F452465

General Info

Members Datasets Scaffolds Average Seq Length
481 283 448 155

Family's Representative Sequence

Representative Sequence 3300042127|Ga0450890_029944|Ga0450890_029944_155_703
Length 182
Sequence MPAVVGVLARCHHLRALDRLHLNKESEMVQRRMFVAGSLGLALPAWAHHGWSSFDQDRPLYLEGRATKVMWRNPHGELELELPENLALPPDLKQRPLPRQSTAVDGPGLLAKAQLPTRRDRKWLVELAPLTRLQAWGVEEIKPGTPVAVLGFTFTGEKGDPVLRAEYLFVGGKAYGLRSSPA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
12 2643221656 Pelomonas sp. Root405 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2831864461 Roseateles noduli HZ7 Isolate Nodule
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
20 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
21 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
22 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
23 2904456579 Variovorax sp. 2002 Isolate Unclassified
24 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
25 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
26 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
27 2928070936 Variovorax gossypii 1167 Isolate Unclassified
28 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
29 2929520902 Variovorax beijingensis 502 Isolate Unclassified
30 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
31 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
32 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
33 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
34 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
106 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
176 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
177 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
205 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
206 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
212 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
213 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
214 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
215 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
216 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
217 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
218 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
219 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
220 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
257 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
258 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
259 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
276 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
281 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.72
Metatranscriptomes 0.21
Isolates 7.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.32
Nodule 1.04
Rhizoplane 2.91
Rhizosphere 62.79
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10070810 3300001989 Bacteria 1085
2 JGI25152J39213_1001702 3300002773 Bacteria 9033
3 JGI25151J46595_10007671 3300003187 Bacteria 5263
4 JGI25153J46596_10001783 3300003215 Bacteria 12764
5 JGI25153J46596_10004517 3300003215 Bacteria 7487
6 rootH1_10013138 3300003316 Bacteria 2133
7 rootH2_10046829 3300003320 Bacteria 1546
8 rootL2_10003084 3300003322 Bacteria 20643
9 rootH1_10001103 3300003316 Bacteria 17593
10 rootH1_10001103 3300003323 Bacteria 2047
11 rootH1_10131997 3300003323 Bacteria 5856
12 Ga0006562J51391_1059464 3300003578 Bacteria 2790
13 Ga0055526_1002755 3300003771 Bacteria 11652
14 Ga0055526_1002957 3300003771 Bacteria 11137
15 Ga0055537_1000515 3300003773 Bacteria 22842
16 Ga0055536_1001230 3300003781 Bacteria 15819
17 Ga0055534_1000092 3300003784 Bacteria 70082
18 Ga0055528_1000190 3300003790 Bacteria 52365
19 Ga0055528_1000956 3300003790 Bacteria 19155
20 Ga0055540_1000013 3300003792 Bacteria 262274
21 Ga0055540_1004017 3300003792 Bacteria 6850
22 Ga0055540_1004209 3300003792 Bacteria 6610
23 Ga0055531_10003580 3300003794 Bacteria 9842
24 Ga0055531_10012723 3300003794 Bacteria 3933
25 Ga0055531_10067226 3300003794 Bacteria 843
26 Ga0055543_1001983 3300004625 Bacteria 7284
27 Ga0065165_1000214 3300005262 Bacteria 100283
28 Ga0065165_1000239 3300005262 Bacteria 94061
29 Ga0065714_10128494 3300005288 Bacteria 1265
30 Ga0065704_10115160 3300005289 Bacteria 1877
31 Ga0070658_10462654 3300005327 Bacteria 1094
32 Ga0070676_10296564 3300005328 Bacteria 1094
33 Ga0070676_10463088 3300005328 Bacteria 894
34 Ga0070670_100057275 3300005331 Bacteria 3346
35 Ga0070677_10001760 3300005333 Bacteria 6842
36 Ga0070677_10021412 3300005333 Bacteria 2371
37 Ga0068868_100241845 3300005338 Bacteria 1517
38 Ga0068868_100269292 3300005338 Bacteria 1439
39 Ga0070661_100823056 3300005344 Bacteria 763
40 Ga0070668_100045281 3300005347 Bacteria 3376
41 Ga0070669_100073728 3300005353 Bacteria 2529
42 Ga0070675_100026553 3300005354 Bacteria 4648
43 Ga0070671_100034516 3300005355 Bacteria 4187
44 Ga0070671_100045514 3300005355 Bacteria 3648
45 Ga0070671_100046869 3300005355 Bacteria 3595
46 Ga0070671_100321036 3300005355 Bacteria 1319
47 Ga0070674_100007438 3300005356 Bacteria 6461
48 Ga0070674_100117058 3300005356 Bacteria 1967
49 Ga0070674_100166171 3300005356 Bacteria 1678
50 Ga0070673_100005635 3300005364 Bacteria 8038
51 Ga0070673_100088981 3300005364 Bacteria 2519
52 Ga0070673_100351087 3300005364 Bacteria 1309
53 Ga0070688_100226947 3300005365 Bacteria 1319
54 Ga0070667_100146428 3300005367 Bacteria 2072
55 Ga0070667_100403545 3300005367 Bacteria 1244
56 Ga0070663_100063131 3300005455 Bacteria 2673
57 Ga0070678_100028267 3300005456 Bacteria 3822
58 Ga0070678_100073623 3300005456 Bacteria 2564
59 Ga0070678_100674244 3300005456 Unclassified 929
60 Ga0070662_100106749 3300005457 Bacteria 2128
61 Ga0068867_100014852 3300005459 Bacteria 5520
62 Ga0068867_100101065 3300005459 Bacteria 2202
63 Ga0068867_100141672 3300005459 Bacteria 1880
64 Ga0068867_100229573 3300005459 Bacteria 1500
65 Ga0068853_100126321 3300005539 Bacteria 2285
66 Ga0068853_100405445 3300005539 Unclassified 1277
67 Ga0070672_100014317 3300005543 Bacteria 5620
68 Ga0070672_100020075 3300005543 Bacteria 4867
69 Ga0070672_100039128 3300005543 Bacteria 3630
70 Ga0070672_100230535 3300005543 Bacteria 1556
71 Ga0070672_100664696 3300005543 Bacteria 911
72 Ga0070672_101280815 3300005543 Bacteria 654
73 Ga0070665_100175486 3300005548 Bacteria 2144
74 Ga0070665_100269049 3300005548 Bacteria 1706
75 Ga0070664_100799661 3300005564 Bacteria 882
76 Ga0068854_100157629 3300005578 Bacteria 1755
77 Ga0068854_100583440 3300005578 Bacteria 952
78 Ga0068852_100032624 3300005616 Bacteria 4314
79 Ga0068852_100139003 3300005616 Bacteria 2246
80 Ga0068864_100043665 3300005618 Bacteria 3838
81 Ga0068866_10107070 3300005718 Bacteria 1553
82 Ga0068861_100059654 3300005719 Bacteria 2922
83 Ga0068851_10027500 3300005834 Bacteria 2804
84 Ga0068851_10568179 3300005834 Bacteria 687
85 Ga0068863_100678359 3300005841 Bacteria 1023
86 Ga0068863_102288735 3300005841 Bacteria 550
87 Ga0068862_100057026 3300005844 Bacteria 3348
88 Ga0075365_10011332 3300006038 Bacteria 5239
89 Ga0075365_10450300 3300006038 Bacteria 909
90 Ga0075368_10047903 3300006042 Bacteria 1693
91 Ga0075368_10479244 3300006042 Bacteria 554
92 Ga0075363_100023060 3300006048 Bacteria 3151
93 Ga0075363_100475055 3300006048 Bacteria 740
94 Ga0075364_10011533 3300006051 Bacteria 5372
95 Ga0075364_10388563 3300006051 Bacteria 952
96 Ga0075362_10049885 3300006177 Bacteria 1871
97 Ga0075362_10564361 3300006177 Bacteria 586
98 Ga0075367_10243768 3300006178 Bacteria 1126
99 Ga0075369_10017248 3300006186 Bacteria 2923
100 Ga0075366_10002313 3300006195 Bacteria 9747
101 Ga0075366_10137233 3300006195 Bacteria 1477
102 Ga0075366_10173042 3300006195 Bacteria 1310
103 Ga0075366_10369481 3300006195 Bacteria 881
104 Ga0075366_10492661 3300006195 Bacteria 757
105 Ga0075366_10602224 3300006195 Bacteria 681
106 Ga0075366_10832177 3300006195 Bacteria 574
107 Ga0075370_10000363 3300006353 Bacteria 16630
108 Ga0075370_10169435 3300006353 Bacteria 1283
109 Ga0075370_10188049 3300006353 Bacteria 1216
110 Ga0075370_10212037 3300006353 Bacteria 1143
111 Ga0075370_10480756 3300006353 Bacteria 749
112 Ga0068871_100067879 3300006358 Bacteria 2927
113 Ga0068865_100142000 3300006881 Bacteria 1811
114 Ga0068865_100459616 3300006881 Bacteria 1054
115 Ga0099826_10000115 3300006948 Bacteria 36769
116 Ga0099826_10155283 3300006948 Bacteria 1304
117 Ga0105240_10012876 3300009093 Bacteria 11520
118 Ga0105243_10050268 3300009148 Bacteria 3293
119 Ga0105243_10055453 3300009148 Bacteria 3149
120 Ga0105241_10420738 3300009174 Bacteria 1176
121 Ga0105248_11243595 3300009177 Bacteria 842
122 Ga0105237_10000556 3300009545 Bacteria 52272
123 Ga0105238_10058270 3300009551 Bacteria 3872
124 Ga0105249_10026054 3300009553 Bacteria 5266
125 Ga0105239_10003145 3300010375 Bacteria 20491
126 Ga0157319_1000031 3300012497 Bacteria 48442
127 Ga0157347_1001884 3300012502 Bacteria 1722
128 Ga0157373_10015938 3300013100 Bacteria 5486
129 Ga0157370_10167600 3300013104 Bacteria 2042
130 Ga0163162_10153121 3300013306 Bacteria 2424
131 Ga0163162_10176032 3300013306 Bacteria 2265
132 Ga0163162_11411029 3300013306 Bacteria 792
133 Ga0157375_10108195 3300013308 Bacteria 2874
134 Ga0157375_10242279 3300013308 Bacteria 1963
135 Ga0163163_10769676 3300014325 Bacteria 1026
136 Ga0157380_10015082 3300014326 Bacteria 5670
137 Ga0182008_10006490 3300014497 Bacteria 6531
138 Ga0182008_10028897 3300014497 Bacteria 2803
139 Ga0157377_10075714 3300014745 Bacteria 1955
140 Ga0157377_10542984 3300014745 Bacteria 820
141 Ga0157376_10027741 3300014969 Bacteria 4492
142 Ga0157376_10105969 3300014969 Bacteria 2466
143 Ga0182006_1060979 3300015261 Bacteria 1423
144 Ga0163161_10079387 3300017792 Bacteria 2413
145 Ga0163161_10171719 3300017792 Bacteria 1658
146 Ga0163161_10604383 3300017792 Bacteria 904
147 Ga0207425_1000221 3300025245 Bacteria 44837
148 Ga0209129_1000012 3300025258 Bacteria 541516
149 Ga0209129_1043930 3300025258 Bacteria 699
150 Ga0209565_1000073 3300025263 Bacteria 164695
151 Ga0209565_1006883 3300025263 Bacteria 3136
152 Ga0209565_1037015 3300025263 Bacteria 925
153 Ga0209673_1000127 3300025273 Bacteria 164695
154 Ga0209673_1013897 3300025273 Bacteria 3151
155 Ga0209673_1014969 3300025273 Bacteria 2972
156 Ga0209673_1032506 3300025273 Bacteria 1606
157 Ga0209675_1000029 3300025291 Bacteria 281053
158 Ga0209675_1018835 3300025291 Bacteria 1920
159 Ga0209676_1000142 3300025292 Bacteria 175752
160 Ga0209676_1034661 3300025292 Bacteria 1490
161 Ga0209025_1000351 3300025294 Bacteria 99585
162 Ga0209025_1003418 3300025294 Bacteria 15061
163 Ga0209025_1042193 3300025294 Bacteria 1942
164 Ga0209564_1000003 3300025295 Bacteria 1585848
165 Ga0209564_1000022 3300025295 Bacteria 555109
166 Ga0209564_1021623 3300025295 Bacteria 2304
167 Ga0209758_1000124 3300025297 Bacteria 189933
168 Ga0209758_1000659 3300025297 Bacteria 51717
169 Ga0209050_1000340 3300025298 Bacteria 92794
170 Ga0209050_1000567 3300025298 Bacteria 60093
171 Ga0209050_1059344 3300025298 Bacteria 913
172 Ga0209256_1000015 3300025299 Bacteria 622953
173 Ga0209256_1023064 3300025299 Bacteria 1866
174 Ga0209051_1000022 3300025303 Bacteria 474879
175 Ga0209051_1000416 3300025303 Bacteria 58872
176 Ga0209051_1000735 3300025303 Bacteria 35429
177 Ga0209051_1057057 3300025303 Bacteria 1254
178 Ga0209257_1000030 3300025304 Bacteria 689812
179 Ga0209257_1002866 3300025304 Bacteria 16088
180 Ga0209257_1027944 3300025304 Bacteria 1866
181 Ga0207697_10019344 3300025315 Bacteria 2788
182 Ga0207697_10079021 3300025315 Bacteria 1385
183 Ga0207682_10016445 3300025893 Bacteria 2885
184 Ga0207682_10027727 3300025893 Bacteria 2256
185 Ga0207688_10137951 3300025901 Bacteria 1434
186 Ga0207688_10183844 3300025901 Bacteria 1248
187 Ga0207645_10027891 3300025907 Bacteria 3646
188 Ga0207645_10114730 3300025907 Bacteria 1746
189 Ga0207705_10092264 3300025909 Bacteria 2219
190 Ga0207654_10261602 3300025911 Bacteria 1163
191 Ga0207695_10391363 3300025913 Bacteria 1275
192 Ga0207671_10001994 3300025914 Bacteria 22499
193 Ga0207681_10042839 3300025923 Bacteria 3026
194 Ga0207681_10175593 3300025923 Bacteria 1627
195 Ga0207681_10720996 3300025923 Bacteria 830
196 Ga0207694_10075912 3300025924 Bacteria 2631
197 Ga0207650_10000551 3300025925 Bacteria 30436
198 Ga0207650_10699271 3300025925 Bacteria 856
199 Ga0207659_10002206 3300025926 Bacteria 11582
200 Ga0207659_10150579 3300025926 Bacteria 1816
201 Ga0207659_10605308 3300025926 Bacteria 934
202 Ga0207644_10004401 3300025931 Bacteria 9138
203 Ga0207644_10030770 3300025931 Bacteria 3736
204 Ga0207644_10048265 3300025931 Bacteria 3043
205 Ga0207644_10462662 3300025931 Bacteria 1043
206 Ga0207706_10178440 3300025933 Bacteria 1865
207 Ga0207706_10272967 3300025933 Bacteria 1475
208 Ga0207686_10025505 3300025934 Bacteria 3438
209 Ga0207709_10000771 3300025935 Bacteria 25177
210 Ga0207709_10265420 3300025935 Bacteria 1261
211 Ga0207709_10392728 3300025935 Unclassified 1058
212 Ga0207709_10743205 3300025935 Bacteria 788
213 Ga0207669_10014228 3300025937 Bacteria 3982
214 Ga0207669_10038692 3300025937 Bacteria 2749
215 Ga0207669_10101966 3300025937 Bacteria 1900
216 Ga0207669_10116172 3300025937 Bacteria 1805
217 Ga0207669_10193503 3300025937 Bacteria 1469
218 Ga0207704_10129236 3300025938 Bacteria 1746
219 Ga0207704_10205911 3300025938 Bacteria 1444
220 Ga0207691_10017528 3300025940 Bacteria 6788
221 Ga0207691_10057289 3300025940 Bacteria 3547
222 Ga0207691_10057895 3300025940 Bacteria 3526
223 Ga0207691_10173250 3300025940 Bacteria 1889
224 Ga0207691_10249313 3300025940 Bacteria 1533
225 Ga0207691_10694366 3300025940 Bacteria 858
226 Ga0207679_10212072 3300025945 Bacteria 1625
227 Ga0207651_10145642 3300025960 Bacteria 1836
228 Ga0207651_11166530 3300025960 Bacteria 691
229 Ga0207712_10026494 3300025961 Bacteria 3863
230 Ga0207668_10924510 3300025972 Bacteria 777
231 Ga0207668_10970597 3300025972 Bacteria 758
232 Ga0207640_10738480 3300025981 Bacteria 847
233 Ga0207658_10428689 3300025986 Bacteria 1167
234 Ga0207658_10782914 3300025986 Bacteria 865
235 Ga0207658_10917444 3300025986 Unclassified 798
236 Ga0207677_10188417 3300026023 Bacteria 1629
237 Ga0207639_10097087 3300026041 Bacteria 2372
238 Ga0207639_11312010 3300026041 Bacteria 679
239 Ga0207678_10415539 3300026067 Bacteria 1166
240 Ga0207641_10705442 3300026088 Bacteria 994
241 Ga0207648_10023780 3300026089 Bacteria 5481
242 Ga0207648_10065278 3300026089 Bacteria 3173
243 Ga0207648_10112028 3300026089 Bacteria 2396
244 Ga0207648_10122042 3300026089 Bacteria 2291
245 Ga0207648_10168049 3300026089 Bacteria 1938
246 Ga0207676_10046563 3300026095 Bacteria 3357
247 Ga0207675_100058145 3300026118 Bacteria 3608
248 Ga0207683_10037417 3300026121 Bacteria 4226
249 Ga0207683_10047577 3300026121 Bacteria 3757
250 Ga0207683_10195323 3300026121 Bacteria 1838
251 Ga0207683_10271140 3300026121 Bacteria 1550
252 Ga0207683_10464177 3300026121 Bacteria 1168
253 Ga0207698_10046642 3300026142 Bacteria 3274
254 Ga0209282_1000109 3300027666 Bacteria 53813
255 Ga0209282_1056017 3300027666 Bacteria 2226
256 Ga0209813_10143053 3300027866 Bacteria 851
257 Ga0209974_10015885 3300027876 Bacteria 2500
258 Ga0268266_10013479 3300028379 Bacteria 7037
259 Ga0268266_10096896 3300028379 Bacteria 2594
260 Ga0268266_10196130 3300028379 Bacteria 1846
261 Ga0268266_10414033 3300028379 Bacteria 1276
262 Ga0268266_10507379 3300028379 Bacteria 1152
263 Ga0268265_10049148 3300028380 Bacteria 3170
264 Ga0268265_10677357 3300028380 Bacteria 994
265 Ga0307517_10000131 3300028786 Bacteria 113233
266 Ga0307515_10051701 3300028794 Bacteria 6117
267 Ga0307515_10265779 3300028794 Bacteria 1444
268 Ga0307515_10367325 3300028794 Bacteria 1077
269 Ga0307512_10252372 3300030522 Bacteria 877
270 Ga0316177_1138618 3300030731 Bacteria 3144
271 Ga0314311_1220007 3300030733 Bacteria 5952
272 Ga0316179_1067495 3300030734 Bacteria 2603
273 Ga0316178_1033335 3300030735 Bacteria 3012
274 Ga0316180_1175341 3300030736 Bacteria 2933
275 Ga0316183_1024856 3300030742 Bacteria 5288
276 Ga0316183_1049727 3300030742 Bacteria 842
277 Ga0316181_1130584 3300030744 Bacteria 3270
278 Ga0316182_1103539 3300030745 Bacteria 2893
279 Ga0307513_10059255 3300031456 Bacteria 4064
280 Ga0307513_10110571 3300031456 Bacteria 2742
281 Ga0307408_100301187 3300031548 Bacteria 1343
282 Ga0307408_100456013 3300031548 Bacteria 1110
283 Ga0307408_100735846 3300031548 Bacteria 889
284 Ga0307408_100957439 3300031548 Bacteria 787
285 Ga0307508_10002230 3300031616 Bacteria 20644
286 Ga0307514_10032081 3300031649 Bacteria 4208
287 Ga0307514_10113270 3300031649 Bacteria 1915
288 Ga0307514_10383372 3300031649 Bacteria 728
289 Ga0307516_10005507 3300031730 Bacteria 15108
290 Ga0307516_10897799 3300031730 Bacteria 552
291 Ga0307405_10028267 3300031731 Bacteria 3264
292 Ga0307405_10030394 3300031731 Bacteria 3167
293 Ga0307405_10080690 3300031731 Bacteria 2124
294 Ga0307405_10593996 3300031731 Bacteria 902
295 Ga0307405_11031086 3300031731 Bacteria 703
296 Ga0307405_11449064 3300031731 Bacteria 602
297 Ga0307406_10179472 3300031901 Bacteria 1540
298 Ga0307406_10231006 3300031901 Bacteria 1381
299 Ga0307406_10760446 3300031901 Bacteria 814
300 Ga0307407_10383447 3300031903 Bacteria 1004
301 Ga0307412_10009490 3300031911 Bacteria 5586
302 Ga0307412_10021853 3300031911 Bacteria 3913
303 Ga0307412_10064520 3300031911 Bacteria 2475
304 Ga0307412_10312317 3300031911 Bacteria 1247
305 Ga0307409_100001481 3300031995 Bacteria 11581
306 Ga0307409_101777913 3300031995 Bacteria 645
307 Ga0307416_100042646 3300032002 Bacteria 3544
308 Ga0307416_100097209 3300032002 Bacteria 2549
309 Ga0307416_100147812 3300032002 Bacteria 2149
310 Ga0307416_100956570 3300032002 Bacteria 958
311 Ga0307416_101065051 3300032002 Bacteria 913
312 Ga0307414_10036703 3300032004 Bacteria 3275
313 Ga0307414_10356235 3300032004 Bacteria 1257
314 Ga0307414_10457875 3300032004 Bacteria 1120
315 Ga0307414_10853764 3300032004 Bacteria 833
316 Ga0307414_11561114 3300032004 Unclassified 615
317 Ga0307411_10014946 3300032005 Bacteria 4339
318 Ga0307411_10015588 3300032005 Bacteria 4274
319 Ga0307411_10030479 3300032005 Bacteria 3306
320 Ga0307411_10048508 3300032005 Bacteria 2752
321 Ga0307411_10289032 3300032005 Bacteria 1309
322 Ga0307411_10456924 3300032005 Bacteria 1070
323 Ga0307411_10898241 3300032005 Bacteria 787
324 Ga0307415_100002275 3300032126 Bacteria 9522
325 Ga0395905_0488850 3300037471 Bacteria 1130
326 Ga0395905_0509398 3300037471 Bacteria 1104
327 Ga0395901_0100456 3300038443 Bacteria 3035
328 Ga0439436_0019638 3300041404 Bacteria 2016
329 Ga0439466_0160283 3300041411 Bacteria 688
330 Ga0439466_0187040 3300041411 Bacteria 631
331 Ga0439465_0061700 3300041413 Bacteria 1243
332 Ga0451793_1560530 3300041452 Bacteria 1038
333 Ga0451800_0738399 3300041459 Bacteria 1475
334 Ga0451807_0984004 3300041486 Bacteria 1311
335 Ga0451807_2015579 3300041486 Bacteria 712
336 Ga0451841_0178986 3300041498 Bacteria 778
337 Ga0451841_0179819 3300041498 Bacteria 675
338 Ga0451845_0679999 3300041501 Bacteria 657
339 Ga0451847_1005878 3300041503 Unclassified 527
340 Ga0451855_0218407 3300041511 Bacteria 1073
341 Ga0439431_0046688 3300041997 Bacteria 1115
342 Ga0439442_007028 3300042002 Bacteria 2260
343 Ga0439442_032331 3300042002 Bacteria 1093
344 Ga0439445_0072087 3300042004 Bacteria 957
345 Ga0439432_007316 3300042006 Bacteria 3917
346 Ga0439449_0000494 3300042007 Bacteria 14768
347 Ga0439457_009985 3300042014 Bacteria 2196
348 Ga0439462_0052107 3300042015 Bacteria 1101
349 Ga0450920_018762 3300042122 Bacteria 1326
350 Ga0450921_002486 3300042123 Bacteria 1229
351 Ga0450923_012089 3300042125 Bacteria 1566
352 Ga0450888_007172 3300042126 Bacteria 1226
353 Ga0450888_017506 3300042126 Bacteria 890
354 Ga0450890_001466 3300042127 Bacteria 3387
355 Ga0450890_029944 3300042127 Bacteria 771
356 Ga0450906_012888 3300042145 Bacteria 1546
357 Ga0450908_000937 3300042184 Bacteria 5617
358 Ga0439434_0013822 3300042435 Bacteria 2398
359 Ga0439459_0000148 3300042438 Bacteria 7133
360 Ga0439464_0090002 3300042439 Bacteria 924
361 Ga0450918_001068 3300042531 Bacteria 5648
362 Ga0451577_0000801 3300042876 Bacteria 47265
363 Ga0451577_0001915 3300042876 Bacteria 26373
364 Ga0451577_0014784 3300042876 Bacteria 7273
365 Ga0451577_0055160 3300042876 Bacteria 3546
366 Ga0453684_0021477 3300044712 Bacteria 9644
367 Ga0451576_0001586 3300045051 Bacteria 38223
368 Ga0451576_0478413 3300045051 Bacteria 1308
369 Ga0451576_1756001 3300045051 Bacteria 642
370 Ga0495590_0006495 3300046457 Bacteria 4563
371 Ga0495638_0194108 3300046460 Bacteria 1150
372 Ga0495650_0132328 3300046471 Bacteria 909
373 Ga0495610_0020402 3300046512 Bacteria 3680
374 Ga0495610_0098606 3300046512 Bacteria 1312
375 Ga0495632_0001118 3300046519 Bacteria 22996
376 Ga0495632_0034711 3300046519 Bacteria 2578
377 Ga0495637_0015355 3300046520 Bacteria 3591
378 Ga0495643_0063978 3300046522 Bacteria 1944
379 Ga0495643_0219301 3300046522 Bacteria 903
380 Ga0495648_0330776 3300046524 Bacteria 703
381 Ga0495654_0045534 3300046530 Bacteria 2164
382 Ga0495621_0004476 3300046539 Bacteria 3935
383 Ga0495656_0007765 3300046615 Bacteria 3806
384 Ga0495625_0000396 3300046660 Bacteria 66627
385 Ga0495625_0007028 3300046660 Bacteria 9906
386 Ga0495625_0035547 3300046660 Bacteria 3671
387 Ga0495659_0433187 3300046664 Bacteria 571
388 Ga0495661_0116514 3300046665 Bacteria 1482
389 Ga0495588_0014019 3300046674 Bacteria 3830
390 Ga0495670_0045433 3300046691 Bacteria 2193
391 Ga0495660_0091424 3300046810 Bacteria 1581
392 Ga0495660_0457203 3300046810 Bacteria 551
393 Ga0495681_0267568 3300047470 Bacteria 670
394 Ga0496101_0135072 3300048904 Bacteria 1876
395 Ga0496102_0028206 3300048905 Bacteria 5014
396 Ga0496108_0008496 3300048911 Bacteria 8332
397 Ga0496108_0687609 3300048911 Bacteria 888
398 Ga0496109_0217663 3300048912 Bacteria 1796
399 Ga0496109_0935113 3300048912 Bacteria 805
400 Ga0496110_0679770 3300048913 Bacteria 930
401 Ga0496117_0036687 3300048920 Bacteria 3664
402 Ga0496125_0026014 3300048928 Bacteria 5344
403 Ga0496125_0101387 3300048928 Bacteria 2119
404 Ga0496126_0065309 3300048929 Bacteria 3257
405 Ga0501292_020706 3300049515 Bacteria 1061
406 Ga0501034_0563398 3300049571 Bacteria 1048
407 Ga0501257_022724 3300049686 Bacteria 1485
408 Ga0501225_0012882 3300049705 Bacteria 2344
409 Ga0501262_000472 3300049759 Bacteria 4802
410 Ga0501281_04700 3300049777 Bacteria 957
411 Ga0501035_1141013 3300049822 Bacteria 607
412 nmdc:mga03683_67845_c1 3300050489 Bacteria 1519
413 nmdc:mga03n38_443994_c1 3300050490 Bacteria 721
414 nmdc:mga00v17_347837_c1 3300050491 Bacteria 964
415 nmdc:mga00v17_631460_c1 3300050491 Bacteria 689
416 nmdc:mga0yw44_190577_c1 3300050492 Bacteria 1352
417 nmdc:mga0yw44_296661_c1 3300050492 Bacteria 1082
418 nmdc:mga0yw44_929257_c1 3300050492 Bacteria 590
419 nmdc:mga0k408_119745_c1 3300050493 Bacteria 1559
420 nmdc:mga0k408_12364_c1 3300050493 Bacteria 4666
421 nmdc:mga0k408_273448_c1 3300050493 Bacteria 1009
422 nmdc:mga0k408_290104_c1 3300050493 Bacteria 977
423 nmdc:mga0k408_414287_c1 3300050493 Bacteria 801
424 nmdc:mga0k408_52726_c1 3300050493 Bacteria 2357
425 nmdc:mga0k408_83049_c1 3300050493 Bacteria 1878
426 nmdc:mga0k408_83409_c1 3300050493 Bacteria 1874
427 nmdc:mga06z11_220641_c1 3300050494 Bacteria 1108
428 nmdc:mga06z11_24700_c1 3300050494 Bacteria 2839
429 nmdc:mga07m45_1629_c1 3300050496 Bacteria 10333
430 nmdc:mga07m45_236795_c1 3300050496 Bacteria 1062
431 nmdc:mga0sz30_24573_c1 3300050516 Bacteria 2459
432 Ga0500610_0143975 3300053079 Bacteria 1200
433 Ga0500578_0000282 3300053086 Bacteria 62821
434 Ga0500644_0252245 3300053088 Bacteria 744
435 Ga0500651_0056446 3300053093 Bacteria 2459
436 Ga0500651_0063144 3300053093 Bacteria 2312
437 Ga0500562_031382 3300053108 Bacteria 1402
438 Ga0500569_138052 3300053109 Bacteria 819
439 Ga0500569_238789 3300053109 Bacteria 617
440 Ga0500593_010975 3300053117 Bacteria 3814
441 Ga0500614_090551 3300053123 Bacteria 868
442 Ga0500658_0037675 3300053134 Bacteria 1924
443 Ga0500559_0001207 3300053136 Bacteria 15383
444 Ga0500622_0008072 3300053156 Bacteria 5922
445 Ga0500627_0023725 3300053158 Bacteria 2503
446 Ga0500634_0008477 3300053161 Bacteria 5143
447 Ga0500636_0068372 3300053177 Bacteria 2063
448 Ga0500587_002651 3300053739 Bacteria 2538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0000801 Ga0451577_0000801_4595_5062 135
2 3300041498 Ga0451841_0179819 Ga0451841_0179819_26_574 136
3 3300009093 Ga0105240_10012876 Ga0105240_100128762 138
4 3300009551 Ga0105238_10058270 Ga0105238_100582703 138
5 3300005328 Ga0070676_10463088 Ga0070676_104630881 141
6 3300005333 Ga0070677_10021412 Ga0070677_100214122 141
7 3300005543 Ga0070672_100230535 Ga0070672_1002305352 141
8 3300005841 Ga0068863_102288735 Ga0068863_1022887351 141
9 3300013306 Ga0163162_11411029 Ga0163162_114110292 141
10 3300013308 Ga0157375_10108195 Ga0157375_101081953 141
11 3300025893 Ga0207682_10027727 Ga0207682_100277274 141
12 3300025901 Ga0207688_10137951 Ga0207688_101379512 141
13 3300025907 Ga0207645_10027891 Ga0207645_100278913 141
14 3300025926 Ga0207659_10150579 Ga0207659_101505793 141
15 3300025926 Ga0207659_10605308 Ga0207659_106053082 141
16 3300025933 Ga0207706_10272967 Ga0207706_102729671 141
17 3300025940 Ga0207691_10173250 Ga0207691_101732503 141
18 3300025960 Ga0207651_11166530 Ga0207651_111665301 141
19 3300026121 Ga0207683_10195323 Ga0207683_101953232 141
20 3300028794 Ga0307515_10367325 Ga0307515_103673252 142
21 3300005616 Ga0068852_100032624 Ga0068852_1000326243 143
22 3300005543 Ga0070672_100664696 Ga0070672_1006646962 144
23 3300028379 Ga0268266_10507379 Ga0268266_105073793 144
24 3300031730 Ga0307516_10897799 Ga0307516_108977991 144
25 3300042126 Ga0450888_017506 Ga0450888_017506_313_780 146
26 iso_pu_bacteria 2881101125 2881101763 146
27 3300006195 Ga0075366_10492661 Ga0075366_104926611 147
28 3300041503 Ga0451847_1005878 Ga0451847_1005878_12_482 147
29 3300050489 nmdc:mga03683_67845_c1 nmdc:mga03683_67845_c1_1041_1487 147
30 3300050493 nmdc:mga0k408_414287_c1 nmdc:mga0k408_414287_c1_73_540 147
31 iso_pu_bacteria 2842733646 2842734835 147
32 iso_pu_bacteria 2885192300 2885192744 147
33 3300025935 Ga0207709_10392728 Ga0207709_103927282 148
34 3300028380 Ga0268265_10677357 Ga0268265_106773572 148
35 3300031616 Ga0307508_10002230 Ga0307508_1000223013 149
36 3300031649 Ga0307514_10113270 Ga0307514_101132702 149
37 3300042876 Ga0451577_0001915 Ga0451577_0001915_13385_13852 149
38 iso_pu_bacteria 2585428057 2587730322 149
39 iso_pu_bacteria 2585428058 2587736025 149
40 iso_pu_bacteria 2643221654 2644303028 149
41 3300003187 JGI25151J46595_10007671 JGI25151J46595_100076715 150
42 3300025294 Ga0209025_1000351 Ga0209025_100035165 150
43 3300037471 Ga0395905_0509398 Ga0395905_0509398_42_515 150
44 3300041404 Ga0439436_0019638 Ga0439436_0019638_990_1442 150
45 3300041411 Ga0439466_0160283 Ga0439466_0160283_70_522 150
46 3300041411 Ga0439466_0187040 Ga0439466_0187040_116_568 150
47 3300041413 Ga0439465_0061700 Ga0439465_0061700_501_953 150
48 3300041997 Ga0439431_0046688 Ga0439431_0046688_270_722 150
49 3300042002 Ga0439442_007028 Ga0439442_007028_540_992 150
50 3300042122 Ga0450920_018762 Ga0450920_018762_305_757 150
51 3300042123 Ga0450921_002486 Ga0450921_002486_185_637 150
52 3300042125 Ga0450923_012089 Ga0450923_012089_675_1127 150
53 3300042145 Ga0450906_012888 Ga0450906_012888_1025_1477 150
54 3300042184 Ga0450908_000937 Ga0450908_000937_4143_4595 150
55 3300042435 Ga0439434_0013822 Ga0439434_0013822_143_595 150
56 3300042531 Ga0450918_001068 Ga0450918_001068_2511_2963 150
57 3300046457 Ga0495590_0006495 Ga0495590_0006495_971_1444 150
58 3300046530 Ga0495654_0045534 Ga0495654_0045534_179_631 150
59 3300046660 Ga0495625_0035547 Ga0495625_0035547_1494_1946 150
60 3300046664 Ga0495659_0433187 Ga0495659_0433187_32_484 150
61 3300046665 Ga0495661_0116514 Ga0495661_0116514_853_1305 150
62 3300046810 Ga0495660_0091424 Ga0495660_0091424_192_644 150
63 3300046810 Ga0495660_0457203 Ga0495660_0457203_49_522 150
64 3300047470 Ga0495681_0267568 Ga0495681_0267568_85_537 150
65 3300049822 Ga0501035_1141013 Ga0501035_1141013_93_560 150
66 3300053079 Ga0500610_0143975 Ga0500610_0143975_618_1070 150
67 3300053117 Ga0500593_010975 Ga0500593_010975_2431_2883 150
68 3300053158 Ga0500627_0023725 Ga0500627_0023725_474_926 150
69 3300053161 Ga0500634_0008477 Ga0500634_0008477_1564_2016 150
70 iso_pu_bacteria 2585428062 2587754114 150
71 iso_pu_bacteria 2831864461 2831865682 150
72 iso_pu_bacteria 2886848708 2886851038 150
73 iso_pu_bacteria 2919704043 2919704579 150
74 3300005262 Ga0065165_1000214 Ga0065165_10002141 151
75 3300005327 Ga0070658_10462654 Ga0070658_104626542 151
76 3300005338 Ga0068868_100269292 Ga0068868_1002692922 151
77 3300005355 Ga0070671_100034516 Ga0070671_1000345163 151
78 3300005355 Ga0070671_100321036 Ga0070671_1003210362 151
79 3300005364 Ga0070673_100088981 Ga0070673_1000889813 151
80 3300005364 Ga0070673_100351087 Ga0070673_1003510872 151
81 3300005367 Ga0070667_100146428 Ga0070667_1001464284 151
82 3300005455 Ga0070663_100063131 Ga0070663_1000631312 151
83 3300005456 Ga0070678_100073623 Ga0070678_1000736234 151
84 3300005539 Ga0068853_100405445 Ga0068853_1004054453 151
85 3300005543 Ga0070672_100014317 Ga0070672_1000143174 151
86 3300005564 Ga0070664_100799661 Ga0070664_1007996611 151
87 3300005578 Ga0068854_100157629 Ga0068854_1001576292 151
88 3300005616 Ga0068852_100139003 Ga0068852_1001390033 151
89 3300005834 Ga0068851_10027500 Ga0068851_100275002 151
90 3300014325 Ga0163163_10769676 Ga0163163_107696762 151
91 3300014745 Ga0157377_10075714 Ga0157377_100757143 151
92 3300017792 Ga0163161_10604383 Ga0163161_106043832 151
93 3300025909 Ga0207705_10092264 Ga0207705_100922644 151
94 3300025925 Ga0207650_10699271 Ga0207650_106992712 151
95 3300025931 Ga0207644_10030770 Ga0207644_100307703 151
96 3300025931 Ga0207644_10462662 Ga0207644_104626622 151
97 3300025940 Ga0207691_10057289 Ga0207691_100572893 151
98 3300025940 Ga0207691_10249313 Ga0207691_102493131 151
99 3300025945 Ga0207679_10212072 Ga0207679_102120723 151
100 3300025972 Ga0207668_10924510 Ga0207668_109245101 151
101 3300025986 Ga0207658_10782914 Ga0207658_107829142 151
102 3300025986 Ga0207658_10917444 Ga0207658_109174442 151
103 3300026041 Ga0207639_11312010 Ga0207639_113120102 151
104 3300026121 Ga0207683_10047577 Ga0207683_100475773 151
105 3300026142 Ga0207698_10046642 Ga0207698_100466424 151
106 3300031456 Ga0307513_10110571 Ga0307513_101105713 151
107 3300031548 Ga0307408_100957439 Ga0307408_1009574392 151
108 3300031731 Ga0307405_10028267 Ga0307405_100282675 151
109 3300031901 Ga0307406_10179472 Ga0307406_101794722 151
110 3300031911 Ga0307412_10009490 Ga0307412_100094906 151
111 3300031995 Ga0307409_100001481 Ga0307409_10000148111 151
112 3300032002 Ga0307416_100097209 Ga0307416_1000972092 151
113 3300032004 Ga0307414_11561114 Ga0307414_115611141 151
114 3300032005 Ga0307411_10014946 Ga0307411_100149466 151
115 3300032005 Ga0307411_10898241 Ga0307411_108982412 151
116 3300032126 Ga0307415_100002275 Ga0307415_10000227510 151
117 3300037471 Ga0395905_0488850 Ga0395905_0488850_630_1097 151
118 3300038443 Ga0395901_0100456 Ga0395901_0100456_1380_1847 151
119 3300041486 Ga0451807_2015579 Ga0451807_2015579_82_549 151
120 3300042002 Ga0439442_032331 Ga0439442_032331_306_779 151
121 3300042004 Ga0439445_0072087 Ga0439445_0072087_118_591 151
122 3300042006 Ga0439432_007316 Ga0439432_007316_2359_2832 151
123 3300042007 Ga0439449_0000494 Ga0439449_0000494_8610_9083 151
124 3300042015 Ga0439462_0052107 Ga0439462_0052107_46_519 151
125 3300042126 Ga0450888_007172 Ga0450888_007172_173_640 151
126 3300046519 Ga0495632_0001118 Ga0495632_0001118_6735_7208 151
127 3300046539 Ga0495621_0004476 Ga0495621_0004476_407_886 151
128 3300046615 Ga0495656_0007765 Ga0495656_0007765_2418_2897 151
129 3300048911 Ga0496108_0008496 Ga0496108_0008496_3504_3968 151
130 3300048911 Ga0496108_0687609 Ga0496108_0687609_146_613 151
131 3300048912 Ga0496109_0217663 Ga0496109_0217663_64_528 151
132 3300048913 Ga0496110_0679770 Ga0496110_0679770_91_558 151
133 iso_pu_bacteria 2643221544 2643742427 151
134 iso_pu_bacteria 2643221585 2643933547 151
135 iso_pu_bacteria 2643221628 2644159584 151
136 iso_pu_bacteria 2643221656 2644314796 151
137 iso_pu_bacteria 2643221683 2644468269 151
138 iso_pu_bacteria 2842677519 2842682584 151
139 iso_pu_bacteria 2904449895 2904454444 151
140 iso_pu_bacteria 2904456579 2904461113 151
141 iso_pu_bacteria 2919462493 2919465990 151
142 iso_pu_bacteria 2929520902 2929526995 151
143 iso_pu_bacteria 2945909444 2945912266 151
144 iso_pu_bacteria 2945945610 2945948201 151
145 iso_pu_bacteria 2945972063 2945977154 151
146 iso_pu_bacteria 2945984333 2945985422 151
147 iso_pu_bacteria 2954767861 2954772318 151
148 3300005356 Ga0070674_100117058 Ga0070674_1001170583 152
149 3300005459 Ga0068867_100229573 Ga0068867_1002295732 152
150 3300005543 Ga0070672_101280815 Ga0070672_1012808152 152
151 3300005548 Ga0070665_100175486 Ga0070665_1001754863 152
152 3300025923 Ga0207681_10720996 Ga0207681_107209961 152
153 3300025937 Ga0207669_10101966 Ga0207669_101019662 152
154 3300025937 Ga0207669_10116172 Ga0207669_101161722 152
155 3300025940 Ga0207691_10694366 Ga0207691_106943662 152
156 3300026089 Ga0207648_10112028 Ga0207648_101120282 152
157 3300026121 Ga0207683_10271140 Ga0207683_102711402 152
158 3300028379 Ga0268266_10013479 Ga0268266_100134794 152
159 3300028379 Ga0268266_10414033 Ga0268266_104140332 152
160 3300042439 Ga0439464_0090002 Ga0439464_0090002_129_605 152
161 3300042876 Ga0451577_0014784 Ga0451577_0014784_5001_5468 152
162 3300044712 Ga0453684_0021477 Ga0453684_0021477_5328_5795 152
163 3300045051 Ga0451576_0001586 Ga0451576_0001586_33334_33801 152
164 3300045051 Ga0451576_0478413 Ga0451576_0478413_417_884 152
165 3300046471 Ga0495650_0132328 Ga0495650_0132328_244_726 152
166 3300046522 Ga0495643_0219301 Ga0495643_0219301_166_648 152
167 3300050493 nmdc:mga0k408_83409_c1 nmdc:mga0k408_83409_c1_554_1018 152
168 3300053086 Ga0500578_0000282 Ga0500578_0000282_39363_39842 152
169 3300053109 Ga0500569_138052 Ga0500569_138052_145_609 152
170 iso_pu_bacteria 2599185214 2599626654 152
171 iso_pu_bacteria 2599185226 2599675718 152
172 iso_pu_bacteria 2599185227 2599684191 152
173 iso_pu_bacteria 2599185229 2599696205 152
174 iso_pu_bacteria 2738541277 2738718072 152
175 iso_pu_bacteria 2738543019 2739278758 152
176 iso_pu_bacteria 2904541872 2904544750 152
177 iso_pu_bacteria 2928070936 2928071262 152
178 iso_pu_bacteria 2929160207 2929163579 152
179 3300002773 JGI25152J39213_1001702 JGI25152J39213_10017024 153
180 3300003215 JGI25153J46596_10004517 JGI25153J46596_100045173 153
181 3300003323 rootH1_10131997 rootH1_101319977 153
182 3300003771 Ga0055526_1002957 Ga0055526_10029576 153
183 3300005456 Ga0070678_100674244 Ga0070678_1006742442 153
184 3300025245 Ga0207425_1000221 Ga0207425_10002217 153
185 3300025258 Ga0209129_1000012 Ga0209129_1000012135 153
186 3300025263 Ga0209565_1037015 Ga0209565_10370151 153
187 3300025295 Ga0209564_1000022 Ga0209564_1000022379 153
188 3300025297 Ga0209758_1000659 Ga0209758_100065922 153
189 3300032004 Ga0307414_10853764 Ga0307414_108537641 153
190 3300032005 Ga0307411_10456924 Ga0307411_104569242 153
191 3300042876 Ga0451577_0055160 Ga0451577_0055160_2993_3463 153
192 3300046460 Ga0495638_0194108 Ga0495638_0194108_35_502 153
193 3300046512 Ga0495610_0098606 Ga0495610_0098606_36_503 153
194 3300048928 Ga0496125_0026014 Ga0496125_0026014_4532_5020 153
195 3300048929 Ga0496126_0065309 Ga0496126_0065309_1106_1594 153
196 3300049571 Ga0501034_0563398 Ga0501034_0563398_535_1002 153
197 3300053088 Ga0500644_0252245 Ga0500644_0252245_106_573 153
198 3300053093 Ga0500651_0063144 Ga0500651_0063144_46_513 153
199 3300053108 Ga0500562_031382 Ga0500562_031382_223_690 153
200 3300053136 Ga0500559_0001207 Ga0500559_0001207_6985_7452 153
201 3300053156 Ga0500622_0008072 Ga0500622_0008072_1282_1749 153
202 3300003215 JGI25153J46596_10001783 JGI25153J46596_100017831 154
203 3300003316 rootH1_10013138 rootH1_100131383 154
204 3300003320 rootH2_10046829 rootH2_100468293 154
205 3300003322 rootL2_10003084 rootL2_1000308413 154
206 3300003323 rootH1_10001103 rootH1_100011033 154
207 3300003771 Ga0055526_1002755 Ga0055526_10027555 154
208 3300003792 Ga0055540_1000013 Ga0055540_100001381 154
209 3300003794 Ga0055531_10003580 Ga0055531_100035802 154
210 3300003794 Ga0055531_10012723 Ga0055531_100127233 154
211 3300004625 Ga0055543_1001983 Ga0055543_10019835 154
212 3300005262 Ga0065165_1000239 Ga0065165_100023925 154
213 3300005338 Ga0068868_100241845 Ga0068868_1002418452 154
214 3300005344 Ga0070661_100823056 Ga0070661_1008230561 154
215 3300005347 Ga0070668_100045281 Ga0070668_1000452814 154
216 3300005353 Ga0070669_100073728 Ga0070669_1000737281 154
217 3300005355 Ga0070671_100046869 Ga0070671_1000468695 154
218 3300005356 Ga0070674_100007438 Ga0070674_1000074386 154
219 3300005356 Ga0070674_100166171 Ga0070674_1001661713 154
220 3300005365 Ga0070688_100226947 Ga0070688_1002269472 154
221 3300005367 Ga0070667_100403545 Ga0070667_1004035451 154
222 3300005457 Ga0070662_100106749 Ga0070662_1001067493 154
223 3300005459 Ga0068867_100101065 Ga0068867_1001010653 154
224 3300005459 Ga0068867_100141672 Ga0068867_1001416721 154
225 3300005539 Ga0068853_100126321 Ga0068853_1001263212 154
226 3300005543 Ga0070672_100039128 Ga0070672_1000391283 154
227 3300005548 Ga0070665_100269049 Ga0070665_1002690492 154
228 3300005718 Ga0068866_10107070 Ga0068866_101070702 154
229 3300005719 Ga0068861_100059654 Ga0068861_1000596542 154
230 3300005834 Ga0068851_10568179 Ga0068851_105681792 154
231 3300005841 Ga0068863_100678359 Ga0068863_1006783592 154
232 3300005844 Ga0068862_100057026 Ga0068862_1000570262 154
233 3300006038 Ga0075365_10450300 Ga0075365_104503002 154
234 3300006042 Ga0075368_10047903 Ga0075368_100479033 154
235 3300006042 Ga0075368_10479244 Ga0075368_104792441 154
236 3300006177 Ga0075362_10049885 Ga0075362_100498852 154
237 3300006178 Ga0075367_10243768 Ga0075367_102437682 154
238 3300006195 Ga0075366_10002313 Ga0075366_100023137 154
239 3300006195 Ga0075366_10173042 Ga0075366_101730422 154
240 3300006195 Ga0075366_10369481 Ga0075366_103694812 154
241 3300006195 Ga0075366_10832177 Ga0075366_108321771 154
242 3300006353 Ga0075370_10169435 Ga0075370_101694352 154
243 3300006353 Ga0075370_10188049 Ga0075370_101880492 154
244 3300006353 Ga0075370_10480756 Ga0075370_104807562 154
245 3300006358 Ga0068871_100067879 Ga0068871_1000678793 154
246 3300006881 Ga0068865_100142000 Ga0068865_1001420003 154
247 3300009148 Ga0105243_10055453 Ga0105243_100554534 154
248 3300009553 Ga0105249_10026054 Ga0105249_100260543 154
249 3300010375 Ga0105239_10003145 Ga0105239_1000314512 154
250 3300012497 Ga0157319_1000031 Ga0157319_10000313 154
251 3300012502 Ga0157347_1001884 Ga0157347_10018843 154
252 3300013104 Ga0157370_10167600 Ga0157370_101676003 154
253 3300013306 Ga0163162_10176032 Ga0163162_101760322 154
254 3300014326 Ga0157380_10015082 Ga0157380_100150822 154
255 3300014497 Ga0182008_10006490 Ga0182008_100064905 154
256 3300014969 Ga0157376_10105969 Ga0157376_101059693 154
257 3300025258 Ga0209129_1043930 Ga0209129_10439301 154
258 3300025263 Ga0209565_1006883 Ga0209565_10068833 154
259 3300025273 Ga0209673_1014969 Ga0209673_10149692 154
260 3300025273 Ga0209673_1032506 Ga0209673_10325062 154
261 3300025291 Ga0209675_1018835 Ga0209675_10188353 154
262 3300025295 Ga0209564_1000003 Ga0209564_10000031198 154
263 3300025297 Ga0209758_1000124 Ga0209758_1000124116 154
264 3300025298 Ga0209050_1000340 Ga0209050_10003402 154
265 3300025298 Ga0209050_1000567 Ga0209050_100056751 154
266 3300025299 Ga0209256_1000015 Ga0209256_1000015222 154
267 3300025303 Ga0209051_1000022 Ga0209051_1000022186 154
268 3300025304 Ga0209257_1000030 Ga0209257_1000030384 154
269 3300025304 Ga0209257_1002866 Ga0209257_10028667 154
270 3300025315 Ga0207697_10019344 Ga0207697_100193443 154
271 3300025911 Ga0207654_10261602 Ga0207654_102616022 154
272 3300025913 Ga0207695_10391363 Ga0207695_103913632 154
273 3300025914 Ga0207671_10001994 Ga0207671_100019949 154
274 3300025923 Ga0207681_10175593 Ga0207681_101755931 154
275 3300025924 Ga0207694_10075912 Ga0207694_100759122 154
276 3300025931 Ga0207644_10048265 Ga0207644_100482652 154
277 3300025933 Ga0207706_10178440 Ga0207706_101784402 154
278 3300025934 Ga0207686_10025505 Ga0207686_100255053 154
279 3300025935 Ga0207709_10265420 Ga0207709_102654202 154
280 3300025937 Ga0207669_10038692 Ga0207669_100386923 154
281 3300025937 Ga0207669_10193503 Ga0207669_101935031 154
282 3300025938 Ga0207704_10129236 Ga0207704_101292362 154
283 3300025940 Ga0207691_10057895 Ga0207691_100578953 154
284 3300025961 Ga0207712_10026494 Ga0207712_100264942 154
285 3300025972 Ga0207668_10970597 Ga0207668_109705972 154
286 3300026041 Ga0207639_10097087 Ga0207639_100970873 154
287 3300026067 Ga0207678_10415539 Ga0207678_104155392 154
288 3300026088 Ga0207641_10705442 Ga0207641_107054422 154
289 3300026089 Ga0207648_10122042 Ga0207648_101220422 154
290 3300026089 Ga0207648_10168049 Ga0207648_101680491 154
291 3300026118 Ga0207675_100058145 Ga0207675_1000581454 154
292 3300026121 Ga0207683_10464177 Ga0207683_104641771 154
293 3300027866 Ga0209813_10143053 Ga0209813_101430532 154
294 3300027876 Ga0209974_10015885 Ga0209974_100158851 154
295 3300028379 Ga0268266_10196130 Ga0268266_101961302 154
296 3300028380 Ga0268265_10049148 Ga0268265_100491483 154
297 3300028786 Ga0307517_10000131 Ga0307517_1000013115 154
298 3300028794 Ga0307515_10051701 Ga0307515_100517014 154
299 3300030522 Ga0307512_10252372 Ga0307512_102523722 154
300 3300031456 Ga0307513_10059255 Ga0307513_100592552 154
301 3300031548 Ga0307408_100301187 Ga0307408_1003011872 154
302 3300031548 Ga0307408_100456013 Ga0307408_1004560132 154
303 3300031649 Ga0307514_10383372 Ga0307514_103833722 154
304 3300031730 Ga0307516_10005507 Ga0307516_100055073 154
305 3300031731 Ga0307405_11449064 Ga0307405_114490641 154
306 3300031911 Ga0307412_10312317 Ga0307412_103123172 154
307 3300032002 Ga0307416_100042646 Ga0307416_1000426461 154
308 3300032004 Ga0307414_10036703 Ga0307414_100367033 154
309 3300032005 Ga0307411_10015588 Ga0307411_100155883 154
310 3300041452 Ga0451793_1560530 Ga0451793_1560530_166_636 154
311 3300041459 Ga0451800_0738399 Ga0451800_0738399_822_1292 154
312 3300041486 Ga0451807_0984004 Ga0451807_0984004_213_683 154
313 3300041498 Ga0451841_0178986 Ga0451841_0178986_149_619 154
314 3300041501 Ga0451845_0679999 Ga0451845_0679999_82_552 154
315 3300041511 Ga0451855_0218407 Ga0451855_0218407_472_942 154
316 3300042014 Ga0439457_009985 Ga0439457_009985_1429_1899 154
317 3300042127 Ga0450890_001466 Ga0450890_001466_2803_3276 154
318 3300042438 Ga0439459_0000148 Ga0439459_0000148_4761_5234 154
319 3300045051 Ga0451576_1756001 Ga0451576_1756001_110_577 154
320 3300046512 Ga0495610_0020402 Ga0495610_0020402_2227_2697 154
321 3300046519 Ga0495632_0034711 Ga0495632_0034711_1143_1613 154
322 3300046522 Ga0495643_0063978 Ga0495643_0063978_539_1009 154
323 3300046660 Ga0495625_0007028 Ga0495625_0007028_3608_4078 154
324 3300046691 Ga0495670_0045433 Ga0495670_0045433_1696_2169 154
325 3300048905 Ga0496102_0028206 Ga0496102_0028206_3959_4429 154
326 3300049515 Ga0501292_020706 Ga0501292_020706_553_1023 154
327 3300049686 Ga0501257_022724 Ga0501257_022724_680_1150 154
328 3300049777 Ga0501281_04700 Ga0501281_04700_220_690 154
329 3300050492 nmdc:mga0yw44_296661_c1 nmdc:mga0yw44_296661_c1_566_1045 154
330 3300050493 nmdc:mga0k408_12364_c1 nmdc:mga0k408_12364_c1_4119_4589 154
331 3300050493 nmdc:mga0k408_273448_c1 nmdc:mga0k408_273448_c1_101_571 154
332 3300050493 nmdc:mga0k408_290104_c1 nmdc:mga0k408_290104_c1_419_889 154
333 3300050493 nmdc:mga0k408_52726_c1 nmdc:mga0k408_52726_c1_986_1459 154
334 3300050493 nmdc:mga0k408_83049_c1 nmdc:mga0k408_83049_c1_406_876 154
335 3300050494 nmdc:mga06z11_220641_c1 nmdc:mga06z11_220641_c1_476_946 154
336 3300053093 Ga0500651_0056446 Ga0500651_0056446_1319_1783 154
337 3300053123 Ga0500614_090551 Ga0500614_090551_301_825 154
338 3300053134 Ga0500658_0037675 Ga0500658_0037675_789_1259 154
339 3300053177 Ga0500636_0068372 Ga0500636_0068372_901_1425 154
340 3300053739 Ga0500587_002651 Ga0500587_002651_1052_1522 154
341 3300001989 JGI24739J22299_10070810 JGI24739J22299_100708102 155
342 3300003578 Ga0006562J51391_1059464 Ga0006562J51391_10594642 155
343 3300003773 Ga0055537_1000515 Ga0055537_100051516 155
344 3300003781 Ga0055536_1001230 Ga0055536_100123013 155
345 3300003784 Ga0055534_1000092 Ga0055534_100009214 155
346 3300003790 Ga0055528_1000190 Ga0055528_100019050 155
347 3300003790 Ga0055528_1000956 Ga0055528_100095614 155
348 3300003792 Ga0055540_1004017 Ga0055540_10040173 155
349 3300003792 Ga0055540_1004209 Ga0055540_10042096 155
350 3300003794 Ga0055531_10067226 Ga0055531_100672262 155
351 3300005288 Ga0065714_10128494 Ga0065714_101284942 155
352 3300005289 Ga0065704_10115160 Ga0065704_101151602 155
353 3300005328 Ga0070676_10296564 Ga0070676_102965641 155
354 3300005331 Ga0070670_100057275 Ga0070670_1000572755 155
355 3300005333 Ga0070677_10001760 Ga0070677_100017605 155
356 3300005354 Ga0070675_100026553 Ga0070675_1000265533 155
357 3300005355 Ga0070671_100045514 Ga0070671_1000455143 155
358 3300005364 Ga0070673_100005635 Ga0070673_1000056353 155
359 3300005456 Ga0070678_100028267 Ga0070678_1000282673 155
360 3300005459 Ga0068867_100014852 Ga0068867_1000148525 155
361 3300005543 Ga0070672_100020075 Ga0070672_1000200753 155
362 3300005578 Ga0068854_100583440 Ga0068854_1005834402 155
363 3300005618 Ga0068864_100043665 Ga0068864_1000436655 155
364 3300006038 Ga0075365_10011332 Ga0075365_100113323 155
365 3300006048 Ga0075363_100023060 Ga0075363_1000230602 155
366 3300006048 Ga0075363_100475055 Ga0075363_1004750552 155
367 3300006051 Ga0075364_10011533 Ga0075364_100115335 155
368 3300006051 Ga0075364_10388563 Ga0075364_103885632 155
369 3300006177 Ga0075362_10564361 Ga0075362_105643611 155
370 3300006186 Ga0075369_10017248 Ga0075369_100172484 155
371 3300006195 Ga0075366_10137233 Ga0075366_101372332 155
372 3300006195 Ga0075366_10602224 Ga0075366_106022241 155
373 3300006353 Ga0075370_10000363 Ga0075370_1000036317 155
374 3300006353 Ga0075370_10212037 Ga0075370_102120371 155
375 3300006881 Ga0068865_100459616 Ga0068865_1004596162 155
376 3300006948 Ga0099826_10000115 Ga0099826_100001158 155
377 3300006948 Ga0099826_10155283 Ga0099826_101552832 155
378 3300009148 Ga0105243_10050268 Ga0105243_100502685 155
379 3300009174 Ga0105241_10420738 Ga0105241_104207382 155
380 3300009177 Ga0105248_11243595 Ga0105248_112435952 155
381 3300009545 Ga0105237_10000556 Ga0105237_1000055615 155
382 3300013100 Ga0157373_10015938 Ga0157373_100159388 155
383 3300013306 Ga0163162_10153121 Ga0163162_101531213 155
384 3300013308 Ga0157375_10242279 Ga0157375_102422792 155
385 3300014497 Ga0182008_10028897 Ga0182008_100288974 155
386 3300014745 Ga0157377_10542984 Ga0157377_105429842 155
387 3300014969 Ga0157376_10027741 Ga0157376_100277412 155
388 3300015261 Ga0182006_1060979 Ga0182006_10609792 155
389 3300017792 Ga0163161_10079387 Ga0163161_100793873 155
390 3300017792 Ga0163161_10171719 Ga0163161_101717192 155
391 3300025263 Ga0209565_1000073 Ga0209565_100007320 155
392 3300025273 Ga0209673_1000127 Ga0209673_1000127147 155
393 3300025273 Ga0209673_1013897 Ga0209673_10138971 155
394 3300025291 Ga0209675_1000029 Ga0209675_1000029147 155
395 3300025292 Ga0209676_1000142 Ga0209676_1000142128 155
396 3300025292 Ga0209676_1034661 Ga0209676_10346612 155
397 3300025294 Ga0209025_1003418 Ga0209025_100341811 155
398 3300025294 Ga0209025_1042193 Ga0209025_10421932 155
399 3300025295 Ga0209564_1021623 Ga0209564_10216232 155
400 3300025298 Ga0209050_1059344 Ga0209050_10593442 155
401 3300025299 Ga0209256_1023064 Ga0209256_10230642 155
402 3300025303 Ga0209051_1000416 Ga0209051_100041636 155
403 3300025303 Ga0209051_1000735 Ga0209051_100073516 155
404 3300025303 Ga0209051_1057057 Ga0209051_10570572 155
405 3300025304 Ga0209257_1027944 Ga0209257_10279442 155
406 3300025315 Ga0207697_10079021 Ga0207697_100790212 155
407 3300025893 Ga0207682_10016445 Ga0207682_100164452 155
408 3300025901 Ga0207688_10183844 Ga0207688_101838443 155
409 3300025907 Ga0207645_10114730 Ga0207645_101147303 155
410 3300025923 Ga0207681_10042839 Ga0207681_100428392 155
411 3300025925 Ga0207650_10000551 Ga0207650_100005515 155
412 3300025926 Ga0207659_10002206 Ga0207659_100022062 155
413 3300025931 Ga0207644_10004401 Ga0207644_100044015 155
414 3300025935 Ga0207709_10000771 Ga0207709_100007715 155
415 3300025935 Ga0207709_10743205 Ga0207709_107432052 155
416 3300025937 Ga0207669_10014228 Ga0207669_100142283 155
417 3300025938 Ga0207704_10205911 Ga0207704_102059112 155
418 3300025940 Ga0207691_10017528 Ga0207691_100175286 155
419 3300025960 Ga0207651_10145642 Ga0207651_101456423 155
420 3300025981 Ga0207640_10738480 Ga0207640_107384802 155
421 3300025986 Ga0207658_10428689 Ga0207658_104286892 155
422 3300026023 Ga0207677_10188417 Ga0207677_101884173 155
423 3300026089 Ga0207648_10023780 Ga0207648_100237805 155
424 3300026089 Ga0207648_10065278 Ga0207648_100652782 155
425 3300026095 Ga0207676_10046563 Ga0207676_100465633 155
426 3300026121 Ga0207683_10037417 Ga0207683_100374175 155
427 3300027666 Ga0209282_1000109 Ga0209282_100010946 155
428 3300027666 Ga0209282_1056017 Ga0209282_10560173 155
429 3300028379 Ga0268266_10096896 Ga0268266_100968963 155
430 3300028794 Ga0307515_10265779 Ga0307515_102657792 155
431 3300030731 Ga0316177_1138618 Ga0316177_11386182 155
432 3300030733 Ga0314311_1220007 Ga0314311_12200072 155
433 3300030734 Ga0316179_1067495 Ga0316179_10674952 155
434 3300030735 Ga0316178_1033335 Ga0316178_10333352 155
435 3300030736 Ga0316180_1175341 Ga0316180_11753412 155
436 3300030742 Ga0316183_1024856 Ga0316183_10248564 155
437 3300030742 Ga0316183_1049727 Ga0316183_10497271 155
438 3300030744 Ga0316181_1130584 Ga0316181_11305845 155
439 3300030745 Ga0316182_1103539 Ga0316182_11035392 155
440 3300031548 Ga0307408_100735846 Ga0307408_1007358462 155
441 3300031649 Ga0307514_10032081 Ga0307514_100320812 155
442 3300031731 Ga0307405_10030394 Ga0307405_100303942 155
443 3300031731 Ga0307405_10080690 Ga0307405_100806902 155
444 3300031731 Ga0307405_10593996 Ga0307405_105939962 155
445 3300031731 Ga0307405_11031086 Ga0307405_110310861 155
446 3300031901 Ga0307406_10231006 Ga0307406_102310062 155
447 3300031901 Ga0307406_10760446 Ga0307406_107604461 155
448 3300031903 Ga0307407_10383447 Ga0307407_103834472 155
449 3300031911 Ga0307412_10021853 Ga0307412_100218535 155
450 3300031911 Ga0307412_10064520 Ga0307412_100645204 155
451 3300031995 Ga0307409_101777913 Ga0307409_1017779132 155
452 3300032002 Ga0307416_100147812 Ga0307416_1001478123 155
453 3300032002 Ga0307416_100956570 Ga0307416_1009565701 155
454 3300032002 Ga0307416_101065051 Ga0307416_1010650512 155
455 3300032004 Ga0307414_10356235 Ga0307414_103562352 155
456 3300032004 Ga0307414_10457875 Ga0307414_104578751 155
457 3300032005 Ga0307411_10030479 Ga0307411_100304792 155
458 3300032005 Ga0307411_10048508 Ga0307411_100485082 155
459 3300032005 Ga0307411_10289032 Ga0307411_102890322 155
460 3300042127 Ga0450890_029944 Ga0450890_029944_155_703 155
461 3300046520 Ga0495637_0015355 Ga0495637_0015355_3047_3574 155
462 3300046524 Ga0495648_0330776 Ga0495648_0330776_18_566 155
463 3300046660 Ga0495625_0000396 Ga0495625_0000396_22498_22968 155
464 3300046674 Ga0495588_0014019 Ga0495588_0014019_804_1271 155
465 3300048904 Ga0496101_0135072 Ga0496101_0135072_1289_1759 155
466 3300048912 Ga0496109_0935113 Ga0496109_0935113_216_695 155
467 3300048920 Ga0496117_0036687 Ga0496117_0036687_928_1464 155
468 3300048928 Ga0496125_0101387 Ga0496125_0101387_985_1491 155
469 3300049705 Ga0501225_0012882 Ga0501225_0012882_561_1028 155
470 3300049759 Ga0501262_000472 Ga0501262_000472_2648_3148 155
471 3300050490 nmdc:mga03n38_443994_c1 nmdc:mga03n38_443994_c1_128_598 155
472 3300050491 nmdc:mga00v17_347837_c1 nmdc:mga00v17_347837_c1_329_796 155
473 3300050491 nmdc:mga00v17_631460_c1 nmdc:mga00v17_631460_c1_107_574 155
474 3300050492 nmdc:mga0yw44_190577_c1 nmdc:mga0yw44_190577_c1_366_833 155
475 3300050492 nmdc:mga0yw44_929257_c1 nmdc:mga0yw44_929257_c1_95_565 155
476 3300050493 nmdc:mga0k408_119745_c1 nmdc:mga0k408_119745_c1_207_677 155
477 3300050494 nmdc:mga06z11_24700_c1 nmdc:mga06z11_24700_c1_2228_2698 155
478 3300050496 nmdc:mga07m45_1629_c1 nmdc:mga07m45_1629_c1_9147_9617 155
479 3300050496 nmdc:mga07m45_236795_c1 nmdc:mga07m45_236795_c1_131_637 155
480 3300050516 nmdc:mga0sz30_24573_c1 nmdc:mga0sz30_24573_c1_831_1298 155
481 3300053109 Ga0500569_238789 Ga0500569_238789_16_564 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

37

87

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.7914 34 56
2awn-assembly1.cif.gz_A crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.7849 34 56
1h9s-assembly1.cif.gz_B molybdate bound complex of dimop domain of mode from e.coli 0.7736 34 121
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.7705 34 56
1b9m-assembly1.cif.gz_B regulator from escherichia coli 0.7677 34 121
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7722 33 58 2.40.50.140
1q1eB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.772 35 59 2.40.50.140
af_A0A1D6GUD7_40_155_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7623 32 144 2.40.50.140
1h9sA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7573 34 121 2.40.50.100
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7541 34 59 2.40.50.140
ID Description Score Start End GO Terms
AF-W7W877-F1-model_v4 Uncharacterized protein 0.9853 50 155
AF-A0A519EKR1-F1-model_v4 Uncharacterized protein 0.9792 18 155
AF-W7W877-F1-model_v4 Uncharacterized protein 0.9673 50 155
AF-A0A519EKR1-F1-model_v4 Uncharacterized protein 0.952 18 155
AF-A0A7Y8GU37-F1-model_v4 Uncharacterized protein 0.9311 10 155

Feature Viewer

pLDDT pTM Quality
89.39 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map