F452875
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 282 | 481 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10013296|Ga0065707_100132963 |
| Length | 330 |
| Sequence | LNGPRCCAWWRDATRASAIDPEKVSQLSGKAVLVTGAGGGIGRDFALAMAAAGASVLVNDIGTSVKGEGSXAGPAQKVADEINKTFEAAGARAVANTDSVAQWESANRIVTNALDAFGRIDVVINNAGILRDRFFFNMSVEEWRAVIDVHLNGSFYVARAAAPHFKSQESGCYIHMTSTSGLIGNLGQANYSAAKLGVAGLSKSIALDMAKFRVRSNCISPFAWSRMIGSIPTETDDQKARVEKLKSMETAKIAPLAVYLASDHGKEVSGQIFAVRANEIFLMGQSRPLRSVHRAEGWTPETIGAHAIPALRAHFYPLERSQDVFSWDPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 2 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 3 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 138 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 139 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 153 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 177 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 178 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 179 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 180 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 277 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 279 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.72 |
| Nodule | 0.41 |
| Rhizoplane | 0.41 |
| Rhizosphere | 92.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000775 | 3300003187 | Bacteria | 25895 |
| 2 | JGI25406J46586_10022242 | 3300003203 | Bacteria | 2531 |
| 3 | Ga0055536_1004919 | 3300003781 | Bacteria | 6658 |
| 4 | Ga0055540_1020404 | 3300003792 | Bacteria | 1752 |
| 5 | Ga0065707_10002391 | 3300005295 | Bacteria | 5639 |
| 6 | Ga0065707_10013296 | 3300005295 | Bacteria | 2863 |
| 7 | Ga0070690_100001335 | 3300005330 | Bacteria | 12819 |
| 8 | Ga0070677_10099363 | 3300005333 | Bacteria | 1280 |
| 9 | Ga0068869_100002111 | 3300005334 | Bacteria | 11951 |
| 10 | Ga0070680_100001466 | 3300005336 | Bacteria | 17116 |
| 11 | Ga0070680_100052982 | 3300005336 | Bacteria | 3311 |
| 12 | Ga0070682_100007419 | 3300005337 | Bacteria | 6185 |
| 13 | Ga0068868_100007062 | 3300005338 | Bacteria | 7982 |
| 14 | Ga0070689_100001640 | 3300005340 | Bacteria | 14310 |
| 15 | Ga0070689_100040634 | 3300005340 | Bacteria | 3567 |
| 16 | Ga0070687_100000392 | 3300005343 | Bacteria | 14882 |
| 17 | Ga0070692_10012504 | 3300005345 | Bacteria | 3930 |
| 18 | Ga0070692_10017056 | 3300005345 | Bacteria | 3465 |
| 19 | Ga0070669_100021278 | 3300005353 | Bacteria | 4636 |
| 20 | Ga0070669_100101101 | 3300005353 | Bacteria | 2175 |
| 21 | Ga0070675_100113004 | 3300005354 | Bacteria | 2300 |
| 22 | Ga0070675_100374206 | 3300005354 | Bacteria | 1267 |
| 23 | Ga0070703_10006581 | 3300005406 | Bacteria | 3257 |
| 24 | Ga0070701_10001104 | 3300005438 | Bacteria | 9860 |
| 25 | Ga0070705_100000198 | 3300005440 | Bacteria | 35654 |
| 26 | Ga0070705_100007580 | 3300005440 | Bacteria | 5346 |
| 27 | Ga0070705_100118894 | 3300005440 | Bacteria | 1703 |
| 28 | Ga0070705_100262462 | 3300005440 | Bacteria | 1219 |
| 29 | Ga0070700_100000336 | 3300005441 | Bacteria | 24375 |
| 30 | Ga0070700_100000389 | 3300005441 | Bacteria | 22607 |
| 31 | Ga0070694_100003027 | 3300005444 | Bacteria | 10010 |
| 32 | Ga0070694_100007226 | 3300005444 | Bacteria | 6762 |
| 33 | Ga0070694_100056234 | 3300005444 | Bacteria | 2672 |
| 34 | Ga0070681_10000676 | 3300005458 | Bacteria | 28267 |
| 35 | Ga0068867_100000780 | 3300005459 | Bacteria | 21510 |
| 36 | Ga0068867_100024393 | 3300005459 | Bacteria | 4333 |
| 37 | Ga0070707_100178057 | 3300005468 | Bacteria | 2073 |
| 38 | Ga0070698_100063760 | 3300005471 | Bacteria | 3715 |
| 39 | Ga0070699_100070943 | 3300005518 | Bacteria | 3029 |
| 40 | Ga0070699_100143102 | 3300005518 | Bacteria | 2113 |
| 41 | Ga0070679_100012766 | 3300005530 | Bacteria | 8037 |
| 42 | Ga0070672_100344751 | 3300005543 | Bacteria | 1269 |
| 43 | Ga0070686_100001108 | 3300005544 | Bacteria | 15487 |
| 44 | Ga0070695_100000292 | 3300005545 | Bacteria | 25201 |
| 45 | Ga0070695_100003027 | 3300005545 | Bacteria | 9794 |
| 46 | Ga0070695_100184673 | 3300005545 | Bacteria | 1480 |
| 47 | Ga0070696_100000489 | 3300005546 | Bacteria | 24889 |
| 48 | Ga0070696_100015085 | 3300005546 | Bacteria | 5188 |
| 49 | Ga0070696_100093320 | 3300005546 | Bacteria | 2146 |
| 50 | Ga0070696_100100523 | 3300005546 | Bacteria | 2072 |
| 51 | Ga0070696_100222879 | 3300005546 | Bacteria | 1415 |
| 52 | Ga0070693_100000126 | 3300005547 | Bacteria | 34382 |
| 53 | Ga0070693_100314639 | 3300005547 | Bacteria | 1060 |
| 54 | Ga0070704_100001261 | 3300005549 | Bacteria | 13342 |
| 55 | Ga0070704_100002806 | 3300005549 | Bacteria | 9865 |
| 56 | Ga0070704_100041955 | 3300005549 | Bacteria | 3162 |
| 57 | Ga0070704_100065499 | 3300005549 | Bacteria | 2616 |
| 58 | Ga0070704_100213573 | 3300005549 | Bacteria | 1565 |
| 59 | Ga0068855_100026989 | 3300005563 | Bacteria | 6871 |
| 60 | Ga0068857_100409470 | 3300005577 | Bacteria | 1263 |
| 61 | Ga0068854_100005630 | 3300005578 | Bacteria | 7912 |
| 62 | Ga0068854_100013930 | 3300005578 | Bacteria | 5289 |
| 63 | Ga0068856_100031945 | 3300005614 | Bacteria | 5151 |
| 64 | Ga0068856_100132085 | 3300005614 | Bacteria | 2502 |
| 65 | Ga0070702_100001105 | 3300005615 | Bacteria | 10801 |
| 66 | Ga0070702_100090832 | 3300005615 | Bacteria | 1852 |
| 67 | Ga0068852_100095314 | 3300005616 | Bacteria | 2672 |
| 68 | Ga0068852_100489358 | 3300005616 | Bacteria | 1223 |
| 69 | Ga0068859_100010604 | 3300005617 | Bacteria | 9274 |
| 70 | Ga0068859_100288531 | 3300005617 | Bacteria | 1734 |
| 71 | Ga0068864_100037077 | 3300005618 | Bacteria | 4159 |
| 72 | Ga0068866_10003537 | 3300005718 | Bacteria | 6399 |
| 73 | Ga0068866_10006743 | 3300005718 | Bacteria | 4787 |
| 74 | Ga0068861_100000316 | 3300005719 | Bacteria | 27077 |
| 75 | Ga0068861_100006140 | 3300005719 | Bacteria | 8174 |
| 76 | Ga0068870_10061354 | 3300005840 | Bacteria | 2021 |
| 77 | Ga0068863_100002399 | 3300005841 | Bacteria | 18633 |
| 78 | Ga0068863_100021294 | 3300005841 | Bacteria | 6188 |
| 79 | Ga0068863_100106776 | 3300005841 | Bacteria | 2664 |
| 80 | Ga0068863_100497046 | 3300005841 | Bacteria | 1201 |
| 81 | Ga0068858_100018197 | 3300005842 | Bacteria | 6579 |
| 82 | Ga0068860_100008921 | 3300005843 | Bacteria | 9991 |
| 83 | Ga0068862_100002813 | 3300005844 | Bacteria | 15253 |
| 84 | Ga0068862_100006610 | 3300005844 | Bacteria | 9617 |
| 85 | Ga0081539_10006772 | 3300005985 | Bacteria | 10754 |
| 86 | Ga0075362_10001585 | 3300006177 | Bacteria | 7366 |
| 87 | Ga0075366_10025280 | 3300006195 | Bacteria | 3467 |
| 88 | Ga0097621_100002057 | 3300006237 | Bacteria | 13759 |
| 89 | Ga0075370_10003457 | 3300006353 | Bacteria | 7524 |
| 90 | Ga0068871_100004146 | 3300006358 | Bacteria | 10029 |
| 91 | Ga0075428_100001001 | 3300006844 | Bacteria | 29943 |
| 92 | Ga0075428_100033666 | 3300006844 | Bacteria | 5656 |
| 93 | Ga0075428_100214360 | 3300006844 | Bacteria | 2080 |
| 94 | Ga0075428_100427312 | 3300006844 | Bacteria | 1419 |
| 95 | Ga0075430_100000318 | 3300006846 | Bacteria | 34303 |
| 96 | Ga0075430_100009635 | 3300006846 | Bacteria | 8163 |
| 97 | Ga0075430_100118227 | 3300006846 | Bacteria | 2209 |
| 98 | Ga0075430_100241071 | 3300006846 | Bacteria | 1498 |
| 99 | Ga0075431_100050300 | 3300006847 | Bacteria | 4297 |
| 100 | Ga0075431_100426171 | 3300006847 | Bacteria | 1325 |
| 101 | Ga0075433_10000441 | 3300006852 | Bacteria | 26831 |
| 102 | Ga0075434_100013244 | 3300006871 | Bacteria | 7838 |
| 103 | Ga0075434_100022149 | 3300006871 | Bacteria | 6189 |
| 104 | Ga0075434_100031718 | 3300006871 | Bacteria | 5210 |
| 105 | Ga0075429_100000363 | 3300006880 | Bacteria | 33387 |
| 106 | Ga0075429_100019170 | 3300006880 | Bacteria | 5927 |
| 107 | Ga0075429_100193940 | 3300006880 | Bacteria | 1779 |
| 108 | Ga0075429_100370617 | 3300006880 | Bacteria | 1254 |
| 109 | Ga0068865_100001740 | 3300006881 | Bacteria | 12775 |
| 110 | Ga0068865_100003157 | 3300006881 | Bacteria | 9864 |
| 111 | Ga0075436_100001646 | 3300006914 | Bacteria | 15264 |
| 112 | Ga0075436_100003099 | 3300006914 | Bacteria | 11396 |
| 113 | Ga0097620_100010604 | 3300006931 | Bacteria | 9274 |
| 114 | Ga0097620_100288550 | 3300006931 | Bacteria | 1734 |
| 115 | Ga0099822_1019647 | 3300006943 | Bacteria | 6839 |
| 116 | Ga0075435_100008938 | 3300007076 | Bacteria | 7220 |
| 117 | Ga0075435_100029975 | 3300007076 | Bacteria | 4275 |
| 118 | Ga0075435_100306769 | 3300007076 | Bacteria | 1358 |
| 119 | Ga0099794_10016869 | 3300007265 | Bacteria | 3245 |
| 120 | Ga0105244_10107821 | 3300009036 | Bacteria | 1358 |
| 121 | Ga0105240_10312357 | 3300009093 | Bacteria | 1794 |
| 122 | Ga0111539_10025413 | 3300009094 | Bacteria | 7260 |
| 123 | Ga0111539_10046079 | 3300009094 | Bacteria | 5218 |
| 124 | Ga0111539_10101418 | 3300009094 | Bacteria | 3379 |
| 125 | Ga0111539_10227637 | 3300009094 | Bacteria | 2171 |
| 126 | Ga0111539_10276391 | 3300009094 | Bacteria | 1954 |
| 127 | Ga0114129_10001363 | 3300009147 | Bacteria | 32838 |
| 128 | Ga0114129_10049369 | 3300009147 | Bacteria | 5912 |
| 129 | Ga0114129_10483905 | 3300009147 | Bacteria | 1619 |
| 130 | Ga0105243_10001362 | 3300009148 | Bacteria | 21682 |
| 131 | Ga0105243_10003557 | 3300009148 | Bacteria | 12582 |
| 132 | Ga0105243_10004111 | 3300009148 | Bacteria | 11567 |
| 133 | Ga0105242_10009425 | 3300009176 | Bacteria | 7483 |
| 134 | Ga0105248_10000080 | 3300009177 | Bacteria | 111519 |
| 135 | Ga0105237_10381542 | 3300009545 | Bacteria | 1414 |
| 136 | Ga0105249_10011474 | 3300009553 | Bacteria | 7782 |
| 137 | Ga0157374_10086939 | 3300013296 | Bacteria | 2975 |
| 138 | Ga0157378_10001643 | 3300013297 | Bacteria | 20215 |
| 139 | Ga0163162_10514382 | 3300013306 | Bacteria | 1327 |
| 140 | Ga0157375_10139409 | 3300013308 | Bacteria | 2551 |
| 141 | Ga0157380_10001588 | 3300014326 | Bacteria | 14979 |
| 142 | Ga0157377_10006333 | 3300014745 | Bacteria | 5637 |
| 143 | Ga0157379_10057756 | 3300014968 | Bacteria | 3468 |
| 144 | Ga0157376_10025135 | 3300014969 | Bacteria | 4688 |
| 145 | Ga0163161_10079405 | 3300017792 | Bacteria | 2413 |
| 146 | Ga0213875_10008932 | 3300021388 | Bacteria | 5105 |
| 147 | Ga0209129_1005606 | 3300025258 | Bacteria | 4368 |
| 148 | Ga0209676_1000173 | 3300025292 | Bacteria | 153411 |
| 149 | Ga0209025_1000122 | 3300025294 | Bacteria | 206064 |
| 150 | Ga0209051_1000282 | 3300025303 | Bacteria | 82787 |
| 151 | Ga0207653_10019749 | 3300025885 | Bacteria | 2126 |
| 152 | Ga0207682_10064255 | 3300025893 | Bacteria | 1542 |
| 153 | Ga0207642_10000598 | 3300025899 | Bacteria | 11081 |
| 154 | Ga0207642_10042479 | 3300025899 | Bacteria | 1998 |
| 155 | Ga0207688_10008796 | 3300025901 | Bacteria | 5493 |
| 156 | Ga0207643_10054465 | 3300025908 | Bacteria | 2274 |
| 157 | Ga0207643_10111980 | 3300025908 | Bacteria | 1609 |
| 158 | Ga0207707_10001702 | 3300025912 | Bacteria | 20238 |
| 159 | Ga0207662_10001169 | 3300025918 | Bacteria | 12456 |
| 160 | Ga0207662_10051326 | 3300025918 | Bacteria | 2454 |
| 161 | Ga0207652_10006354 | 3300025921 | Bacteria | 9542 |
| 162 | Ga0207646_10161258 | 3300025922 | Bacteria | 2024 |
| 163 | Ga0207681_10009570 | 3300025923 | Bacteria | 5923 |
| 164 | Ga0207681_10074228 | 3300025923 | Bacteria | 2382 |
| 165 | Ga0207659_10264597 | 3300025926 | Bacteria | 1400 |
| 166 | Ga0207687_10013680 | 3300025927 | Bacteria | 5298 |
| 167 | Ga0207706_10008024 | 3300025933 | Bacteria | 9741 |
| 168 | Ga0207706_10049025 | 3300025933 | Bacteria | 3733 |
| 169 | Ga0207686_10024001 | 3300025934 | Bacteria | 3527 |
| 170 | Ga0207709_10000285 | 3300025935 | Bacteria | 57630 |
| 171 | Ga0207709_10001943 | 3300025935 | Bacteria | 13531 |
| 172 | Ga0207709_10002633 | 3300025935 | Bacteria | 11161 |
| 173 | Ga0207670_10001333 | 3300025936 | Bacteria | 13035 |
| 174 | Ga0207669_10032730 | 3300025937 | Bacteria | 2924 |
| 175 | Ga0207704_10002408 | 3300025938 | Bacteria | 8412 |
| 176 | Ga0207704_10010636 | 3300025938 | Bacteria | 4496 |
| 177 | Ga0207691_10308439 | 3300025940 | Bacteria | 1359 |
| 178 | Ga0207689_10003864 | 3300025942 | Bacteria | 13653 |
| 179 | Ga0207667_10026105 | 3300025949 | Bacteria | 6387 |
| 180 | Ga0207712_10058912 | 3300025961 | Bacteria | 2716 |
| 181 | Ga0207712_10060628 | 3300025961 | Bacteria | 2683 |
| 182 | Ga0207640_10015619 | 3300025981 | Bacteria | 4400 |
| 183 | Ga0207677_10005202 | 3300026023 | Bacteria | 7042 |
| 184 | Ga0207703_10018476 | 3300026035 | Bacteria | 5444 |
| 185 | Ga0207708_10001410 | 3300026075 | Bacteria | 18034 |
| 186 | Ga0207708_10011960 | 3300026075 | Bacteria | 6465 |
| 187 | Ga0207702_10094050 | 3300026078 | Bacteria | 2630 |
| 188 | Ga0207702_10564736 | 3300026078 | Bacteria | 1114 |
| 189 | Ga0207641_10002789 | 3300026088 | Bacteria | 15906 |
| 190 | Ga0207641_10010788 | 3300026088 | Bacteria | 7490 |
| 191 | Ga0207641_10110716 | 3300026088 | Bacteria | 2434 |
| 192 | Ga0207648_10000359 | 3300026089 | Bacteria | 50214 |
| 193 | Ga0207648_10004228 | 3300026089 | Bacteria | 14837 |
| 194 | Ga0207674_10198208 | 3300026116 | Bacteria | 1957 |
| 195 | Ga0207674_10344607 | 3300026116 | Bacteria | 1441 |
| 196 | Ga0207675_100006845 | 3300026118 | Bacteria | 10795 |
| 197 | Ga0207675_100022734 | 3300026118 | Bacteria | 5834 |
| 198 | Ga0207675_100412789 | 3300026118 | Bacteria | 1332 |
| 199 | Ga0209969_1001779 | 3300027360 | Bacteria | 2965 |
| 200 | Ga0209967_1000362 | 3300027364 | Bacteria | 6026 |
| 201 | Ga0209981_1001593 | 3300027378 | Bacteria | 2872 |
| 202 | Ga0209996_1002375 | 3300027395 | Bacteria | 2330 |
| 203 | Ga0210000_1002987 | 3300027462 | Bacteria | 2419 |
| 204 | Ga0210000_1003453 | 3300027462 | Bacteria | 2277 |
| 205 | Ga0210000_1017807 | 3300027462 | Bacteria | 1078 |
| 206 | Ga0209995_1002504 | 3300027471 | Bacteria | 2907 |
| 207 | Ga0209995_1007846 | 3300027471 | Bacteria | 1721 |
| 208 | Ga0209968_1001234 | 3300027526 | Bacteria | 3906 |
| 209 | Ga0209999_1010737 | 3300027543 | Bacteria | 1655 |
| 210 | Ga0207428_10001380 | 3300027907 | Bacteria | 25677 |
| 211 | Ga0207428_10029000 | 3300027907 | Bacteria | 4592 |
| 212 | Ga0207428_10073712 | 3300027907 | Bacteria | 2678 |
| 213 | Ga0207428_10100876 | 3300027907 | Bacteria | 2231 |
| 214 | Ga0268265_10002908 | 3300028380 | Bacteria | 12578 |
| 215 | Ga0268265_10014302 | 3300028380 | Bacteria | 5405 |
| 216 | Ga0268264_10011730 | 3300028381 | Bacteria | 7226 |
| 217 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 218 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 219 | Ga0316176_1099358 | 3300030732 | Bacteria | 1653 |
| 220 | Ga0314311_1100549 | 3300030733 | Bacteria | 7564 |
| 221 | Ga0316183_1052990 | 3300030742 | Bacteria | 1264 |
| 222 | Ga0316183_1066259 | 3300030742 | Bacteria | 10511 |
| 223 | Ga0265327_10000186 | 3300031251 | Bacteria | 131420 |
| 224 | Ga0265327_10002083 | 3300031251 | Bacteria | 22333 |
| 225 | Ga0307513_10087432 | 3300031456 | Bacteria | 3190 |
| 226 | Ga0307408_100021136 | 3300031548 | Bacteria | 4401 |
| 227 | Ga0307408_100026766 | 3300031548 | Bacteria | 3966 |
| 228 | Ga0307408_100052489 | 3300031548 | Bacteria | 2940 |
| 229 | Ga0307408_100242580 | 3300031548 | Bacteria | 1482 |
| 230 | Ga0307408_100275514 | 3300031548 | Bacteria | 1399 |
| 231 | Ga0307516_10000095 | 3300031730 | Bacteria | 99115 |
| 232 | Ga0307516_10000099 | 3300031730 | Bacteria | 97472 |
| 233 | Ga0307516_10096212 | 3300031730 | Unclassified | 2782 |
| 234 | Ga0307405_10140624 | 3300031731 | Bacteria | 1682 |
| 235 | Ga0307413_10173798 | 3300031824 | Bacteria | 1528 |
| 236 | Ga0307412_10051021 | 3300031911 | Bacteria | 2732 |
| 237 | Ga0307416_100080689 | 3300032002 | Bacteria | 2747 |
| 238 | Ga0307416_100105440 | 3300032002 | Bacteria | 2467 |
| 239 | Ga0307411_10007321 | 3300032005 | Bacteria | 5607 |
| 240 | Ga0307415_100129780 | 3300032126 | Bacteria | 1906 |
| 241 | Ga0307510_10054817 | 3300033180 | Bacteria | 4171 |
| 242 | Ga0373950_0009707 | 3300034818 | Bacteria | 1542 |
| 243 | Ga0373959_0003430 | 3300034820 | Bacteria | 2524 |
| 244 | Ga0373938_0020408 | 3300034957 | Bacteria | 1334 |
| 245 | Ga0373926_0001812 | 3300035083 | Bacteria | 6630 |
| 246 | Ga0373928_0001984 | 3300035084 | Bacteria | 3987 |
| 247 | Ga0373929_0006228 | 3300035085 | Bacteria | 2155 |
| 248 | Ga0373934_0002883 | 3300035086 | Bacteria | 6288 |
| 249 | Ga0373940_0064212 | 3300035088 | Bacteria | 1056 |
| 250 | Ga0373944_0002250 | 3300035089 | Bacteria | 4909 |
| 251 | Ga0373932_0004217 | 3300035112 | Bacteria | 3414 |
| 252 | Ga0373936_0060804 | 3300035113 | Bacteria | 1541 |
| 253 | Ga0373939_0015992 | 3300035114 | Bacteria | 1972 |
| 254 | Ga0373945_0008885 | 3300035116 | Bacteria | 3283 |
| 255 | Ga0373943_0021735 | 3300035170 | Bacteria | 2965 |
| 256 | Ga0373955_0185223 | 3300035172 | Bacteria | 1236 |
| 257 | Ga0373942_0001086 | 3300035207 | Bacteria | 7288 |
| 258 | Ga0316574_0126592 | 3300035398 | Bacteria | 1642 |
| 259 | Ga0373931_0000352 | 3300035691 | Bacteria | 18923 |
| 260 | Ga0373931_0022874 | 3300035691 | Bacteria | 3149 |
| 261 | Ga0373935_0019277 | 3300035692 | Bacteria | 4160 |
| 262 | Ga0373927_0133562 | 3300035695 | Bacteria | 1621 |
| 263 | Ga0373933_0003079 | 3300035724 | Bacteria | 9300 |
| 264 | Ga0373933_0042632 | 3300035724 | Bacteria | 2683 |
| 265 | Ga0373933_0240571 | 3300035724 | Bacteria | 1164 |
| 266 | Ga0373947_0122875 | 3300035725 | Bacteria | 1650 |
| 267 | Ga0373937_0021997 | 3300036401 | Bacteria | 5726 |
| 268 | Ga0373937_0066211 | 3300036401 | Bacteria | 3326 |
| 269 | Ga0373937_0264835 | 3300036401 | Bacteria | 1621 |
| 270 | Ga0373925_0024962 | 3300037068 | Bacteria | 4365 |
| 271 | Ga0373925_0132039 | 3300037068 | Bacteria | 1948 |
| 272 | Ga0436364_0624342 | 3300037853 | Bacteria | 7200 |
| 273 | Ga0436364_0912133 | 3300037853 | Bacteria | 2151 |
| 274 | Ga0439453_0011083 | 3300041408 | Bacteria | 1498 |
| 275 | Ga0439441_021667 | 3300042001 | Bacteria | 1188 |
| 276 | Ga0439442_006848 | 3300042002 | Bacteria | 2287 |
| 277 | Ga0450923_010947 | 3300042125 | Bacteria | 1621 |
| 278 | Ga0450896_003533 | 3300042133 | Bacteria | 2084 |
| 279 | Ga0439434_0001312 | 3300042435 | Bacteria | 7160 |
| 280 | Ga0439434_0008759 | 3300042435 | Bacteria | 2973 |
| 281 | Ga0439435_0000387 | 3300042436 | Bacteria | 6792 |
| 282 | Ga0439435_0029824 | 3300042436 | Bacteria | 1475 |
| 283 | Ga0451577_0487950 | 3300042876 | Bacteria | 1119 |
| 284 | Ga0451576_0002819 | 3300045051 | Bacteria | 25036 |
| 285 | Ga0451576_0003913 | 3300045051 | Bacteria | 19889 |
| 286 | Ga0451576_0005813 | 3300045051 | Bacteria | 15340 |
| 287 | Ga0451576_0103848 | 3300045051 | Bacteria | 2956 |
| 288 | Ga0451576_0106051 | 3300045051 | Bacteria | 2924 |
| 289 | Ga0451576_0129878 | 3300045051 | Bacteria | 2626 |
| 290 | Ga0466958_0167448 | 3300045836 | Bacteria | 1391 |
| 291 | Ga0466967_0031196 | 3300045976 | Bacteria | 4484 |
| 292 | Ga0495592_0027699 | 3300046454 | Bacteria | 4293 |
| 293 | Ga0495603_0005435 | 3300046455 | Bacteria | 7605 |
| 294 | Ga0495629_0013426 | 3300046459 | Bacteria | 5909 |
| 295 | Ga0495629_0090170 | 3300046459 | Bacteria | 2139 |
| 296 | Ga0495651_0020240 | 3300046462 | Bacteria | 5164 |
| 297 | Ga0495580_0000006 | 3300046472 | Bacteria | 105024 |
| 298 | Ga0495580_0015061 | 3300046472 | Bacteria | 5850 |
| 299 | Ga0495582_0046589 | 3300046473 | Bacteria | 2388 |
| 300 | Ga0495639_0054678 | 3300046475 | Bacteria | 1820 |
| 301 | Ga0495662_0004705 | 3300046476 | Bacteria | 6835 |
| 302 | Ga0495584_0086116 | 3300046491 | Bacteria | 1583 |
| 303 | Ga0495584_0164209 | 3300046491 | Bacteria | 1129 |
| 304 | Ga0495594_0043563 | 3300046499 | Bacteria | 2460 |
| 305 | Ga0495596_0009787 | 3300046500 | Bacteria | 4204 |
| 306 | Ga0495608_0004765 | 3300046511 | Bacteria | 9704 |
| 307 | Ga0495628_0094427 | 3300046516 | Bacteria | 2312 |
| 308 | Ga0495628_0127253 | 3300046516 | Bacteria | 1951 |
| 309 | Ga0495630_0047049 | 3300046517 | Bacteria | 3226 |
| 310 | Ga0495630_0129844 | 3300046517 | Bacteria | 1913 |
| 311 | Ga0495648_0005025 | 3300046524 | Bacteria | 11115 |
| 312 | Ga0495666_0040068 | 3300046526 | Bacteria | 2272 |
| 313 | Ga0495652_0022681 | 3300046529 | Bacteria | 5570 |
| 314 | Ga0495665_0065218 | 3300046531 | Bacteria | 1922 |
| 315 | Ga0495640_0037176 | 3300046533 | Bacteria | 3436 |
| 316 | Ga0495640_0067732 | 3300046533 | Bacteria | 2404 |
| 317 | Ga0495586_0012607 | 3300046535 | Bacteria | 4484 |
| 318 | Ga0495587_0003760 | 3300046536 | Bacteria | 10066 |
| 319 | Ga0495621_0025194 | 3300046539 | Bacteria | 1997 |
| 320 | Ga0495656_0082281 | 3300046615 | Bacteria | 1455 |
| 321 | Ga0495668_0022663 | 3300046616 | Bacteria | 3588 |
| 322 | Ga0495635_0092872 | 3300046663 | Bacteria | 2064 |
| 323 | Ga0495657_0069390 | 3300046675 | Bacteria | 2307 |
| 324 | Ga0495646_0017709 | 3300046680 | Bacteria | 4516 |
| 325 | Ga0495647_0006502 | 3300046681 | Bacteria | 3874 |
| 326 | Ga0495658_0001994 | 3300046683 | Bacteria | 10406 |
| 327 | Ga0495669_0003283 | 3300046684 | Bacteria | 6659 |
| 328 | Ga0495669_0015769 | 3300046684 | Bacteria | 3235 |
| 329 | Ga0495613_0001914 | 3300046689 | Bacteria | 15792 |
| 330 | Ga0495624_0056135 | 3300046690 | Bacteria | 2479 |
| 331 | Ga0495671_0006751 | 3300046692 | Bacteria | 6607 |
| 332 | Ga0495589_0000671 | 3300046794 | Bacteria | 22395 |
| 333 | Ga0495600_0017517 | 3300046809 | Bacteria | 4558 |
| 334 | Ga0495581_0142785 | 3300047315 | Bacteria | 1397 |
| 335 | Ga0495604_0026636 | 3300047317 | Bacteria | 4601 |
| 336 | Ga0495604_0071789 | 3300047317 | Bacteria | 2618 |
| 337 | Ga0495636_0002675 | 3300047318 | Bacteria | 6880 |
| 338 | Ga0495636_0076523 | 3300047318 | Bacteria | 1435 |
| 339 | Ga0495674_0112009 | 3300047319 | Bacteria | 2312 |
| 340 | Ga0495676_0026508 | 3300047321 | Bacteria | 4988 |
| 341 | Ga0495676_0039551 | 3300047321 | Bacteria | 3905 |
| 342 | Ga0495683_0001150 | 3300047323 | Bacteria | 18197 |
| 343 | Ga0495675_0000759 | 3300047444 | Bacteria | 20203 |
| 344 | Ga0495679_035729 | 3300047446 | Bacteria | 1573 |
| 345 | Ga0495673_0001825 | 3300047469 | Bacteria | 16081 |
| 346 | Ga0495593_0001429 | 3300047673 | Bacteria | 14014 |
| 347 | Ga0495602_0003332 | 3300048088 | Bacteria | 16585 |
| 348 | Ga0496106_0134480 | 3300048909 | Bacteria | 1941 |
| 349 | Ga0496115_0068674 | 3300048918 | Bacteria | 2870 |
| 350 | Ga0496125_0005953 | 3300048928 | Bacteria | 13355 |
| 351 | Ga0501031_0016698 | 3300049568 | Bacteria | 4769 |
| 352 | Ga0501032_0000024 | 3300049569 | Bacteria | 143876 |
| 353 | Ga0501033_0000090 | 3300049570 | Bacteria | 86596 |
| 354 | Ga0501033_0002540 | 3300049570 | Bacteria | 15451 |
| 355 | Ga0501034_0000140 | 3300049571 | Bacteria | 134996 |
| 356 | Ga0501034_0017653 | 3300049571 | Bacteria | 7316 |
| 357 | Ga0501034_0073343 | 3300049571 | Bacteria | 3432 |
| 358 | Ga0501036_0003542 | 3300049572 | Bacteria | 12488 |
| 359 | Ga0501036_0003547 | 3300049572 | Bacteria | 12480 |
| 360 | Ga0501037_0000024 | 3300049573 | Bacteria | 146046 |
| 361 | Ga0501037_0010375 | 3300049573 | Bacteria | 6834 |
| 362 | Ga0501038_0000197 | 3300049574 | Bacteria | 51975 |
| 363 | Ga0501038_0198924 | 3300049574 | Bacteria | 1609 |
| 364 | Ga0501039_0000017 | 3300049575 | Bacteria | 189412 |
| 365 | Ga0501039_0000199 | 3300049575 | Bacteria | 43314 |
| 366 | Ga0501039_0010321 | 3300049575 | Bacteria | 7124 |
| 367 | Ga0501039_0016516 | 3300049575 | Bacteria | 5654 |
| 368 | Ga0501039_0043849 | 3300049575 | Bacteria | 3455 |
| 369 | Ga0501039_0056452 | 3300049575 | Bacteria | 3042 |
| 370 | Ga0501039_0296228 | 3300049575 | Bacteria | 1272 |
| 371 | Ga0501040_0000082 | 3300049576 | Bacteria | 46447 |
| 372 | Ga0501040_0011783 | 3300049576 | Bacteria | 5721 |
| 373 | Ga0501040_0256025 | 3300049576 | Bacteria | 1249 |
| 374 | Ga0501041_0000410 | 3300049577 | Bacteria | 21637 |
| 375 | Ga0501041_0028889 | 3300049577 | Bacteria | 3346 |
| 376 | Ga0501042_0003570 | 3300049578 | Bacteria | 9797 |
| 377 | Ga0501042_0020484 | 3300049578 | Bacteria | 4603 |
| 378 | Ga0501042_0024125 | 3300049578 | Bacteria | 4264 |
| 379 | Ga0501042_0044025 | 3300049578 | Bacteria | 3180 |
| 380 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 381 | Ga0501043_0004093 | 3300049579 | Bacteria | 11913 |
| 382 | Ga0501043_0008049 | 3300049579 | Bacteria | 8323 |
| 383 | Ga0501043_0224322 | 3300049579 | Bacteria | 1453 |
| 384 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 385 | Ga0501046_0006832 | 3300049580 | Bacteria | 10066 |
| 386 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 387 | Ga0501047_0010304 | 3300049581 | Bacteria | 8839 |
| 388 | Ga0501047_0107094 | 3300049581 | Bacteria | 2677 |
| 389 | Ga0501047_0261245 | 3300049581 | Bacteria | 1579 |
| 390 | Ga0501048_0000414 | 3300049582 | Bacteria | 29908 |
| 391 | Ga0501048_0001243 | 3300049582 | Bacteria | 19319 |
| 392 | Ga0501048_0033077 | 3300049582 | Bacteria | 3737 |
| 393 | Ga0501048_0046217 | 3300049582 | Bacteria | 3108 |
| 394 | Ga0501048_0059112 | 3300049582 | Bacteria | 2717 |
| 395 | Ga0501048_0072281 | 3300049582 | Bacteria | 2435 |
| 396 | Ga0501071_0008661 | 3300049587 | Bacteria | 6729 |
| 397 | Ga0501071_0014198 | 3300049587 | Bacteria | 5446 |
| 398 | Ga0501072_0002099 | 3300049588 | Bacteria | 14843 |
| 399 | Ga0501072_0007920 | 3300049588 | Bacteria | 8067 |
| 400 | Ga0501072_0046888 | 3300049588 | Bacteria | 3402 |
| 401 | Ga0501072_0097956 | 3300049588 | Bacteria | 2331 |
| 402 | Ga0501074_0001772 | 3300049590 | Bacteria | 14753 |
| 403 | Ga0501075_0000696 | 3300049591 | Bacteria | 20851 |
| 404 | Ga0501075_0001299 | 3300049591 | Bacteria | 16201 |
| 405 | Ga0501075_0009119 | 3300049591 | Bacteria | 6931 |
| 406 | Ga0501075_0065318 | 3300049591 | Bacteria | 2745 |
| 407 | Ga0501076_0000856 | 3300049592 | Bacteria | 19728 |
| 408 | Ga0501076_0000922 | 3300049592 | Bacteria | 19182 |
| 409 | Ga0501077_0022401 | 3300049593 | Bacteria | 4001 |
| 410 | Ga0501079_0000165 | 3300049741 | Bacteria | 36937 |
| 411 | Ga0501079_0006707 | 3300049741 | Bacteria | 8660 |
| 412 | Ga0501079_0042767 | 3300049741 | Bacteria | 3498 |
| 413 | Ga0501079_0108637 | 3300049741 | Bacteria | 2154 |
| 414 | Ga0501080_0029215 | 3300049742 | Bacteria | 5132 |
| 415 | Ga0501080_0036464 | 3300049742 | Bacteria | 4590 |
| 416 | Ga0501080_0273878 | 3300049742 | Bacteria | 1536 |
| 417 | Ga0501081_0001217 | 3300049743 | Bacteria | 15671 |
| 418 | Ga0501081_0002100 | 3300049743 | Bacteria | 12452 |
| 419 | Ga0501081_0020447 | 3300049743 | Bacteria | 4412 |
| 420 | Ga0501081_0032760 | 3300049743 | Bacteria | 3527 |
| 421 | Ga0501081_0101061 | 3300049743 | Bacteria | 2039 |
| 422 | Ga0501035_0000021 | 3300049822 | Bacteria | 209085 |
| 423 | Ga0501035_0076614 | 3300049822 | Bacteria | 2957 |
| 424 | Ga0501035_0126425 | 3300049822 | Bacteria | 2232 |
| 425 | Ga0501044_0122190 | 3300049823 | Bacteria | 2604 |
| 426 | Ga0501045_0000012 | 3300049824 | Bacteria | 74001 |
| 427 | Ga0501045_0000154 | 3300049824 | Bacteria | 36954 |
| 428 | Ga0501045_0011996 | 3300049824 | Bacteria | 6093 |
| 429 | Ga0501045_0026584 | 3300049824 | Bacteria | 4165 |
| 430 | Ga0501045_0106335 | 3300049824 | Bacteria | 2079 |
| 431 | nmdc:mga07m45_4268_c1 | 3300050496 | Bacteria | 6992 |
| 432 | nmdc:mga07m45_58766_c1 | 3300050496 | Bacteria | 2176 |
| 433 | nmdc:mga05p37_113855_c1 | 3300050507 | Bacteria | 3326 |
| 434 | nmdc:mga05p37_150198_c1 | 3300050507 | Bacteria | 2850 |
| 435 | nmdc:mga05p37_623_c1 | 3300050507 | Bacteria | 39191 |
| 436 | nmdc:mga09592_1081_c1 | 3300050508 | Bacteria | 21649 |
| 437 | nmdc:mga09592_139675_c1 | 3300050508 | Bacteria | 2088 |
| 438 | nmdc:mga09592_2644_c1 | 3300050508 | Bacteria | 14481 |
| 439 | nmdc:mga0qj67_101644_c1 | 3300050509 | Bacteria | 2318 |
| 440 | nmdc:mga0qj67_10939_c1 | 3300050509 | Bacteria | 6791 |
| 441 | nmdc:mga0qj67_147671_c1 | 3300050509 | Bacteria | 1906 |
| 442 | nmdc:mga0qj67_58315_c1 | 3300050509 | Bacteria | 3061 |
| 443 | nmdc:mga0qj67_60784_c1 | 3300050509 | Bacteria | 2999 |
| 444 | nmdc:mga0qj67_851_c1 | 3300050509 | Bacteria | 20946 |
| 445 | nmdc:mga06r32_12986_c1 | 3300050510 | Bacteria | 7532 |
| 446 | nmdc:mga06r32_143478_c1 | 3300050510 | Bacteria | 2365 |
| 447 | nmdc:mga06r32_204832_c1 | 3300050510 | Bacteria | 1961 |
| 448 | nmdc:mga06r32_216119_c1 | 3300050510 | Bacteria | 1905 |
| 449 | nmdc:mga06r32_358230_c1 | 3300050510 | Bacteria | 1443 |
| 450 | nmdc:mga08y16_11393_c1 | 3300050511 | Bacteria | 9344 |
| 451 | nmdc:mga08y16_165879_c1 | 3300050511 | Bacteria | 2294 |
| 452 | nmdc:mga08y16_18821_c1 | 3300050511 | Bacteria | 7276 |
| 453 | nmdc:mga08y16_23213_c1 | 3300050511 | Bacteria | 6549 |
| 454 | nmdc:mga08y16_293350_c1 | 3300050511 | Bacteria | 1677 |
| 455 | nmdc:mga08y16_39231_c1 | 3300050511 | Bacteria | 4969 |
| 456 | nmdc:mga08y16_91355_c1 | 3300050511 | Bacteria | 3173 |
| 457 | nmdc:mga0n895_29872_c1 | 3300050512 | Bacteria | 5203 |
| 458 | nmdc:mga0n895_3455_c1 | 3300050512 | Bacteria | 12748 |
| 459 | nmdc:mga0n895_37363_c1 | 3300050512 | Bacteria | 4697 |
| 460 | nmdc:mga0rr50_10819_c1 | 3300050513 | Bacteria | 5816 |
| 461 | nmdc:mga0rr50_2773_c1 | 3300050513 | Bacteria | 9956 |
| 462 | nmdc:mga08x19_21311_c1 | 3300050514 | Bacteria | 3999 |
| 463 | nmdc:mga08x19_2340_c1 | 3300050514 | Bacteria | 11503 |
| 464 | nmdc:mga08x19_3542_c1 | 3300050514 | Bacteria | 9284 |
| 465 | nmdc:mga08x19_4566_c1 | 3300050514 | Bacteria | 8218 |
| 466 | nmdc:mga0a205_956_c1 | 3300050515 | Bacteria | 23838 |
| 467 | Ga0495601_0152613 | 3300053077 | Bacteria | 1508 |
| 468 | Ga0500610_0001230 | 3300053079 | Bacteria | 8543 |
| 469 | Ga0495619_0242512 | 3300053085 | Bacteria | 1249 |
| 470 | Ga0500562_000576 | 3300053108 | Bacteria | 8804 |
| 471 | Ga0500562_030382 | 3300053108 | Bacteria | 1423 |
| 472 | Ga0500608_092181 | 3300053122 | Bacteria | 1414 |
| 473 | Ga0500559_0012754 | 3300053136 | Bacteria | 3568 |
| 474 | Ga0500627_0162720 | 3300053158 | Bacteria | 1006 |
| 475 | Ga0501084_0000200 | 3300054114 | Bacteria | 46374 |
| 476 | Ga0501084_0022056 | 3300054114 | Bacteria | 5311 |
| 477 | Ga0501082_0022004 | 3300060353 | Bacteria | 5497 |
| 478 | Ga0501082_0030307 | 3300060353 | Bacteria | 4662 |
| 479 | Ga0530510_0000977 | 3300061734 | Bacteria | 18901 |
| 480 | Ga0530510_0003503 | 3300061734 | Bacteria | 10788 |
| 481 | Ga0530510_0040875 | 3300061734 | Bacteria | 3347 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005333 | Ga0070677_10099363 | Ga0070677_100993632 | 263 |
| 2 | 3300005578 | Ga0068854_100013930 | Ga0068854_1000139304 | 263 |
| 3 | 3300025893 | Ga0207682_10064255 | Ga0207682_100642551 | 263 |
| 4 | 3300025933 | Ga0207706_10008024 | Ga0207706_100080245 | 263 |
| 5 | 3300025981 | Ga0207640_10015619 | Ga0207640_100156193 | 263 |
| 6 | 3300045976 | Ga0466967_0031196 | Ga0466967_0031196_1721_2635 | 265 |
| 7 | 3300006943 | Ga0099822_1019647 | Ga0099822_10196473 | 267 |
| 8 | 3300009177 | Ga0105248_10000080 | Ga0105248_1000008064 | 267 |
| 9 | 3300042133 | Ga0450896_003533 | Ga0450896_003533_561_1448 | 269 |
| 10 | 3300048928 | Ga0496125_0005953 | Ga0496125_0005953_2975_3880 | 269 |
| 11 | 3300035724 | Ga0373933_0042632 | Ga0373933_0042632_1050_1964 | 271 |
| 12 | 3300036401 | Ga0373937_0066211 | Ga0373937_0066211_1596_2510 | 271 |
| 13 | 3300037068 | Ga0373925_0132039 | Ga0373925_0132039_531_1445 | 271 |
| 14 | 3300037853 | Ga0436364_0912133 | Ga0436364_0912133_593_1507 | 271 |
| 15 | 3300046615 | Ga0495656_0082281 | Ga0495656_0082281_471_1385 | 272 |
| 16 | 3300053108 | Ga0500562_030382 | Ga0500562_030382_53_967 | 272 |
| 17 | 3300046684 | Ga0495669_0015769 | Ga0495669_0015769_931_1827 | 273 |
| 18 | 3300009093 | Ga0105240_10312357 | Ga0105240_103123572 | 274 |
| 19 | 3300031251 | Ga0265327_10002083 | Ga0265327_100020836 | 274 |
| 20 | 3300005841 | Ga0068863_100021294 | Ga0068863_1000212944 | 278 |
| 21 | 3300026088 | Ga0207641_10010788 | Ga0207641_100107885 | 278 |
| 22 | 3300031251 | Ga0265327_10000186 | Ga0265327_1000018656 | 278 |
| 23 | 3300046491 | Ga0495584_0086116 | Ga0495584_0086116_737_1573 | 278 |
| 24 | 3300049741 | Ga0501079_0108637 | Ga0501079_0108637_1295_2131 | 278 |
| 25 | 3300005577 | Ga0068857_100409470 | Ga0068857_1004094701 | 279 |
| 26 | 3300006195 | Ga0075366_10025280 | Ga0075366_100252802 | 279 |
| 27 | 3300006353 | Ga0075370_10003457 | Ga0075370_100034573 | 279 |
| 28 | 3300009148 | Ga0105243_10001362 | Ga0105243_1000136219 | 279 |
| 29 | 3300025935 | Ga0207709_10000285 | Ga0207709_1000028516 | 279 |
| 30 | 3300026116 | Ga0207674_10198208 | Ga0207674_101982082 | 279 |
| 31 | 3300046616 | Ga0495668_0022663 | Ga0495668_0022663_124_1044 | 279 |
| 32 | 3300050496 | nmdc:mga07m45_4268_c1 | nmdc:mga07m45_4268_c1_1627_2544 | 279 |
| 33 | 3300053158 | Ga0500627_0162720 | Ga0500627_0162720_72_992 | 279 |
| 34 | 3300003781 | Ga0055536_1004919 | Ga0055536_10049192 | 281 |
| 35 | 3300003792 | Ga0055540_1020404 | Ga0055540_10204042 | 281 |
| 36 | 3300025292 | Ga0209676_1000173 | Ga0209676_100017395 | 281 |
| 37 | 3300025303 | Ga0209051_1000282 | Ga0209051_100028241 | 281 |
| 38 | 3300005616 | Ga0068852_100489358 | Ga0068852_1004893582 | 282 |
| 39 | 3300017792 | Ga0163161_10079405 | Ga0163161_100794052 | 282 |
| 40 | 3300033180 | Ga0307510_10054817 | Ga0307510_100548173 | 282 |
| 41 | 3300053085 | Ga0495619_0242512 | Ga0495619_0242512_58_972 | 282 |
| 42 | 3300028786 | Ga0307517_10000634 | Ga0307517_1000063434 | 283 |
| 43 | 3300028794 | Ga0307515_10006012 | Ga0307515_100060122 | 283 |
| 44 | 3300049575 | Ga0501039_0296228 | Ga0501039_0296228_270_1229 | 283 |
| 45 | 3300030742 | Ga0316183_1052990 | Ga0316183_10529902 | 284 |
| 46 | 3300006177 | Ga0075362_10001585 | Ga0075362_100015854 | 286 |
| 47 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_174911_175843 | 286 |
| 48 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_115993_116925 | 286 |
| 49 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_115673_116605 | 286 |
| 50 | 3300049582 | Ga0501048_0000414 | Ga0501048_0000414_23452_24384 | 286 |
| 51 | 3300049823 | Ga0501044_0122190 | Ga0501044_0122190_671_1603 | 286 |
| 52 | 3300049824 | Ga0501045_0011996 | Ga0501045_0011996_1401_2333 | 286 |
| 53 | 3300031548 | Ga0307408_100052489 | Ga0307408_1000524894 | 287 |
| 54 | 3300032002 | Ga0307416_100080689 | Ga0307416_1000806892 | 287 |
| 55 | 3300042002 | Ga0439442_006848 | Ga0439442_006848_676_1581 | 287 |
| 56 | 3300042125 | Ga0450923_010947 | Ga0450923_010947_549_1454 | 287 |
| 57 | 3300042435 | Ga0439434_0008759 | Ga0439434_0008759_1862_2767 | 287 |
| 58 | 3300031456 | Ga0307513_10087432 | Ga0307513_100874323 | 289 |
| 59 | 3300030732 | Ga0316176_1099358 | Ga0316176_10993582 | 291 |
| 60 | 3300030733 | Ga0314311_1100549 | Ga0314311_11005492 | 291 |
| 61 | 3300030742 | Ga0316183_1066259 | Ga0316183_10662599 | 291 |
| 62 | 3300005841 | Ga0068863_100106776 | Ga0068863_1001067762 | 292 |
| 63 | 3300006871 | Ga0075434_100022149 | Ga0075434_1000221492 | 292 |
| 64 | 3300007076 | Ga0075435_100306769 | Ga0075435_1003067692 | 292 |
| 65 | 3300026088 | Ga0207641_10110716 | Ga0207641_101107162 | 292 |
| 66 | 3300048918 | Ga0496115_0068674 | Ga0496115_0068674_62_1036 | 292 |
| 67 | 3300050512 | nmdc:mga0n895_37363_c1 | nmdc:mga0n895_37363_c1_1529_2434 | 292 |
| 68 | 3300053108 | Ga0500562_000576 | Ga0500562_000576_637_1578 | 292 |
| 69 | 3300025926 | Ga0207659_10264597 | Ga0207659_102645972 | 294 |
| 70 | 3300050510 | nmdc:mga06r32_358230_c1 | nmdc:mga06r32_358230_c1_542_1426 | 294 |
| 71 | 3300031731 | Ga0307405_10140624 | Ga0307405_101406242 | 295 |
| 72 | 3300032126 | Ga0307415_100129780 | Ga0307415_1001297802 | 295 |
| 73 | 3300031548 | Ga0307408_100021136 | Ga0307408_1000211363 | 296 |
| 74 | 3300032002 | Ga0307416_100105440 | Ga0307416_1001054403 | 296 |
| 75 | 3300046692 | Ga0495671_0006751 | Ga0495671_0006751_4168_5061 | 297 |
| 76 | 3300025908 | Ga0207643_10111980 | Ga0207643_101119802 | 298 |
| 77 | 3300027462 | Ga0210000_1002987 | Ga0210000_10029872 | 298 |
| 78 | 3300031730 | Ga0307516_10096212 | Ga0307516_100962123 | 298 |
| 79 | 3300005549 | Ga0070704_100213573 | Ga0070704_1002135731 | 299 |
| 80 | 3300006846 | Ga0075430_100000318 | Ga0075430_10000031819 | 299 |
| 81 | 3300025918 | Ga0207662_10051326 | Ga0207662_100513263 | 299 |
| 82 | 3300027462 | Ga0210000_1017807 | Ga0210000_10178071 | 299 |
| 83 | 3300031824 | Ga0307413_10173798 | Ga0307413_101737981 | 299 |
| 84 | 3300046476 | Ga0495662_0004705 | Ga0495662_0004705_5349_6248 | 299 |
| 85 | 3300049574 | Ga0501038_0198924 | Ga0501038_0198924_390_1295 | 299 |
| 86 | 3300049578 | Ga0501042_0044025 | Ga0501042_0044025_1879_2784 | 299 |
| 87 | 3300049582 | Ga0501048_0059112 | Ga0501048_0059112_698_1603 | 299 |
| 88 | 3300050509 | nmdc:mga0qj67_60784_c1 | nmdc:mga0qj67_60784_c1_789_1694 | 299 |
| 89 | 3300050509 | nmdc:mga0qj67_851_c1 | nmdc:mga0qj67_851_c1_19437_20342 | 299 |
| 90 | 3300050510 | nmdc:mga06r32_12986_c1 | nmdc:mga06r32_12986_c1_2702_3607 | 299 |
| 91 | 3300005354 | Ga0070675_100374206 | Ga0070675_1003742062 | 300 |
| 92 | 3300006844 | Ga0075428_100033666 | Ga0075428_1000336662 | 300 |
| 93 | 3300006846 | Ga0075430_100241071 | Ga0075430_1002410712 | 300 |
| 94 | 3300007265 | Ga0099794_10016869 | Ga0099794_100168691 | 300 |
| 95 | 3300009094 | Ga0111539_10227637 | Ga0111539_102276372 | 300 |
| 96 | 3300036401 | Ga0373937_0264835 | Ga0373937_0264835_243_1145 | 300 |
| 97 | 3300046472 | Ga0495580_0000006 | Ga0495580_0000006_56081_56983 | 300 |
| 98 | 3300046516 | Ga0495628_0127253 | Ga0495628_0127253_719_1627 | 300 |
| 99 | 3300050509 | nmdc:mga0qj67_147671_c1 | nmdc:mga0qj67_147671_c1_348_1286 | 300 |
| 100 | 3300050511 | nmdc:mga08y16_91355_c1 | nmdc:mga08y16_91355_c1_2243_3145 | 300 |
| 101 | 3300003203 | JGI25406J46586_10022242 | JGI25406J46586_100222422 | 301 |
| 102 | 3300005295 | Ga0065707_10002391 | Ga0065707_100023912 | 301 |
| 103 | 3300005295 | Ga0065707_10013296 | Ga0065707_100132963 | 301 |
| 104 | 3300005330 | Ga0070690_100001335 | Ga0070690_1000013353 | 301 |
| 105 | 3300005334 | Ga0068869_100002111 | Ga0068869_1000021119 | 301 |
| 106 | 3300005336 | Ga0070680_100001466 | Ga0070680_1000014666 | 301 |
| 107 | 3300005336 | Ga0070680_100052982 | Ga0070680_1000529823 | 301 |
| 108 | 3300005337 | Ga0070682_100007419 | Ga0070682_1000074192 | 301 |
| 109 | 3300005338 | Ga0068868_100007062 | Ga0068868_1000070623 | 301 |
| 110 | 3300005340 | Ga0070689_100001640 | Ga0070689_1000016403 | 301 |
| 111 | 3300005340 | Ga0070689_100040634 | Ga0070689_1000406343 | 301 |
| 112 | 3300005343 | Ga0070687_100000392 | Ga0070687_1000003924 | 301 |
| 113 | 3300005345 | Ga0070692_10012504 | Ga0070692_100125044 | 301 |
| 114 | 3300005345 | Ga0070692_10017056 | Ga0070692_100170564 | 301 |
| 115 | 3300005353 | Ga0070669_100021278 | Ga0070669_1000212782 | 301 |
| 116 | 3300005353 | Ga0070669_100101101 | Ga0070669_1001011012 | 301 |
| 117 | 3300005354 | Ga0070675_100113004 | Ga0070675_1001130043 | 301 |
| 118 | 3300005406 | Ga0070703_10006581 | Ga0070703_100065812 | 301 |
| 119 | 3300005438 | Ga0070701_10001104 | Ga0070701_100011048 | 301 |
| 120 | 3300005440 | Ga0070705_100000198 | Ga0070705_1000001987 | 301 |
| 121 | 3300005440 | Ga0070705_100007580 | Ga0070705_1000075802 | 301 |
| 122 | 3300005440 | Ga0070705_100118894 | Ga0070705_1001188942 | 301 |
| 123 | 3300005440 | Ga0070705_100262462 | Ga0070705_1002624622 | 301 |
| 124 | 3300005441 | Ga0070700_100000336 | Ga0070700_10000033614 | 301 |
| 125 | 3300005441 | Ga0070700_100000389 | Ga0070700_10000038915 | 301 |
| 126 | 3300005444 | Ga0070694_100003027 | Ga0070694_10000302710 | 301 |
| 127 | 3300005444 | Ga0070694_100007226 | Ga0070694_1000072262 | 301 |
| 128 | 3300005444 | Ga0070694_100056234 | Ga0070694_1000562342 | 301 |
| 129 | 3300005458 | Ga0070681_10000676 | Ga0070681_1000067610 | 301 |
| 130 | 3300005459 | Ga0068867_100000780 | Ga0068867_10000078010 | 301 |
| 131 | 3300005459 | Ga0068867_100024393 | Ga0068867_1000243932 | 301 |
| 132 | 3300005468 | Ga0070707_100178057 | Ga0070707_1001780573 | 301 |
| 133 | 3300005471 | Ga0070698_100063760 | Ga0070698_1000637603 | 301 |
| 134 | 3300005518 | Ga0070699_100070943 | Ga0070699_1000709432 | 301 |
| 135 | 3300005518 | Ga0070699_100143102 | Ga0070699_1001431023 | 301 |
| 136 | 3300005530 | Ga0070679_100012766 | Ga0070679_1000127666 | 301 |
| 137 | 3300005543 | Ga0070672_100344751 | Ga0070672_1003447512 | 301 |
| 138 | 3300005544 | Ga0070686_100001108 | Ga0070686_1000011083 | 301 |
| 139 | 3300005545 | Ga0070695_100000292 | Ga0070695_10000029217 | 301 |
| 140 | 3300005545 | Ga0070695_100003027 | Ga0070695_1000030278 | 301 |
| 141 | 3300005545 | Ga0070695_100184673 | Ga0070695_1001846731 | 301 |
| 142 | 3300005546 | Ga0070696_100000489 | Ga0070696_10000048912 | 301 |
| 143 | 3300005546 | Ga0070696_100015085 | Ga0070696_1000150853 | 301 |
| 144 | 3300005546 | Ga0070696_100093320 | Ga0070696_1000933203 | 301 |
| 145 | 3300005546 | Ga0070696_100100523 | Ga0070696_1001005232 | 301 |
| 146 | 3300005546 | Ga0070696_100222879 | Ga0070696_1002228792 | 301 |
| 147 | 3300005547 | Ga0070693_100000126 | Ga0070693_10000012623 | 301 |
| 148 | 3300005547 | Ga0070693_100314639 | Ga0070693_1003146392 | 301 |
| 149 | 3300005549 | Ga0070704_100001261 | Ga0070704_1000012612 | 301 |
| 150 | 3300005549 | Ga0070704_100002806 | Ga0070704_1000028068 | 301 |
| 151 | 3300005549 | Ga0070704_100041955 | Ga0070704_1000419553 | 301 |
| 152 | 3300005549 | Ga0070704_100065499 | Ga0070704_1000654992 | 301 |
| 153 | 3300005563 | Ga0068855_100026989 | Ga0068855_1000269893 | 301 |
| 154 | 3300005578 | Ga0068854_100005630 | Ga0068854_1000056303 | 301 |
| 155 | 3300005614 | Ga0068856_100031945 | Ga0068856_1000319453 | 301 |
| 156 | 3300005614 | Ga0068856_100132085 | Ga0068856_1001320852 | 301 |
| 157 | 3300005615 | Ga0070702_100001105 | Ga0070702_10000110511 | 301 |
| 158 | 3300005615 | Ga0070702_100090832 | Ga0070702_1000908322 | 301 |
| 159 | 3300005616 | Ga0068852_100095314 | Ga0068852_1000953142 | 301 |
| 160 | 3300005617 | Ga0068859_100010604 | Ga0068859_10001060411 | 301 |
| 161 | 3300005617 | Ga0068859_100288531 | Ga0068859_1002885312 | 301 |
| 162 | 3300005618 | Ga0068864_100037077 | Ga0068864_1000370773 | 301 |
| 163 | 3300005718 | Ga0068866_10003537 | Ga0068866_100035373 | 301 |
| 164 | 3300005718 | Ga0068866_10006743 | Ga0068866_100067433 | 301 |
| 165 | 3300005719 | Ga0068861_100000316 | Ga0068861_1000003165 | 301 |
| 166 | 3300005719 | Ga0068861_100006140 | Ga0068861_1000061409 | 301 |
| 167 | 3300005840 | Ga0068870_10061354 | Ga0068870_100613542 | 301 |
| 168 | 3300005841 | Ga0068863_100002399 | Ga0068863_1000023997 | 301 |
| 169 | 3300005841 | Ga0068863_100497046 | Ga0068863_1004970462 | 301 |
| 170 | 3300005842 | Ga0068858_100018197 | Ga0068858_1000181976 | 301 |
| 171 | 3300005843 | Ga0068860_100008921 | Ga0068860_1000089213 | 301 |
| 172 | 3300005844 | Ga0068862_100002813 | Ga0068862_1000028132 | 301 |
| 173 | 3300005844 | Ga0068862_100006610 | Ga0068862_1000066103 | 301 |
| 174 | 3300005985 | Ga0081539_10006772 | Ga0081539_100067725 | 301 |
| 175 | 3300006237 | Ga0097621_100002057 | Ga0097621_1000020573 | 301 |
| 176 | 3300006358 | Ga0068871_100004146 | Ga0068871_1000041468 | 301 |
| 177 | 3300006844 | Ga0075428_100001001 | Ga0075428_10000100119 | 301 |
| 178 | 3300006844 | Ga0075428_100214360 | Ga0075428_1002143602 | 301 |
| 179 | 3300006844 | Ga0075428_100427312 | Ga0075428_1004273122 | 301 |
| 180 | 3300006846 | Ga0075430_100009635 | Ga0075430_1000096357 | 301 |
| 181 | 3300006846 | Ga0075430_100118227 | Ga0075430_1001182274 | 301 |
| 182 | 3300006847 | Ga0075431_100050300 | Ga0075431_1000503002 | 301 |
| 183 | 3300006847 | Ga0075431_100426171 | Ga0075431_1004261711 | 301 |
| 184 | 3300006852 | Ga0075433_10000441 | Ga0075433_1000044116 | 301 |
| 185 | 3300006871 | Ga0075434_100013244 | Ga0075434_1000132443 | 301 |
| 186 | 3300006871 | Ga0075434_100031718 | Ga0075434_1000317183 | 301 |
| 187 | 3300006880 | Ga0075429_100000363 | Ga0075429_10000036319 | 301 |
| 188 | 3300006880 | Ga0075429_100019170 | Ga0075429_1000191701 | 301 |
| 189 | 3300006880 | Ga0075429_100193940 | Ga0075429_1001939402 | 301 |
| 190 | 3300006880 | Ga0075429_100370617 | Ga0075429_1003706172 | 301 |
| 191 | 3300006881 | Ga0068865_100001740 | Ga0068865_1000017408 | 301 |
| 192 | 3300006881 | Ga0068865_100003157 | Ga0068865_1000031575 | 301 |
| 193 | 3300006914 | Ga0075436_100001646 | Ga0075436_1000016469 | 301 |
| 194 | 3300006914 | Ga0075436_100003099 | Ga0075436_1000030992 | 301 |
| 195 | 3300006931 | Ga0097620_100010604 | Ga0097620_1000106043 | 301 |
| 196 | 3300006931 | Ga0097620_100288550 | Ga0097620_1002885502 | 301 |
| 197 | 3300007076 | Ga0075435_100008938 | Ga0075435_1000089383 | 301 |
| 198 | 3300007076 | Ga0075435_100029975 | Ga0075435_1000299752 | 301 |
| 199 | 3300009094 | Ga0111539_10025413 | Ga0111539_100254137 | 301 |
| 200 | 3300009094 | Ga0111539_10046079 | Ga0111539_100460796 | 301 |
| 201 | 3300009094 | Ga0111539_10101418 | Ga0111539_101014183 | 301 |
| 202 | 3300009094 | Ga0111539_10276391 | Ga0111539_102763912 | 301 |
| 203 | 3300009147 | Ga0114129_10001363 | Ga0114129_100013635 | 301 |
| 204 | 3300009147 | Ga0114129_10049369 | Ga0114129_100493691 | 301 |
| 205 | 3300009147 | Ga0114129_10483905 | Ga0114129_104839052 | 301 |
| 206 | 3300009148 | Ga0105243_10003557 | Ga0105243_100035572 | 301 |
| 207 | 3300009148 | Ga0105243_10004111 | Ga0105243_1000411112 | 301 |
| 208 | 3300009176 | Ga0105242_10009425 | Ga0105242_100094253 | 301 |
| 209 | 3300009545 | Ga0105237_10381542 | Ga0105237_103815422 | 301 |
| 210 | 3300009553 | Ga0105249_10011474 | Ga0105249_100114749 | 301 |
| 211 | 3300013296 | Ga0157374_10086939 | Ga0157374_100869393 | 301 |
| 212 | 3300013297 | Ga0157378_10001643 | Ga0157378_1000164312 | 301 |
| 213 | 3300013306 | Ga0163162_10514382 | Ga0163162_105143821 | 301 |
| 214 | 3300013308 | Ga0157375_10139409 | Ga0157375_101394093 | 301 |
| 215 | 3300014326 | Ga0157380_10001588 | Ga0157380_1000158811 | 301 |
| 216 | 3300014745 | Ga0157377_10006333 | Ga0157377_100063334 | 301 |
| 217 | 3300014968 | Ga0157379_10057756 | Ga0157379_100577564 | 301 |
| 218 | 3300014969 | Ga0157376_10025135 | Ga0157376_100251353 | 301 |
| 219 | 3300021388 | Ga0213875_10008932 | Ga0213875_100089322 | 301 |
| 220 | 3300025885 | Ga0207653_10019749 | Ga0207653_100197492 | 301 |
| 221 | 3300025899 | Ga0207642_10000598 | Ga0207642_100005987 | 301 |
| 222 | 3300025899 | Ga0207642_10042479 | Ga0207642_100424793 | 301 |
| 223 | 3300025901 | Ga0207688_10008796 | Ga0207688_100087963 | 301 |
| 224 | 3300025908 | Ga0207643_10054465 | Ga0207643_100544652 | 301 |
| 225 | 3300025912 | Ga0207707_10001702 | Ga0207707_100017023 | 301 |
| 226 | 3300025918 | Ga0207662_10001169 | Ga0207662_100011692 | 301 |
| 227 | 3300025921 | Ga0207652_10006354 | Ga0207652_100063544 | 301 |
| 228 | 3300025922 | Ga0207646_10161258 | Ga0207646_101612581 | 301 |
| 229 | 3300025923 | Ga0207681_10009570 | Ga0207681_100095702 | 301 |
| 230 | 3300025923 | Ga0207681_10074228 | Ga0207681_100742283 | 301 |
| 231 | 3300025927 | Ga0207687_10013680 | Ga0207687_100136804 | 301 |
| 232 | 3300025933 | Ga0207706_10049025 | Ga0207706_100490253 | 301 |
| 233 | 3300025934 | Ga0207686_10024001 | Ga0207686_100240012 | 301 |
| 234 | 3300025935 | Ga0207709_10001943 | Ga0207709_100019437 | 301 |
| 235 | 3300025935 | Ga0207709_10002633 | Ga0207709_100026338 | 301 |
| 236 | 3300025936 | Ga0207670_10001333 | Ga0207670_1000133312 | 301 |
| 237 | 3300025937 | Ga0207669_10032730 | Ga0207669_100327303 | 301 |
| 238 | 3300025938 | Ga0207704_10002408 | Ga0207704_100024088 | 301 |
| 239 | 3300025938 | Ga0207704_10010636 | Ga0207704_100106364 | 301 |
| 240 | 3300025940 | Ga0207691_10308439 | Ga0207691_103084392 | 301 |
| 241 | 3300025942 | Ga0207689_10003864 | Ga0207689_100038644 | 301 |
| 242 | 3300025949 | Ga0207667_10026105 | Ga0207667_100261054 | 301 |
| 243 | 3300025961 | Ga0207712_10058912 | Ga0207712_100589122 | 301 |
| 244 | 3300025961 | Ga0207712_10060628 | Ga0207712_100606282 | 301 |
| 245 | 3300026023 | Ga0207677_10005202 | Ga0207677_100052026 | 301 |
| 246 | 3300026035 | Ga0207703_10018476 | Ga0207703_100184764 | 301 |
| 247 | 3300026075 | Ga0207708_10001410 | Ga0207708_100014107 | 301 |
| 248 | 3300026075 | Ga0207708_10011960 | Ga0207708_100119605 | 301 |
| 249 | 3300026078 | Ga0207702_10094050 | Ga0207702_100940501 | 301 |
| 250 | 3300026078 | Ga0207702_10564736 | Ga0207702_105647361 | 301 |
| 251 | 3300026088 | Ga0207641_10002789 | Ga0207641_1000278910 | 301 |
| 252 | 3300026089 | Ga0207648_10000359 | Ga0207648_1000035929 | 301 |
| 253 | 3300026089 | Ga0207648_10004228 | Ga0207648_100042285 | 301 |
| 254 | 3300026116 | Ga0207674_10344607 | Ga0207674_103446072 | 301 |
| 255 | 3300026118 | Ga0207675_100006845 | Ga0207675_10000684511 | 301 |
| 256 | 3300026118 | Ga0207675_100022734 | Ga0207675_1000227342 | 301 |
| 257 | 3300026118 | Ga0207675_100412789 | Ga0207675_1004127892 | 301 |
| 258 | 3300027360 | Ga0209969_1001779 | Ga0209969_10017793 | 301 |
| 259 | 3300027364 | Ga0209967_1000362 | Ga0209967_10003623 | 301 |
| 260 | 3300027378 | Ga0209981_1001593 | Ga0209981_10015933 | 301 |
| 261 | 3300027395 | Ga0209996_1002375 | Ga0209996_10023752 | 301 |
| 262 | 3300027462 | Ga0210000_1003453 | Ga0210000_10034532 | 301 |
| 263 | 3300027471 | Ga0209995_1002504 | Ga0209995_10025042 | 301 |
| 264 | 3300027471 | Ga0209995_1007846 | Ga0209995_10078462 | 301 |
| 265 | 3300027526 | Ga0209968_1001234 | Ga0209968_10012343 | 301 |
| 266 | 3300027543 | Ga0209999_1010737 | Ga0209999_10107372 | 301 |
| 267 | 3300027907 | Ga0207428_10001380 | Ga0207428_100013807 | 301 |
| 268 | 3300027907 | Ga0207428_10029000 | Ga0207428_100290003 | 301 |
| 269 | 3300027907 | Ga0207428_10073712 | Ga0207428_100737123 | 301 |
| 270 | 3300027907 | Ga0207428_10100876 | Ga0207428_101008762 | 301 |
| 271 | 3300028380 | Ga0268265_10002908 | Ga0268265_100029085 | 301 |
| 272 | 3300028380 | Ga0268265_10014302 | Ga0268265_100143026 | 301 |
| 273 | 3300028381 | Ga0268264_10011730 | Ga0268264_100117306 | 301 |
| 274 | 3300031548 | Ga0307408_100026766 | Ga0307408_1000267665 | 301 |
| 275 | 3300031548 | Ga0307408_100242580 | Ga0307408_1002425802 | 301 |
| 276 | 3300031548 | Ga0307408_100275514 | Ga0307408_1002755142 | 301 |
| 277 | 3300031730 | Ga0307516_10000095 | Ga0307516_1000009523 | 301 |
| 278 | 3300031730 | Ga0307516_10000099 | Ga0307516_1000009941 | 301 |
| 279 | 3300031911 | Ga0307412_10051021 | Ga0307412_100510214 | 301 |
| 280 | 3300032005 | Ga0307411_10007321 | Ga0307411_100073215 | 301 |
| 281 | 3300034818 | Ga0373950_0009707 | Ga0373950_0009707_101_1024 | 301 |
| 282 | 3300034820 | Ga0373959_0003430 | Ga0373959_0003430_359_1282 | 301 |
| 283 | 3300034957 | Ga0373938_0020408 | Ga0373938_0020408_125_1048 | 301 |
| 284 | 3300035083 | Ga0373926_0001812 | Ga0373926_0001812_4824_5747 | 301 |
| 285 | 3300035084 | Ga0373928_0001984 | Ga0373928_0001984_2273_3196 | 301 |
| 286 | 3300035085 | Ga0373929_0006228 | Ga0373929_0006228_585_1490 | 301 |
| 287 | 3300035086 | Ga0373934_0002883 | Ga0373934_0002883_4361_5266 | 301 |
| 288 | 3300035088 | Ga0373940_0064212 | Ga0373940_0064212_72_995 | 301 |
| 289 | 3300035089 | Ga0373944_0002250 | Ga0373944_0002250_3335_4258 | 301 |
| 290 | 3300035112 | Ga0373932_0004217 | Ga0373932_0004217_971_1894 | 301 |
| 291 | 3300035113 | Ga0373936_0060804 | Ga0373936_0060804_585_1508 | 301 |
| 292 | 3300035114 | Ga0373939_0015992 | Ga0373939_0015992_870_1793 | 301 |
| 293 | 3300035116 | Ga0373945_0008885 | Ga0373945_0008885_981_1904 | 301 |
| 294 | 3300035170 | Ga0373943_0021735 | Ga0373943_0021735_1542_2465 | 301 |
| 295 | 3300035172 | Ga0373955_0185223 | Ga0373955_0185223_222_1127 | 301 |
| 296 | 3300035207 | Ga0373942_0001086 | Ga0373942_0001086_1641_2546 | 301 |
| 297 | 3300035398 | Ga0316574_0126592 | Ga0316574_0126592_710_1624 | 301 |
| 298 | 3300035691 | Ga0373931_0000352 | Ga0373931_0000352_12021_12944 | 301 |
| 299 | 3300035691 | Ga0373931_0022874 | Ga0373931_0022874_1560_2483 | 301 |
| 300 | 3300035692 | Ga0373935_0019277 | Ga0373935_0019277_3080_4021 | 301 |
| 301 | 3300035695 | Ga0373927_0133562 | Ga0373927_0133562_198_1121 | 301 |
| 302 | 3300035724 | Ga0373933_0003079 | Ga0373933_0003079_4604_5509 | 301 |
| 303 | 3300035724 | Ga0373933_0240571 | Ga0373933_0240571_105_1010 | 301 |
| 304 | 3300035725 | Ga0373947_0122875 | Ga0373947_0122875_501_1424 | 301 |
| 305 | 3300036401 | Ga0373937_0021997 | Ga0373937_0021997_4508_5413 | 301 |
| 306 | 3300037068 | Ga0373925_0024962 | Ga0373925_0024962_2514_3455 | 301 |
| 307 | 3300037853 | Ga0436364_0624342 | Ga0436364_0624342_5354_6304 | 301 |
| 308 | 3300041408 | Ga0439453_0011083 | Ga0439453_0011083_52_963 | 301 |
| 309 | 3300042001 | Ga0439441_021667 | Ga0439441_021667_12_923 | 301 |
| 310 | 3300042435 | Ga0439434_0001312 | Ga0439434_0001312_962_1873 | 301 |
| 311 | 3300042436 | Ga0439435_0000387 | Ga0439435_0000387_451_1362 | 301 |
| 312 | 3300042436 | Ga0439435_0029824 | Ga0439435_0029824_517_1428 | 301 |
| 313 | 3300042876 | Ga0451577_0487950 | Ga0451577_0487950_24_929 | 301 |
| 314 | 3300045051 | Ga0451576_0002819 | Ga0451576_0002819_8513_9436 | 301 |
| 315 | 3300045051 | Ga0451576_0003913 | Ga0451576_0003913_1954_2877 | 301 |
| 316 | 3300045051 | Ga0451576_0005813 | Ga0451576_0005813_5371_6294 | 301 |
| 317 | 3300045051 | Ga0451576_0103848 | Ga0451576_0103848_2016_2921 | 301 |
| 318 | 3300045051 | Ga0451576_0106051 | Ga0451576_0106051_100_1005 | 301 |
| 319 | 3300045051 | Ga0451576_0129878 | Ga0451576_0129878_264_1169 | 301 |
| 320 | 3300045836 | Ga0466958_0167448 | Ga0466958_0167448_409_1314 | 301 |
| 321 | 3300046454 | Ga0495592_0027699 | Ga0495592_0027699_2657_3577 | 301 |
| 322 | 3300046455 | Ga0495603_0005435 | Ga0495603_0005435_1151_2074 | 301 |
| 323 | 3300046459 | Ga0495629_0013426 | Ga0495629_0013426_65_985 | 301 |
| 324 | 3300046459 | Ga0495629_0090170 | Ga0495629_0090170_881_1786 | 301 |
| 325 | 3300046462 | Ga0495651_0020240 | Ga0495651_0020240_4180_5100 | 301 |
| 326 | 3300046472 | Ga0495580_0015061 | Ga0495580_0015061_1467_2387 | 301 |
| 327 | 3300046473 | Ga0495582_0046589 | Ga0495582_0046589_95_1018 | 301 |
| 328 | 3300046475 | Ga0495639_0054678 | Ga0495639_0054678_732_1637 | 301 |
| 329 | 3300046491 | Ga0495584_0164209 | Ga0495584_0164209_98_1003 | 301 |
| 330 | 3300046499 | Ga0495594_0043563 | Ga0495594_0043563_1305_2228 | 301 |
| 331 | 3300046500 | Ga0495596_0009787 | Ga0495596_0009787_993_1913 | 301 |
| 332 | 3300046511 | Ga0495608_0004765 | Ga0495608_0004765_7917_8837 | 301 |
| 333 | 3300046516 | Ga0495628_0094427 | Ga0495628_0094427_1390_2295 | 301 |
| 334 | 3300046517 | Ga0495630_0047049 | Ga0495630_0047049_720_1625 | 301 |
| 335 | 3300046517 | Ga0495630_0129844 | Ga0495630_0129844_668_1588 | 301 |
| 336 | 3300046524 | Ga0495648_0005025 | Ga0495648_0005025_7666_8586 | 301 |
| 337 | 3300046526 | Ga0495666_0040068 | Ga0495666_0040068_354_1277 | 301 |
| 338 | 3300046529 | Ga0495652_0022681 | Ga0495652_0022681_3184_4104 | 301 |
| 339 | 3300046531 | Ga0495665_0065218 | Ga0495665_0065218_504_1424 | 301 |
| 340 | 3300046533 | Ga0495640_0037176 | Ga0495640_0037176_922_1842 | 301 |
| 341 | 3300046533 | Ga0495640_0067732 | Ga0495640_0067732_329_1234 | 301 |
| 342 | 3300046535 | Ga0495586_0012607 | Ga0495586_0012607_2827_3750 | 301 |
| 343 | 3300046536 | Ga0495587_0003760 | Ga0495587_0003760_7680_8600 | 301 |
| 344 | 3300046539 | Ga0495621_0025194 | Ga0495621_0025194_785_1690 | 301 |
| 345 | 3300046663 | Ga0495635_0092872 | Ga0495635_0092872_424_1344 | 301 |
| 346 | 3300046675 | Ga0495657_0069390 | Ga0495657_0069390_1231_2136 | 301 |
| 347 | 3300046680 | Ga0495646_0017709 | Ga0495646_0017709_1067_1987 | 301 |
| 348 | 3300046681 | Ga0495647_0006502 | Ga0495647_0006502_735_1658 | 301 |
| 349 | 3300046683 | Ga0495658_0001994 | Ga0495658_0001994_7718_8641 | 301 |
| 350 | 3300046684 | Ga0495669_0003283 | Ga0495669_0003283_3498_4403 | 301 |
| 351 | 3300046689 | Ga0495613_0001914 | Ga0495613_0001914_2297_3217 | 301 |
| 352 | 3300046690 | Ga0495624_0056135 | Ga0495624_0056135_1483_2388 | 301 |
| 353 | 3300046794 | Ga0495589_0000671 | Ga0495589_0000671_11493_12413 | 301 |
| 354 | 3300046809 | Ga0495600_0017517 | Ga0495600_0017517_2479_3399 | 301 |
| 355 | 3300047315 | Ga0495581_0142785 | Ga0495581_0142785_47_952 | 301 |
| 356 | 3300047317 | Ga0495604_0026636 | Ga0495604_0026636_66_986 | 301 |
| 357 | 3300047317 | Ga0495604_0071789 | Ga0495604_0071789_1065_1970 | 301 |
| 358 | 3300047318 | Ga0495636_0002675 | Ga0495636_0002675_1394_2299 | 301 |
| 359 | 3300047318 | Ga0495636_0076523 | Ga0495636_0076523_35_940 | 301 |
| 360 | 3300047319 | Ga0495674_0112009 | Ga0495674_0112009_869_1789 | 301 |
| 361 | 3300047321 | Ga0495676_0026508 | Ga0495676_0026508_3441_4364 | 301 |
| 362 | 3300047321 | Ga0495676_0039551 | Ga0495676_0039551_1782_2702 | 301 |
| 363 | 3300047323 | Ga0495683_0001150 | Ga0495683_0001150_13971_14891 | 301 |
| 364 | 3300047444 | Ga0495675_0000759 | Ga0495675_0000759_10005_10925 | 301 |
| 365 | 3300047446 | Ga0495679_035729 | Ga0495679_035729_501_1421 | 301 |
| 366 | 3300047469 | Ga0495673_0001825 | Ga0495673_0001825_431_1351 | 301 |
| 367 | 3300047673 | Ga0495593_0001429 | Ga0495593_0001429_245_1165 | 301 |
| 368 | 3300048088 | Ga0495602_0003332 | Ga0495602_0003332_6728_7648 | 301 |
| 369 | 3300048909 | Ga0496106_0134480 | Ga0496106_0134480_199_1122 | 301 |
| 370 | 3300049568 | Ga0501031_0016698 | Ga0501031_0016698_470_1393 | 301 |
| 371 | 3300049569 | Ga0501032_0000024 | Ga0501032_0000024_116017_116934 | 301 |
| 372 | 3300049570 | Ga0501033_0000090 | Ga0501033_0000090_27988_28905 | 301 |
| 373 | 3300049570 | Ga0501033_0002540 | Ga0501033_0002540_7049_7972 | 301 |
| 374 | 3300049571 | Ga0501034_0000140 | Ga0501034_0000140_65875_66792 | 301 |
| 375 | 3300049571 | Ga0501034_0017653 | Ga0501034_0017653_2320_3237 | 301 |
| 376 | 3300049571 | Ga0501034_0073343 | Ga0501034_0073343_549_1472 | 301 |
| 377 | 3300049572 | Ga0501036_0003542 | Ga0501036_0003542_4905_5822 | 301 |
| 378 | 3300049572 | Ga0501036_0003547 | Ga0501036_0003547_6754_7677 | 301 |
| 379 | 3300049573 | Ga0501037_0000024 | Ga0501037_0000024_87671_88588 | 301 |
| 380 | 3300049573 | Ga0501037_0010375 | Ga0501037_0010375_4630_5553 | 301 |
| 381 | 3300049574 | Ga0501038_0000197 | Ga0501038_0000197_23988_24905 | 301 |
| 382 | 3300049575 | Ga0501039_0000017 | Ga0501039_0000017_115832_116749 | 301 |
| 383 | 3300049575 | Ga0501039_0000199 | Ga0501039_0000199_13869_14792 | 301 |
| 384 | 3300049575 | Ga0501039_0010321 | Ga0501039_0010321_784_1695 | 301 |
| 385 | 3300049575 | Ga0501039_0016516 | Ga0501039_0016516_2439_3350 | 301 |
| 386 | 3300049575 | Ga0501039_0043849 | Ga0501039_0043849_1081_1995 | 301 |
| 387 | 3300049575 | Ga0501039_0056452 | Ga0501039_0056452_574_1485 | 301 |
| 388 | 3300049576 | Ga0501040_0000082 | Ga0501040_0000082_38876_39799 | 301 |
| 389 | 3300049576 | Ga0501040_0011783 | Ga0501040_0011783_1051_1962 | 301 |
| 390 | 3300049576 | Ga0501040_0256025 | Ga0501040_0256025_139_1050 | 301 |
| 391 | 3300049577 | Ga0501041_0000410 | Ga0501041_0000410_13470_14393 | 301 |
| 392 | 3300049577 | Ga0501041_0028889 | Ga0501041_0028889_124_1038 | 301 |
| 393 | 3300049578 | Ga0501042_0003570 | Ga0501042_0003570_7055_7978 | 301 |
| 394 | 3300049578 | Ga0501042_0020484 | Ga0501042_0020484_2490_3404 | 301 |
| 395 | 3300049578 | Ga0501042_0024125 | Ga0501042_0024125_973_1884 | 301 |
| 396 | 3300049579 | Ga0501043_0004093 | Ga0501043_0004093_503_1420 | 301 |
| 397 | 3300049579 | Ga0501043_0008049 | Ga0501043_0008049_527_1450 | 301 |
| 398 | 3300049579 | Ga0501043_0224322 | Ga0501043_0224322_323_1240 | 301 |
| 399 | 3300049580 | Ga0501046_0006832 | Ga0501046_0006832_8304_9227 | 301 |
| 400 | 3300049581 | Ga0501047_0010304 | Ga0501047_0010304_6455_7372 | 301 |
| 401 | 3300049581 | Ga0501047_0107094 | Ga0501047_0107094_608_1531 | 301 |
| 402 | 3300049581 | Ga0501047_0261245 | Ga0501047_0261245_344_1261 | 301 |
| 403 | 3300049582 | Ga0501048_0001243 | Ga0501048_0001243_11311_12234 | 301 |
| 404 | 3300049582 | Ga0501048_0033077 | Ga0501048_0033077_2125_3036 | 301 |
| 405 | 3300049582 | Ga0501048_0046217 | Ga0501048_0046217_598_1512 | 301 |
| 406 | 3300049582 | Ga0501048_0072281 | Ga0501048_0072281_875_1786 | 301 |
| 407 | 3300049587 | Ga0501071_0008661 | Ga0501071_0008661_4467_5390 | 301 |
| 408 | 3300049587 | Ga0501071_0014198 | Ga0501071_0014198_3113_4027 | 301 |
| 409 | 3300049588 | Ga0501072_0002099 | Ga0501072_0002099_10360_11271 | 301 |
| 410 | 3300049588 | Ga0501072_0007920 | Ga0501072_0007920_6916_7839 | 301 |
| 411 | 3300049588 | Ga0501072_0046888 | Ga0501072_0046888_2289_3203 | 301 |
| 412 | 3300049588 | Ga0501072_0097956 | Ga0501072_0097956_1206_2117 | 301 |
| 413 | 3300049590 | Ga0501074_0001772 | Ga0501074_0001772_5128_6051 | 301 |
| 414 | 3300049591 | Ga0501075_0000696 | Ga0501075_0000696_4405_5328 | 301 |
| 415 | 3300049591 | Ga0501075_0001299 | Ga0501075_0001299_13452_14363 | 301 |
| 416 | 3300049591 | Ga0501075_0009119 | Ga0501075_0009119_124_1038 | 301 |
| 417 | 3300049591 | Ga0501075_0065318 | Ga0501075_0065318_934_1845 | 301 |
| 418 | 3300049592 | Ga0501076_0000856 | Ga0501076_0000856_7286_8209 | 301 |
| 419 | 3300049592 | Ga0501076_0000922 | Ga0501076_0000922_6900_7811 | 301 |
| 420 | 3300049593 | Ga0501077_0022401 | Ga0501077_0022401_1436_2359 | 301 |
| 421 | 3300049741 | Ga0501079_0000165 | Ga0501079_0000165_7062_7985 | 301 |
| 422 | 3300049741 | Ga0501079_0006707 | Ga0501079_0006707_6858_7772 | 301 |
| 423 | 3300049741 | Ga0501079_0042767 | Ga0501079_0042767_1042_1953 | 301 |
| 424 | 3300049742 | Ga0501080_0029215 | Ga0501080_0029215_1020_1934 | 301 |
| 425 | 3300049742 | Ga0501080_0036464 | Ga0501080_0036464_1281_2204 | 301 |
| 426 | 3300049742 | Ga0501080_0273878 | Ga0501080_0273878_598_1503 | 301 |
| 427 | 3300049743 | Ga0501081_0001217 | Ga0501081_0001217_7055_7978 | 301 |
| 428 | 3300049743 | Ga0501081_0002100 | Ga0501081_0002100_3998_4909 | 301 |
| 429 | 3300049743 | Ga0501081_0020447 | Ga0501081_0020447_1552_2466 | 301 |
| 430 | 3300049743 | Ga0501081_0032760 | Ga0501081_0032760_1509_2420 | 301 |
| 431 | 3300049743 | Ga0501081_0101061 | Ga0501081_0101061_324_1235 | 301 |
| 432 | 3300049822 | Ga0501035_0000021 | Ga0501035_0000021_92349_93266 | 301 |
| 433 | 3300049822 | Ga0501035_0076614 | Ga0501035_0076614_684_1607 | 301 |
| 434 | 3300049822 | Ga0501035_0126425 | Ga0501035_0126425_224_1135 | 301 |
| 435 | 3300049824 | Ga0501045_0000012 | Ga0501045_0000012_6972_7895 | 301 |
| 436 | 3300049824 | Ga0501045_0000154 | Ga0501045_0000154_23011_23925 | 301 |
| 437 | 3300049824 | Ga0501045_0026584 | Ga0501045_0026584_786_1697 | 301 |
| 438 | 3300049824 | Ga0501045_0106335 | Ga0501045_0106335_620_1531 | 301 |
| 439 | 3300050507 | nmdc:mga05p37_113855_c1 | nmdc:mga05p37_113855_c1_1660_2565 | 301 |
| 440 | 3300050507 | nmdc:mga05p37_150198_c1 | nmdc:mga05p37_150198_c1_1539_2450 | 301 |
| 441 | 3300050507 | nmdc:mga05p37_623_c1 | nmdc:mga05p37_623_c1_26971_27894 | 301 |
| 442 | 3300050508 | nmdc:mga09592_1081_c1 | nmdc:mga09592_1081_c1_2309_3214 | 301 |
| 443 | 3300050508 | nmdc:mga09592_139675_c1 | nmdc:mga09592_139675_c1_512_1417 | 301 |
| 444 | 3300050508 | nmdc:mga09592_2644_c1 | nmdc:mga09592_2644_c1_4589_5512 | 301 |
| 445 | 3300050509 | nmdc:mga0qj67_101644_c1 | nmdc:mga0qj67_101644_c1_423_1328 | 301 |
| 446 | 3300050509 | nmdc:mga0qj67_10939_c1 | nmdc:mga0qj67_10939_c1_802_1713 | 301 |
| 447 | 3300050509 | nmdc:mga0qj67_58315_c1 | nmdc:mga0qj67_58315_c1_894_1799 | 301 |
| 448 | 3300050510 | nmdc:mga06r32_143478_c1 | nmdc:mga06r32_143478_c1_1007_1912 | 301 |
| 449 | 3300050510 | nmdc:mga06r32_204832_c1 | nmdc:mga06r32_204832_c1_972_1877 | 301 |
| 450 | 3300050510 | nmdc:mga06r32_216119_c1 | nmdc:mga06r32_216119_c1_134_1045 | 301 |
| 451 | 3300050511 | nmdc:mga08y16_11393_c1 | nmdc:mga08y16_11393_c1_561_1466 | 301 |
| 452 | 3300050511 | nmdc:mga08y16_165879_c1 | nmdc:mga08y16_165879_c1_1121_2026 | 301 |
| 453 | 3300050511 | nmdc:mga08y16_18821_c1 | nmdc:mga08y16_18821_c1_6358_7263 | 301 |
| 454 | 3300050511 | nmdc:mga08y16_23213_c1 | nmdc:mga08y16_23213_c1_1274_2197 | 301 |
| 455 | 3300050511 | nmdc:mga08y16_293350_c1 | nmdc:mga08y16_293350_c1_72_977 | 301 |
| 456 | 3300050511 | nmdc:mga08y16_39231_c1 | nmdc:mga08y16_39231_c1_209_1132 | 301 |
| 457 | 3300050512 | nmdc:mga0n895_29872_c1 | nmdc:mga0n895_29872_c1_1297_2220 | 301 |
| 458 | 3300050512 | nmdc:mga0n895_3455_c1 | nmdc:mga0n895_3455_c1_5619_6524 | 301 |
| 459 | 3300050513 | nmdc:mga0rr50_10819_c1 | nmdc:mga0rr50_10819_c1_704_1609 | 301 |
| 460 | 3300050513 | nmdc:mga0rr50_2773_c1 | nmdc:mga0rr50_2773_c1_4253_5176 | 301 |
| 461 | 3300050514 | nmdc:mga08x19_21311_c1 | nmdc:mga08x19_21311_c1_1762_2667 | 301 |
| 462 | 3300050514 | nmdc:mga08x19_2340_c1 | nmdc:mga08x19_2340_c1_2486_3391 | 301 |
| 463 | 3300050514 | nmdc:mga08x19_3542_c1 | nmdc:mga08x19_3542_c1_6993_7916 | 301 |
| 464 | 3300050514 | nmdc:mga08x19_4566_c1 | nmdc:mga08x19_4566_c1_3130_4044 | 301 |
| 465 | 3300050515 | nmdc:mga0a205_956_c1 | nmdc:mga0a205_956_c1_5060_5983 | 301 |
| 466 | 3300053077 | Ga0495601_0152613 | Ga0495601_0152613_100_1005 | 301 |
| 467 | 3300054114 | Ga0501084_0000200 | Ga0501084_0000200_38554_39477 | 301 |
| 468 | 3300054114 | Ga0501084_0022056 | Ga0501084_0022056_2694_3605 | 301 |
| 469 | 3300060353 | Ga0501082_0022004 | Ga0501082_0022004_1496_2419 | 301 |
| 470 | 3300060353 | Ga0501082_0030307 | Ga0501082_0030307_529_1443 | 301 |
| 471 | 3300061734 | Ga0530510_0000977 | Ga0530510_0000977_16961_17872 | 301 |
| 472 | 3300061734 | Ga0530510_0003503 | Ga0530510_0003503_8546_9460 | 301 |
| 473 | 3300061734 | Ga0530510_0040875 | Ga0530510_0040875_1773_2696 | 301 |
| 474 | iso_pu_bacteria | 2728368998 | 2728754123 | 301 |
| 475 | iso_pu_bacteria | 2929520902 | 2929524166 | 301 |
| 476 | iso_pu_bacteria | 2842677519 | 2842682669 | 305 |
| 477 | 3300003187 | JGI25151J46595_10000775 | JGI25151J46595_1000077520 | 309 |
| 478 | 3300009036 | Ga0105244_10107821 | Ga0105244_101078211 | 309 |
| 479 | 3300025258 | Ga0209129_1005606 | Ga0209129_10056062 | 309 |
| 480 | 3300025294 | Ga0209025_1000122 | Ga0209025_100012227 | 309 |
| 481 | 3300050496 | nmdc:mga07m45_58766_c1 | nmdc:mga07m45_58766_c1_650_1579 | 309 |
| 482 | 3300053079 | Ga0500610_0001230 | Ga0500610_0001230_2923_3852 | 309 |
| 483 | 3300053122 | Ga0500608_092181 | Ga0500608_092181_79_1008 | 309 |
| 484 | 3300053136 | Ga0500559_0012754 | Ga0500559_0012754_2271_3200 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gz6-assembly1.cif.gz_B | (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 | 0.9386 | 2 | 283 |
| 1gz6-assembly2.cif.gz_C | (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 | 0.9349 | 2 | 283 |
| 5itv-assembly3.cif.gz_D | crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh | 0.9289 | 2 | 250 |
| 3tfo-assembly1.cif.gz_C | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9278 | 5 | 249 |
| 3edm-assembly1.cif.gz_D | crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens | 0.927 | 2 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2et6A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9654 | 1 | 259 | 3.40.50.720 |
| 1gz6A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.948 | 2 | 256 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9289 | 2 | 250 | 3.40.50.720 |
| af_P96825_7_283_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.926 | 5 | 295 | 3.40.50.720 |
| 1gz6A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9247 | 2 | 256 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6T3P7-F1-model_v4 | Short-chain dehydrogenase | 0.9636 | 1 | 196 |
GO:0016491
|
| AF-A0A7C4SFP5-F1-model_v4 | SDR family oxidoreductase | 0.9601 | 2 | 200 |
GO:0016616
GO:0030497 |
| AF-A0A5C7XHG4-F1-model_v4 | SDR family oxidoreductase | 0.9595 | 2 | 196 |
GO:0016491
|
| AF-A0A428UDL8-F1-model_v4 | Peroxisomal hydratase-dehydrogenase-epimerase | 0.9572 | 3 | 257 |
GO:0005777
GO:0006635 GO:0016491 GO:0016829 |
| AF-A0A2V8EYB2-F1-model_v4 | Oxidoreductase | 0.9565 | 55 | 198 |
GO:0016020
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar