675 Ga0495657_0069390 Ga0495657_0069390_1231_2136 301
347 3300046680 Ga0495646_0017709 Ga0495646_0017709_1067_1987 301
348 3300046681 Ga0495647_0006502 Ga0495647_0006502_735_1658 301
349 3300046683 Ga0495658_0001994 Ga0495658_0001994_7718_8641 301
350 3300046684 Ga0495669_0003283 Ga0495669_0003283_3498_4403 301
351 3300046689 Ga0495613_0001914 Ga0495613_0001914_2297_3217 301
352 3300046690 Ga0495624_0056135 Ga0495624_0056135_1483_2388 301
353 3300046794 Ga0495589_0000671 Ga0495589_0000671_11493_12413 301
354 3300046809 Ga0495600_0017517 Ga0495600_0017517_2479_3399 301
355 3300047315 Ga0495581_0142785 Ga0495581_0142785_47_952 301
356 3300047317 Ga0495604_0026636 Ga0495604_0026636_66_986 301
357 3300047317 Ga0495604_0071789 Ga0495604_0071789_1065_1970 301
358 3300047318 Ga0495636_0002675 Ga0495636_0002675_1394_2299 301
359 3300047318 Ga0495636_0076523 Ga0495636_0076523_35_940 301
360 3300047319 Ga0495674_0112009 Ga0495674_0112009_869_1789 301
361 3300047321 Ga0495676_0026508 Ga0495676_0026508_3441_4364 301
362 3300047321 Ga0495676_0039551 Ga0495676_0039551_1782_2702 301
363 3300047323 Ga0495683_0001150 Ga0495683_0001150_13971_14891 301
364 3300047444 Ga0495675_0000759 Ga0495675_0000759_10005_10925 301
365 3300047446 Ga0495679_035729 Ga0495679_035729_501_1421 301
366 3300047469 Ga0495673_0001825 Ga0495673_0001825_431_1351 301
367 3300047673 Ga0495593_0001429 Ga0495593_0001429_245_1165 301
368 3300048088 Ga0495602_0003332 Ga0495602_0003332_6728_7648 301
369 3300048909 Ga0496106_0134480 Ga0496106_0134480_199_1122 301
370 3300049568 Ga0501031_0016698 Ga0501031_0016698_470_1393 301
371 3300049569 Ga0501032_0000024 Ga0501032_0000024_116017_116934 301
372 3300049570 Ga0501033_0000090 Ga0501033_0000090_27988_28905 301
373 3300049570 Ga0501033_0002540 Ga0501033_0002540_7049_7972 301
374 3300049571 Ga0501034_0000140 Ga0501034_0000140_65875_66792 301
375 3300049571 Ga0501034_0017653 Ga0501034_0017653_2320_3237 301
376 3300049571 Ga0501034_0073343 Ga0501034_0073343_549_1472 301
377 3300049572 Ga0501036_0003542 Ga0501036_0003542_4905_5822 301
378 3300049572 Ga0501036_0003547 Ga0501036_0003547_6754_7677 301
379 3300049573 Ga0501037_0000024 Ga0501037_0000024_87671_88588 301
380 3300049573 Ga0501037_0010375 Ga0501037_0010375_4630_5553 301
381 3300049574 Ga0501038_0000197 Ga0501038_0000197_23988_24905 301
382 3300049575 Ga0501039_0000017 Ga0501039_0000017_115832_116749 301
383 3300049575 Ga0501039_0000199 Ga0501039_0000199_13869_14792 301
384 3300049575 Ga0501039_0010321 Ga0501039_0010321_784_1695 301
385 3300049575 Ga0501039_0016516 Ga0501039_0016516_2439_3350 301
386 3300049575 Ga0501039_0043849 Ga0501039_0043849_1081_1995 301
387 3300049575 Ga0501039_0056452 Ga0501039_0056452_574_1485 301
388 3300049576 Ga0501040_0000082 Ga0501040_0000082_38876_39799 301
389 3300049576 Ga0501040_0011783 Ga0501040_0011783_1051_1962 301
390 3300049576 Ga0501040_0256025 Ga0501040_0256025_139_1050 301
391 3300049577 Ga0501041_0000410 Ga0501041_0000410_13470_14393 301
392 3300049577 Ga0501041_0028889 Ga0501041_0028889_124_1038 301
393 3300049578 Ga0501042_0003570 Ga0501042_0003570_7055_7978 301
394 3300049578 Ga0501042_0020484 Ga0501042_0020484_2490_3404 301
395 3300049578 Ga0501042_0024125 Ga0501042_0024125_973_1884 301
396 3300049579 Ga0501043_0004093 Ga0501043_0004093_503_1420 301
397 3300049579 Ga0501043_0008049 Ga0501043_0008049_527_1450 301
398 3300049579 Ga0501043_0224322 Ga0501043_0224322_323_1240 301
399 3300049580 Ga0501046_0006832 Ga0501046_0006832_8304_9227 301
400 3300049581 Ga0501047_0010304 Ga0501047_0010304_6455_7372 301
401 3300049581 Ga0501047_0107094 Ga0501047_0107094_608_1531 301
402 3300049581 Ga0501047_0261245 Ga0501047_0261245_344_1261 301
403 3300049582 Ga0501048_0001243 Ga0501048_0001243_11311_12234 301
404 3300049582 Ga0501048_0033077 Ga0501048_0033077_2125_3036 301
405 3300049582 Ga0501048_0046217 Ga0501048_0046217_598_1512 301
406 3300049582 Ga0501048_0072281 Ga0501048_0072281_875_1786 301
407 3300049587 Ga0501071_0008661 Ga0501071_0008661_4467_5390 301
408 3300049587 Ga0501071_0014198 Ga0501071_0014198_3113_4027 301
409 3300049588 Ga0501072_0002099 Ga0501072_0002099_10360_11271 301
410 3300049588 Ga0501072_0007920 Ga0501072_0007920_6916_7839 301
411 3300049588 Ga0501072_0046888 Ga0501072_0046888_2289_3203 301
412 3300049588 Ga0501072_0097956 Ga0501072_0097956_1206_2117 301
413 3300049590 Ga0501074_0001772 Ga0501074_0001772_5128_6051 301
414 3300049591 Ga0501075_0000696 Ga0501075_0000696_4405_5328 301
415 3300049591 Ga0501075_0001299 Ga0501075_0001299_13452_14363 301
416 3300049591 Ga0501075_0009119 Ga0501075_0009119_124_1038 301
417 3300049591 Ga0501075_0065318 Ga0501075_0065318_934_1845 301
418 3300049592 Ga0501076_0000856 Ga0501076_0000856_7286_8209 301
419 3300049592 Ga0501076_0000922 Ga0501076_0000922_6900_7811 301
420 3300049593 Ga0501077_0022401 Ga0501077_0022401_1436_2359 301
421 3300049741 Ga0501079_0000165 Ga0501079_0000165_7062_7985 301
422 3300049741 Ga0501079_0006707 Ga0501079_0006707_6858_7772 301
423 3300049741 Ga0501079_0042767 Ga0501079_0042767_1042_1953 301
424 3300049742 Ga0501080_0029215 Ga0501080_0029215_1020_1934 301
425 3300049742 Ga0501080_0036464 Ga0501080_0036464_1281_2204 301
426 3300049742 Ga0501080_0273878 Ga0501080_0273878_598_1503 301
427 3300049743 Ga0501081_0001217 Ga0501081_0001217_7055_7978 301
428 3300049743 Ga0501081_0002100 Ga0501081_0002100_3998_4909 301
429 3300049743 Ga0501081_0020447 Ga0501081_0020447_1552_2466 301
430 3300049743 Ga0501081_0032760 Ga0501081_0032760_1509_2420 301
431 3300049743 Ga0501081_0101061 Ga0501081_0101061_324_1235 301
432 3300049822 Ga0501035_0000021 Ga0501035_0000021_92349_93266 301
433 3300049822 Ga0501035_0076614 Ga0501035_0076614_684_1607 301
434 3300049822 Ga0501035_0126425 Ga0501035_0126425_224_1135 301
435 3300049824 Ga0501045_0000012 Ga0501045_0000012_6972_7895 301
436 3300049824 Ga0501045_0000154 Ga0501045_0000154_23011_23925 301
437 3300049824 Ga0501045_0026584 Ga0501045_0026584_786_1697 301
438 3300049824 Ga0501045_0106335 Ga0501045_0106335_620_1531 301
439 3300050507 nmdc:mga05p37_113855_c1 nmdc:mga05p37_113855_c1_1660_2565 301
440 3300050507 nmdc:mga05p37_150198_c1 nmdc:mga05p37_150198_c1_1539_2450 301
441 3300050507 nmdc:mga05p37_623_c1 nmdc:mga05p37_623_c1_26971_27894 301
442 3300050508 nmdc:mga09592_1081_c1 nmdc:mga09592_1081_c1_2309_3214 301
443 3300050508 nmdc:mga09592_139675_c1 nmdc:mga09592_139675_c1_512_1417 301
444 3300050508 nmdc:mga09592_2644_c1 nmdc:mga09592_2644_c1_4589_5512 301
445 3300050509 nmdc:mga0qj67_101644_c1 nmdc:mga0qj67_101644_c1_423_1328 301
446 3300050509 nmdc:mga0qj67_10939_c1 nmdc:mga0qj67_10939_c1_802_1713 301
447 3300050509 nmdc:mga0qj67_58315_c1 nmdc:mga0qj67_58315_c1_894_1799 301
448 3300050510 nmdc:mga06r32_143478_c1 nmdc:mga06r32_143478_c1_1007_1912 301
449 3300050510 nmdc:mga06r32_204832_c1 nmdc:mga06r32_204832_c1_972_1877 301
450 3300050510 nmdc:mga06r32_216119_c1 nmdc:mga06r32_216119_c1_134_1045 301
451 3300050511 nmdc:mga08y16_11393_c1 nmdc:mga08y16_11393_c1_561_1466 301
452 3300050511 nmdc:mga08y16_165879_c1 nmdc:mga08y16_165879_c1_1121_2026 301
453 3300050511 nmdc:mga08y16_18821_c1 nmdc:mga08y16_18821_c1_6358_7263 301
454 3300050511 nmdc:mga08y16_23213_c1 nmdc:mga08y16_23213_c1_1274_2197 301
455 3300050511 nmdc:mga08y16_293350_c1 nmdc:mga08y16_293350_c1_72_977 301
456 3300050511 nmdc:mga08y16_39231_c1 nmdc:mga08y16_39231_c1_209_1132 301
457 3300050512 nmdc:mga0n895_29872_c1 nmdc:mga0n895_29872_c1_1297_2220 301
458 3300050512 nmdc:mga0n895_3455_c1 nmdc:mga0n895_3455_c1_5619_6524 301
459 3300050513 nmdc:mga0rr50_10819_c1 nmdc:mga0rr50_10819_c1_704_1609 301
460 3300050513 nmdc:mga0rr50_2773_c1 nmdc:mga0rr50_2773_c1_4253_5176 301
461 3300050514 nmdc:mga08x19_21311_c1 nmdc:mga08x19_21311_c1_1762_2667 301
462 3300050514 nmdc:mga08x19_2340_c1 nmdc:mga08x19_2340_c1_2486_3391 301
463 3300050514 nmdc:mga08x19_3542_c1 nmdc:mga08x19_3542_c1_6993_7916 301
464 3300050514 nmdc:mga08x19_4566_c1 nmdc:mga08x19_4566_c1_3130_4044 301
465 3300050515 nmdc:mga0a205_956_c1 nmdc:mga0a205_956_c1_5060_5983 301
466 3300053077 Ga0495601_0152613 Ga0495601_0152613_100_1005 301
467 3300054114 Ga0501084_0000200 Ga0501084_0000200_38554_39477 301
468 3300054114 Ga0501084_0022056 Ga0501084_0022056_2694_3605 301
469 3300060353 Ga0501082_0022004 Ga0501082_0022004_1496_2419 301
470 3300060353 Ga0501082_0030307 Ga0501082_0030307_529_1443 301
471 3300061734 Ga0530510_0000977 Ga0530510_0000977_16961_17872 301
472 3300061734 Ga0530510_0003503 Ga0530510_0003503_8546_9460 301
473 3300061734 Ga0530510_0040875 Ga0530510_0040875_1773_2696 301
474 iso_pu_bacteria 2728368998 2728754123 301
475 iso_pu_bacteria 2929520902 2929524166 301
476 iso_pu_bacteria 2842677519 2842682669 305
477 3300003187 JGI25151J46595_10000775 JGI25151J46595_1000077520 309
478 3300009036 Ga0105244_10107821 Ga0105244_101078211 309
479 3300025258 Ga0209129_1005606 Ga0209129_10056062 309
480 3300025294 Ga0209025_1000122 Ga0209025_100012227 309
481 3300050496 nmdc:mga07m45_58766_c1 nmdc:mga07m45_58766_c1_650_1579 309
482 3300053079 Ga0500610_0001230 Ga0500610_0001230_2923_3852 309
483 3300053122 Ga0500608_092181 Ga0500608_092181_79_1008 309
484 3300053136 Ga0500559_0012754 Ga0500559_0012754_2271_3200 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

228

0.92

PF08659

KR

KR domain

30

209

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

277

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9386 2 283
1gz6-assembly2.cif.gz_C (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9349 2 283
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9289 2 250
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9278 5 249
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.927 2 250
ID Description Score Start End Superfamily
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 1 259 3.40.50.720
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.948 2 256 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9289 2 250 3.40.50.720
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.926 5 295 3.40.50.720
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9247 2 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.9636 1 196 GO:0016491
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.9601 2 200 GO:0016616
GO:0030497
AF-A0A5C7XHG4-F1-model_v4 SDR family oxidoreductase 0.9595 2 196 GO:0016491
AF-A0A428UDL8-F1-model_v4 Peroxisomal hydratase-dehydrogenase-epimerase 0.9572 3 257 GO:0005777
GO:0006635
GO:0016491
GO:0016829
AF-A0A2V8EYB2-F1-model_v4 Oxidoreductase 0.9565 55 198 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.4 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map