metagRoot

F452354

General Info

Members	Datasets	Scaffolds	Average Seq Length
481	277	481	208

Family's Representative Sequence

Representative Sequence	3300005330\|Ga0070690_100011618\|Ga0070690_1000116182
Length	237
Sequence	MRKSPGSLRRWPTNARITSPIKTVKSHFNMIELYTWSTPNGRKVSIMLEECALPYNVHKINIGTNREQFAPEYLKINPNGKIPSIVDPDGPDGKPYSMMESGAILIYLALKTGKFLPQSERGKYDALQWLMFQMGSVGPMFGQAHHFMRAKKDEVPYGTERYGNEAKRLYGVMERQLQANEYLSGAEYTIADIATYPWVARHEWHRVDLGQFPSVKRWYDGIGRRAAVVKGMSVPQT

Samples

	Sample ID	Description	Type	Environment
1	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
2	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
3	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
8	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
9	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
12	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
13	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
14	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
15	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
18	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
19	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
20	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
21	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
22	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
23	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
24	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
25	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
26	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
27	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
28	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
29	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
30	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
31	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
32	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
33	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
34	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
35	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
36	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
37	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
38	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
39	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
40	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
41	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
42	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
43	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
44	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
45	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
46	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
47	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
48	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
49	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
50	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
51	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
52	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
53	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
54	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
57	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
58	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
61	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
63	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
66	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
68	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
69	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
70	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
71	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
72	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
73	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
76	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
79	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
80	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
81	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
82	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
127	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
130	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
131	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
132	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
133	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
134	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
135	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
136	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
137	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
138	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
139	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
140	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
141	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
142	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
143	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
144	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
145	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
146	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
147	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
148	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
149	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
150	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
151	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
152	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
153	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
154	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
155	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
156	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
157	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
158	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
159	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
160	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
161	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
162	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
163	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
164	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
167	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
168	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
169	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
170	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
171	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
172	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
173	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
174	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
175	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
176	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
177	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
178	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
179	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
180	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
181	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
182	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
183	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
184	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
185	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
186	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
187	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
188	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
189	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
190	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
191	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
192	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
193	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
194	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
195	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
196	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
197	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
198	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
199	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
200	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
201	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
202	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
203	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
204	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
205	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
206	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
207	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
208	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
209	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
210	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
211	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
212	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
213	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
214	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
215	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
216	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
217	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
218	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
219	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
220	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
221	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
222	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
223	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
224	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
225	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
226	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
227	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
228	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
229	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
230	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
231	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
232	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
247	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
256	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
257	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
259	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
262	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
263	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
264	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
265	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
266	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
267	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
268	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
269	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
270	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
271	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
272	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
273	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
274	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
275	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
276	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
277	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.62
Nodule	0
Rhizoplane	0.21
Rhizosphere	98.75
Stem	0
Stem Tuber	0
Unclassified	0.42

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065714_10316704	3300005288	Bacteria	674
2	Ga0065707_10037969	3300005295	Bacteria	1234
3	Ga0065707_10103363	3300005295	Bacteria	2722
4	Ga0070676_10486865	3300005328	Bacteria	873
5	Ga0070683_100167815	3300005329	Bacteria	2083
6	Ga0070690_100011618	3300005330	Bacteria	5154
7	Ga0070690_100189020	3300005330	Bacteria	1427
8	Ga0068869_100075791	3300005334	Bacteria	2500
9	Ga0068869_100687476	3300005334	Bacteria	871
10	Ga0070666_10087084	3300005335	Bacteria	2140
11	Ga0070680_100133527	3300005336	Bacteria	2078
12	Ga0070682_100145396	3300005337	Bacteria	1621
13	Ga0068868_100061609	3300005338	Bacteria	2972
14	Ga0068868_100345625	3300005338	Bacteria	1273
15	Ga0070689_100001092	3300005340	Bacteria	17023
16	Ga0070687_100000811	3300005343	Bacteria	10413
17	Ga0070687_100365334	3300005343	Bacteria	936
18	Ga0070692_10022032	3300005345	Bacteria	3107
19	Ga0070692_10026343	3300005345	Bacteria	2873
20	Ga0070671_100085256	3300005355	Bacteria	2642
21	Ga0070673_101432470	3300005364	Bacteria	650
22	Ga0070688_100089093	3300005365	Bacteria	2013
23	Ga0070667_100402715	3300005367	Bacteria	1246
24	Ga0070713_100534394	3300005436	Bacteria	1109
25	Ga0070705_100000473	3300005440	Bacteria	23135
26	Ga0070700_100006345	3300005441	Bacteria	6318
27	Ga0070700_100471553	3300005441	Bacteria	960
28	Ga0070694_100001201	3300005444	Bacteria	14934
29	Ga0070694_100243372	3300005444	Bacteria	1358
30	Ga0070694_100424059	3300005444	Bacteria	1046
31	Ga0070678_100165000	3300005456	Bacteria	1798
32	Ga0070662_100128409	3300005457	Bacteria	1951
33	Ga0070681_10000135	3300005458	Bacteria	56156
34	Ga0070681_10250977	3300005458	Bacteria	1682
35	Ga0070699_100121357	3300005518	Bacteria	2298
36	Ga0070697_100017800	3300005536	Bacteria	5595
37	Ga0070697_100637729	3300005536	Bacteria	938
38	Ga0070672_100266151	3300005543	Bacteria	1446
39	Ga0070686_100119035	3300005544	Bacteria	1811
40	Ga0070686_100298055	3300005544	Bacteria	1195
41	Ga0070695_100003136	3300005545	Bacteria	9637
42	Ga0070696_100007911	3300005546	Bacteria	7097
43	Ga0070696_100011993	3300005546	Bacteria	5806
44	Ga0070696_100231121	3300005546	Bacteria	1391
45	Ga0070693_100000008	3300005547	Bacteria	80726
46	Ga0070693_100233993	3300005547	Bacteria	1210
47	Ga0070665_100111092	3300005548	Bacteria	2743
48	Ga0070704_100004098	3300005549	Bacteria	8416
49	Ga0070704_100009382	3300005549	Bacteria	5909
50	Ga0070704_100373523	3300005549	Bacteria	1209
51	Ga0068855_100011714	3300005563	Bacteria	10599
52	Ga0068855_100844472	3300005563	Bacteria	971
53	Ga0070664_100508788	3300005564	Bacteria	1111
54	Ga0068857_100665291	3300005577	Bacteria	988
55	Ga0068854_100002295	3300005578	Bacteria	11774
56	Ga0068856_100032122	3300005614	Bacteria	5138
57	Ga0068856_100237322	3300005614	Bacteria	1839
58	Ga0070702_100000801	3300005615	Bacteria	12019
59	Ga0068859_100003274	3300005617	Bacteria	16483
60	Ga0068866_10008284	3300005718	Bacteria	4375
61	Ga0068861_101067045	3300005719	Bacteria	775
62	Ga0068870_10089937	3300005840	Bacteria	1714
63	Ga0068863_100297780	3300005841	Bacteria	1564
64	Ga0068858_100003684	3300005842	Bacteria	15183
65	Ga0068858_100142192	3300005842	Bacteria	2253
66	Ga0068860_100020876	3300005843	Bacteria	6345
67	Ga0068862_100011556	3300005844	Bacteria	7285
68	Ga0068862_100453849	3300005844	Bacteria	1209
69	Ga0068862_100803431	3300005844	Bacteria	919
70	Ga0081539_10000803	3300005985	Bacteria	61113
71	Ga0075364_10615448	3300006051	Bacteria	742
72	Ga0070716_100042732	3300006173	Bacteria	2532
73	Ga0070716_100150834	3300006173	Bacteria	1495
74	Ga0097621_100007035	3300006237	Bacteria	8015
75	Ga0097621_100092909	3300006237	Bacteria	2528
76	Ga0068871_100152909	3300006358	Bacteria	1969
77	Ga0068871_100280483	3300006358	Bacteria	1457
78	Ga0075428_100000615	3300006844	Bacteria	36398
79	Ga0075428_100157659	3300006844	Bacteria	2465
80	Ga0075430_100002744	3300006846	Bacteria	14703
81	Ga0075430_100003759	3300006846	Bacteria	12760
82	Ga0075430_100041331	3300006846	Bacteria	3901
83	Ga0075430_100119041	3300006846	Bacteria	2201
84	Ga0075431_100010233	3300006847	Bacteria	9430
85	Ga0075431_100163430	3300006847	Bacteria	2289
86	Ga0075431_100235693	3300006847	Bacteria	1863
87	Ga0075433_10000285	3300006852	Bacteria	30208
88	Ga0075433_10022480	3300006852	Bacteria	5293
89	Ga0075433_10946590	3300006852	Bacteria	751
90	Ga0075434_100000002	3300006871	Bacteria	135661
91	Ga0075434_100023564	3300006871	Bacteria	6001
92	Ga0075434_100735235	3300006871	Bacteria	1004
93	Ga0075429_100000150	3300006880	Bacteria	43105
94	Ga0068865_100013159	3300006881	Bacteria	5222
95	Ga0068865_100791170	3300006881	Bacteria	817
96	Ga0075436_100000541	3300006914	Bacteria	24664
97	Ga0075436_100000939	3300006914	Bacteria	19466
98	Ga0075436_100011332	3300006914	Bacteria	6116
99	Ga0075436_100048526	3300006914	Bacteria	2929
100	Ga0075436_100100931	3300006914	Bacteria	2010
101	Ga0075436_100128870	3300006914	Bacteria	1773
102	Ga0075436_100138606	3300006914	Bacteria	1709
103	Ga0097620_100003274	3300006931	Bacteria	16483
104	Ga0075435_100002145	3300007076	Bacteria	13003
105	Ga0075435_100005634	3300007076	Bacteria	8774
106	Ga0075435_100072067	3300007076	Bacteria	2822
107	Ga0099794_10002127	3300007265	Bacteria	7200
108	Ga0099794_10075728	3300007265	Bacteria	1654
109	Ga0099794_10077557	3300007265	Bacteria	1635
110	Ga0099794_10095640	3300007265	Bacteria	1478
111	Ga0111539_10014131	3300009094	Bacteria	9972
112	Ga0111539_10015864	3300009094	Bacteria	9359
113	Ga0111539_10027196	3300009094	Bacteria	6986
114	Ga0111539_10832987	3300009094	Bacteria	1073
115	Ga0105245_10000776	3300009098	Bacteria	28947
116	Ga0114129_10000534	3300009147	Bacteria	46594
117	Ga0114129_10578218	3300009147	Bacteria	1458
118	Ga0114129_11323437	3300009147	Bacteria	892
119	Ga0105243_10005007	3300009148	Bacteria	10385
120	Ga0105243_10005965	3300009148	Bacteria	9439
121	Ga0105241_10066162	3300009174	Bacteria	2794
122	Ga0105242_10089589	3300009176	Bacteria	2586
123	Ga0105242_10321221	3300009176	Bacteria	1420
124	Ga0105249_10000709	3300009553	Bacteria	30226
125	Ga0105249_10011664	3300009553	Bacteria	7728
126	Ga0105239_10281048	3300010375	Bacteria	1874
127	Ga0105246_10264891	3300011119	Bacteria	1371
128	Ga0157369_11044673	3300013105	Bacteria	836
129	Ga0157374_10250946	3300013296	Bacteria	1741
130	Ga0157378_10029968	3300013297	Bacteria	4805
131	Ga0163162_10169139	3300013306	Bacteria	2310
132	Ga0163162_10260930	3300013306	Bacteria	1864
133	Ga0157375_10378704	3300013308	Bacteria	1582
134	Ga0157380_10004906	3300014326	Bacteria	9322
135	Ga0157380_10206918	3300014326	Bacteria	1745
136	Ga0157377_10114239	3300014745	Bacteria	1627
137	Ga0157377_10307293	3300014745	Bacteria	1049
138	Ga0157379_10256942	3300014968	Bacteria	1587
139	Ga0157376_10004088	3300014969	Bacteria	10097
140	Ga0207642_10242062	3300025899	Bacteria	1019
141	Ga0207680_10070537	3300025903	Bacteria	2163
142	Ga0207645_10080162	3300025907	Bacteria	2092
143	Ga0207643_10320595	3300025908	Bacteria	968
144	Ga0207643_10324997	3300025908	Bacteria	961
145	Ga0207707_10003800	3300025912	Bacteria	13383
146	Ga0207707_10233537	3300025912	Bacteria	1600
147	Ga0207660_10052304	3300025917	Bacteria	2907
148	Ga0207662_10000388	3300025918	Bacteria	19709
149	Ga0207662_10082393	3300025918	Bacteria	1965
150	Ga0207662_10091653	3300025918	Bacteria	1870
151	Ga0207652_10038483	3300025921	Bacteria	4055
152	Ga0207687_10186795	3300025927	Bacteria	1610
153	Ga0207687_10931569	3300025927	Bacteria	744
154	Ga0207644_10613177	3300025931	Bacteria	904
155	Ga0207706_10110438	3300025933	Bacteria	2419
156	Ga0207709_10015271	3300025935	Bacteria	4257
157	Ga0207670_10147489	3300025936	Bacteria	1742
158	Ga0207670_10218936	3300025936	Bacteria	1456
159	Ga0207704_10110298	3300025938	Bacteria	1858
160	Ga0207665_10103753	3300025939	Bacteria	1989
161	Ga0207689_10006400	3300025942	Bacteria	10421
162	Ga0207689_10092055	3300025942	Bacteria	2491
163	Ga0207689_10153052	3300025942	Bacteria	1901
164	Ga0207689_10325096	3300025942	Bacteria	1277
165	Ga0207661_10219368	3300025944	Bacteria	1680
166	Ga0207667_10027042	3300025949	Bacteria	6255
167	Ga0207651_10365509	3300025960	Bacteria	1219
168	Ga0207712_10150565	3300025961	Bacteria	1797
169	Ga0207640_10017877	3300025981	Bacteria	4156
170	Ga0207677_10076171	3300026023	Bacteria	2387
171	Ga0207677_10095632	3300026023	Bacteria	2171
172	Ga0207703_10156521	3300026035	Bacteria	1992
173	Ga0207703_10295121	3300026035	Bacteria	1476
174	Ga0207639_10153313	3300026041	Bacteria	1932
175	Ga0207708_10005256	3300026075	Bacteria	9532
176	Ga0207708_10238534	3300026075	Bacteria	1462
177	Ga0207702_10266080	3300026078	Bacteria	1616
178	Ga0207702_10404153	3300026078	Bacteria	1318
179	Ga0207641_10018861	3300026088	Bacteria	5658
180	Ga0207648_10000708	3300026089	Bacteria	37374
181	Ga0207648_10300596	3300026089	Bacteria	1439
182	Ga0207676_10203880	3300026095	Bacteria	1749
183	Ga0207676_10243656	3300026095	Bacteria	1614
184	Ga0207675_100000120	3300026118	Bacteria	64416
185	Ga0207675_100044365	3300026118	Bacteria	4155
186	Ga0207683_10476687	3300026121	Bacteria	1151
187	Ga0209969_1009596	3300027360	Bacteria	1380
188	Ga0209967_1021200	3300027364	Bacteria	950
189	Ga0209981_1000507	3300027378	Bacteria	4960
190	Ga0210000_1017598	3300027462	Bacteria	1084
191	Ga0209995_1009696	3300027471	Bacteria	1559
192	Ga0209995_1018558	3300027471	Bacteria	1147
193	Ga0209995_1020562	3300027471	Bacteria	1092
194	Ga0209179_1047883	3300027512	Bacteria	912
195	Ga0209999_1013554	3300027543	Bacteria	1478
196	Ga0209999_1019167	3300027543	Bacteria	1253
197	Ga0209999_1023257	3300027543	Bacteria	1142
198	Ga0209983_1011569	3300027665	Bacteria	1806
199	Ga0209983_1063439	3300027665	Bacteria	818
200	Ga0209588_1008774	3300027671	Bacteria	3006
201	Ga0209588_1016477	3300027671	Bacteria	2282
202	Ga0209588_1030875	3300027671	Bacteria	1713
203	Ga0209588_1073212	3300027671	Bacteria	1107
204	Ga0209971_1005895	3300027682	Bacteria	2903
205	Ga0209966_1006922	3300027695	Bacteria	1979
206	Ga0209998_10011093	3300027717	Bacteria	1865
207	Ga0209974_10051664	3300027876	Bacteria	1383
208	Ga0207428_10000758	3300027907	Bacteria	36770
209	Ga0207428_10139019	3300027907	Bacteria	1855
210	Ga0268265_10021495	3300028380	Bacteria	4521
211	Ga0268264_10193545	3300028381	Bacteria	1855
212	Ga0268264_10469296	3300028381	Bacteria	1222
213	Ga0307408_100391898	3300031548	Bacteria	1190
214	Ga0307408_100627476	3300031548	Bacteria	958
215	Ga0316576_10021103	3300031727	Bacteria	4498
216	Ga0307410_10357312	3300031852	Bacteria	1169
217	Ga0307407_10127283	3300031903	Bacteria	1624
218	Ga0307412_10167141	3300031911	Bacteria	1641
219	Ga0307416_100035966	3300032002	Bacteria	3791
220	Ga0307416_100130932	3300032002	Bacteria	2258
221	Ga0307411_10090957	3300032005	Bacteria	2130
222	Ga0307411_10125269	3300032005	Bacteria	1867
223	Ga0307411_10128614	3300032005	Bacteria	1847
224	Ga0307411_10772356	3300032005	Bacteria	844
225	Ga0316585_10072822	3300032137	Bacteria	1116
226	Ga0373926_0001237	3300035083	Bacteria	7689
227	Ga0373928_0003480	3300035084	Bacteria	2998
228	Ga0373928_0024057	3300035084	Bacteria	1303
229	Ga0373934_0000565	3300035086	Bacteria	13043
230	Ga0373934_0027954	3300035086	Bacteria	2194
231	Ga0373940_0000228	3300035088	Bacteria	7987
232	Ga0373923_0093756	3300035111	Bacteria	1316
233	Ga0373932_0000697	3300035112	Bacteria	10160
234	Ga0373932_0066205	3300035112	Bacteria	1110
235	Ga0373936_0000086	3300035113	Bacteria	34644
236	Ga0373936_0005754	3300035113	Bacteria	4673
237	Ga0373939_0007879	3300035114	Bacteria	2597
238	Ga0373941_0004697	3300035115	Bacteria	3174
239	Ga0373941_0011242	3300035115	Bacteria	2309
240	Ga0373941_0147021	3300035115	Bacteria	861
241	Ga0373945_0010702	3300035116	Bacteria	3024
242	Ga0373953_0011279	3300035117	Bacteria	3132
243	Ga0373953_0017488	3300035117	Bacteria	2637
244	Ga0373953_0048854	3300035117	Bacteria	1705
245	Ga0373954_0000082	3300035118	Bacteria	33880
246	Ga0373954_0002456	3300035118	Bacteria	7771
247	Ga0373954_0019260	3300035118	Bacteria	3077
248	Ga0373954_0020395	3300035118	Bacteria	2998
249	Ga0373956_0000155	3300035119	Bacteria	25133
250	Ga0373956_0196129	3300035119	Bacteria	956
251	Ga0373956_0228501	3300035119	Bacteria	883
252	Ga0373957_0018491	3300035120	Bacteria	2442
253	Ga0373957_0027114	3300035120	Bacteria	2079
254	Ga0373957_0054208	3300035120	Bacteria	1539
255	Ga0373957_0259971	3300035120	Bacteria	731
256	Ga0373943_0020182	3300035170	Bacteria	3070
257	Ga0373946_0006828	3300035171	Bacteria	4152
258	Ga0373946_0028870	3300035171	Bacteria	2203
259	Ga0373955_0008818	3300035172	Bacteria	4700
260	Ga0373955_0010403	3300035172	Bacteria	4392
261	Ga0373955_0245850	3300035172	Bacteria	1072
262	Ga0373942_0010415	3300035207	Bacteria	2188
263	Ga0373961_0001991	3300035241	Bacteria	5492
264	Ga0373961_0064284	3300035241	Bacteria	1121
265	Ga0373962_0006766	3300035242	Bacteria	2785
266	Ga0316574_0034734	3300035398	Bacteria	3076
267	Ga0316574_0145401	3300035398	Bacteria	1528
268	Ga0373924_0025636	3300035410	Bacteria	2331
269	Ga0373931_0000123	3300035691	Bacteria	34923
270	Ga0373931_0048267	3300035691	Bacteria	2256
271	Ga0373935_0018482	3300035692	Bacteria	4240
272	Ga0373927_0026529	3300035695	Bacteria	3786
273	Ga0373933_0001013	3300035724	Bacteria	17051
274	Ga0373933_0005656	3300035724	Bacteria	6806
275	Ga0373933_0009338	3300035724	Bacteria	5357
276	Ga0373933_0025147	3300035724	Bacteria	3412
277	Ga0373933_0191780	3300035724	Bacteria	1305
278	Ga0373947_0010202	3300035725	Bacteria	5393
279	Ga0373947_0087880	3300035725	Bacteria	1933
280	Ga0373947_0119922	3300035725	Bacteria	1670
281	Ga0373937_0000696	3300036401	Bacteria	29326
282	Ga0373937_0011742	3300036401	Bacteria	7682
283	Ga0373937_0056532	3300036401	Bacteria	3603
284	Ga0373937_0075618	3300036401	Bacteria	3110
285	Ga0373937_0144217	3300036401	Bacteria	2228
286	Ga0373937_0508483	3300036401	Bacteria	1144
287	Ga0373925_0031618	3300037068	Bacteria	3890
288	Ga0373925_0043051	3300037068	Bacteria	3350
289	Ga0400483_243392	3300039062	Bacteria	1658
290	Ga0439453_0005795	3300041408	Bacteria	1898
291	Ga0439461_0004046	3300041410	Bacteria	2433
292	Ga0439466_0030916	3300041411	Bacteria	1834
293	Ga0439441_000627	3300042001	Bacteria	3999
294	Ga0439441_003033	3300042001	Bacteria	2429
295	Ga0439454_011986	3300042011	Bacteria	1168
296	Ga0439456_020427	3300042013	Bacteria	1397
297	Ga0439434_0007915	3300042435	Bacteria	3116
298	Ga0439435_0000215	3300042436	Bacteria	8152
299	Ga0439435_0001547	3300042436	Bacteria	4293
300	Ga0439444_0004720	3300042437	Bacteria	1993
301	Ga0439444_0023983	3300042437	Bacteria	1099
302	Ga0439460_0000034	3300042461	Bacteria	19622
303	Ga0466965_0087201	3300044683	Bacteria	1584
304	Ga0466964_0018470	3300044706	Bacteria	2677
305	Ga0453684_0100617	3300044712	Bacteria	3538
306	Ga0466957_0063677	3300044842	Bacteria	2267
307	Ga0451576_0001013	3300045051	Bacteria	51916
308	Ga0451576_0025444	3300045051	Bacteria	6375
309	Ga0451576_0033625	3300045051	Bacteria	5450
310	Ga0451576_1153114	3300045051	Bacteria	810
311	Ga0466967_0001149	3300045976	Bacteria	14789
312	Ga0466967_0479024	3300045976	Bacteria	1219
313	Ga0495592_0001120	3300046454	Bacteria	18622
314	Ga0495592_0056837	3300046454	Bacteria	2889
315	Ga0495592_0146955	3300046454	Bacteria	1633
316	Ga0495592_0235328	3300046454	Bacteria	1218
317	Ga0495603_0012968	3300046455	Bacteria	5039
318	Ga0495603_0096620	3300046455	Bacteria	1726
319	Ga0495641_0011876	3300046461	Bacteria	4920
320	Ga0495651_0004288	3300046462	Bacteria	10933
321	Ga0495651_0172049	3300046462	Bacteria	1541
322	Ga0495651_0204564	3300046462	Bacteria	1379
323	Ga0495651_0694732	3300046462	Bacteria	634
324	Ga0495653_0061115	3300046463	Bacteria	2851
325	Ga0495580_0015367	3300046472	Bacteria	5774
326	Ga0495580_0022988	3300046472	Bacteria	4584
327	Ga0495582_0040051	3300046473	Bacteria	2580
328	Ga0495639_0003798	3300046475	Bacteria	6486
329	Ga0495639_0089619	3300046475	Bacteria	1441
330	Ga0495662_0070318	3300046476	Bacteria	1696
331	Ga0495664_0002269	3300046477	Bacteria	10309
332	Ga0495584_0104262	3300046491	Bacteria	1434
333	Ga0495594_0018117	3300046499	Bacteria	3729
334	Ga0495594_0065355	3300046499	Bacteria	2017
335	Ga0495608_0049910	3300046511	Bacteria	2776
336	Ga0495608_0092150	3300046511	Bacteria	1959
337	Ga0495608_0328141	3300046511	Bacteria	944
338	Ga0495618_0045889	3300046514	Bacteria	2757
339	Ga0495628_0000904	3300046516	Bacteria	27219
340	Ga0495628_0022309	3300046516	Bacteria	5200
341	Ga0495628_0049311	3300046516	Bacteria	3335
342	Ga0495630_0172628	3300046517	Bacteria	1647
343	Ga0495663_0197121	3300046525	Bacteria	702
344	Ga0495666_0040936	3300046526	Bacteria	2245
345	Ga0495642_0070629	3300046528	Bacteria	1460
346	Ga0495652_0005891	3300046529	Bacteria	11463
347	Ga0495652_0079136	3300046529	Bacteria	2719
348	Ga0495652_0115055	3300046529	Bacteria	2156
349	Ga0495665_0064156	3300046531	Bacteria	1939
350	Ga0495640_0111844	3300046533	Bacteria	1784
351	Ga0495640_0159615	3300046533	Bacteria	1445
352	Ga0495586_0058071	3300046535	Bacteria	2100
353	Ga0495586_0210757	3300046535	Bacteria	1102
354	Ga0495586_0278705	3300046535	Bacteria	956
355	Ga0495587_0013022	3300046536	Bacteria	5231
356	Ga0495587_0339886	3300046536	Bacteria	837
357	Ga0495598_0006675	3300046537	Bacteria	2615
358	Ga0495645_0000272	3300046543	Bacteria	37937
359	Ga0495667_0260232	3300046559	Bacteria	1103
360	Ga0495667_0364237	3300046559	Bacteria	912
361	Ga0495634_0045760	3300046642	Bacteria	2956
362	Ga0495635_0052360	3300046663	Bacteria	2812
363	Ga0495635_0147095	3300046663	Bacteria	1604
364	Ga0495657_0059450	3300046675	Bacteria	2535
365	Ga0495657_0250110	3300046675	Bacteria	1067
366	Ga0495599_0001029	3300046678	Bacteria	15642
367	Ga0495599_0010568	3300046678	Bacteria	5649
368	Ga0495646_0411760	3300046680	Bacteria	702
369	Ga0495647_0002694	3300046681	Bacteria	5643
370	Ga0495647_0015767	3300046681	Bacteria	2651
371	Ga0495647_0033019	3300046681	Bacteria	1932
372	Ga0495658_0020769	3300046683	Bacteria	3452
373	Ga0495658_0034045	3300046683	Bacteria	2793
374	Ga0495669_0004956	3300046684	Bacteria	5533
375	Ga0495624_0028242	3300046690	Bacteria	3669
376	Ga0495670_0182694	3300046691	Bacteria	1108
377	Ga0495581_0407782	3300047315	Bacteria	792
378	Ga0495604_0176102	3300047317	Bacteria	1500
379	Ga0495604_0325341	3300047317	Bacteria	1027
380	Ga0495604_0329717	3300047317	Bacteria	1018
381	Ga0495636_0147635	3300047318	Bacteria	1053
382	Ga0495674_0008936	3300047319	Bacteria	9524
383	Ga0495680_0044296	3300047322	Bacteria	3519
384	Ga0495680_0146734	3300047322	Bacteria	1722
385	Ga0495675_0005852	3300047444	Bacteria	7513
386	Ga0495684_0113250	3300047471	Bacteria	2045
387	Ga0495684_0390084	3300047471	Bacteria	980
388	Ga0495684_0631058	3300047471	Bacteria	719
389	Ga0495614_0130750	3300048089	Bacteria	1111
390	Ga0496109_0421560	3300048912	Bacteria	1261
391	Ga0496121_0007521	3300048924	Bacteria	13140
392	Ga0501290_063157	3300049513	Bacteria	601
393	Ga0501291_089293	3300049514	Bacteria	626
394	Ga0501031_0204665	3300049568	Bacteria	1287
395	Ga0501031_0283026	3300049568	Bacteria	1075
396	Ga0501032_0192952	3300049569	Bacteria	1331
397	Ga0501033_0847500	3300049570	Bacteria	616
398	Ga0501034_0012117	3300049571	Bacteria	8914
399	Ga0501036_0135880	3300049572	Bacteria	2075
400	Ga0501036_0717101	3300049572	Bacteria	826
401	Ga0501037_0212708	3300049573	Bacteria	1363
402	Ga0501038_0454572	3300049574	Bacteria	984
403	Ga0501039_0110288	3300049575	Bacteria	2151
404	Ga0501039_0913266	3300049575	Bacteria	683
405	Ga0501040_0035301	3300049576	Bacteria	3390
406	Ga0501041_0018988	3300049577	Bacteria	4097
407	Ga0501042_0022388	3300049578	Bacteria	4415
408	Ga0501046_0047293	3300049580	Bacteria	3411
409	Ga0501048_0052733	3300049582	Bacteria	2895
410	Ga0501048_0121456	3300049582	Bacteria	1846
411	Ga0501048_0416725	3300049582	Bacteria	961
412	Ga0501068_0004380	3300049584	Bacteria	7683
413	Ga0501069_0070029	3300049585	Bacteria	1964
414	Ga0501070_0016825	3300049586	Bacteria	6139
415	Ga0501070_0065697	3300049586	Bacteria	3004
416	Ga0501071_0034423	3300049587	Bacteria	3605
417	Ga0501071_0922270	3300049587	Bacteria	674
418	Ga0501072_0109239	3300049588	Bacteria	2201
419	Ga0501072_0458327	3300049588	Bacteria	1009
420	Ga0501073_0001128	3300049589	Bacteria	19387
421	Ga0501073_0381265	3300049589	Bacteria	974
422	Ga0501074_0002951	3300049590	Bacteria	11951
423	Ga0501074_0038393	3300049590	Bacteria	3471
424	Ga0501074_0474421	3300049590	Bacteria	887
425	Ga0501075_0007270	3300049591	Bacteria	7676
426	Ga0501075_0025905	3300049591	Bacteria	4311
427	Ga0501076_0044220	3300049592	Bacteria	3512
428	Ga0501077_0296850	3300049593	Bacteria	1029
429	Ga0501217_048323	3300049661	Bacteria	1105
430	Ga0501217_049167	3300049661	Bacteria	1097
431	Ga0501079_0430337	3300049741	Bacteria	1036
432	Ga0501080_0000288	3300049742	Bacteria	38150
433	Ga0501080_0737454	3300049742	Bacteria	867
434	Ga0501081_0020734	3300049743	Bacteria	4384
435	Ga0501081_0114865	3300049743	Bacteria	1913
436	Ga0501044_0284488	3300049823	Bacteria	1586
437	Ga0501045_0156145	3300049824	Bacteria	1698
438	Ga0501045_0443802	3300049824	Bacteria	965
439	nmdc:mga05p37_124078_c1	3300050507	Bacteria	3172
440	nmdc:mga05p37_243932_c1	3300050507	Bacteria	2158
441	nmdc:mga05p37_453_c1	3300050507	Bacteria	44606
442	nmdc:mga05p37_846529_c1	3300050507	Bacteria	994
443	nmdc:mga09592_1204_c1	3300050508	Bacteria	20724
444	nmdc:mga09592_152264_c1	3300050508	Bacteria	1996
445	nmdc:mga0qj67_1103_c1	3300050509	Bacteria	18726
446	nmdc:mga0qj67_2672_c1	3300050509	Bacteria	12763
447	nmdc:mga0qj67_81113_c1	3300050509	Bacteria	2601
448	nmdc:mga06r32_147484_c1	3300050510	Bacteria	2330
449	nmdc:mga06r32_39277_c1	3300050510	Bacteria	4491
450	nmdc:mga06r32_44734_c1	3300050510	Bacteria	4217
451	nmdc:mga08y16_176052_c1	3300050511	Bacteria	2221
452	nmdc:mga08y16_261890_c1	3300050511	Bacteria	1786
453	nmdc:mga08y16_4362_c1	3300050511	Bacteria	14779
454	nmdc:mga08y16_61309_c1	3300050511	Bacteria	3928
455	nmdc:mga08y16_8215_c1	3300050511	Bacteria	10918
456	nmdc:mga0n895_32044_c1	3300050512	Bacteria	5041
457	nmdc:mga0n895_32810_c1	3300050512	Bacteria	4986
458	nmdc:mga0n895_738_c1	3300050512	Bacteria	23103
459	nmdc:mga0rr50_248382_c1	3300050513	Bacteria	1477
460	nmdc:mga0rr50_3029_c1	3300050513	Bacteria	9613
461	nmdc:mga0rr50_988_c1	3300050513	Bacteria	15447
462	nmdc:mga08x19_33319_c1	3300050514	Bacteria	3251
463	nmdc:mga08x19_39004_c1	3300050514	Bacteria	3018
464	nmdc:mga08x19_548_c1	3300050514	Bacteria	24677
465	nmdc:mga0a205_1234_c1	3300050515	Bacteria	21448
466	nmdc:mga0a205_396951_c1	3300050515	Bacteria	1243
467	nmdc:mga0a205_6478_c1	3300050515	Bacteria	10586
468	Ga0495601_0017753	3300053077	Bacteria	4323
469	Ga0495601_0061819	3300053077	Bacteria	2378
470	Ga0495601_0116913	3300053077	Bacteria	1730
471	Ga0495601_0461476	3300053077	Bacteria	821
472	Ga0495595_0004520	3300053084	Bacteria	5597
473	Ga0495619_0048821	3300053085	Bacteria	2789
474	Ga0495619_0481300	3300053085	Bacteria	854
475	Ga0495619_0527400	3300053085	Bacteria	811
476	Ga0500652_145689	3300053131	Bacteria	984
477	Ga0500616_0175640	3300053153	Bacteria	969
478	Ga0501084_0148291	3300054114	Bacteria	1976
479	Ga0501082_0536533	3300060353	Bacteria	1023
480	Ga0530510_0027372	3300061734	Bacteria	4084
481	Ga0530510_0068528	3300061734	Bacteria	2574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049513	Ga0501290_063157	Ga0501290_063157_40_582	179
2	3300027378	Ga0209981_1000507	Ga0209981_10005077	182
3	3300006871	Ga0075434_100000002	Ga0075434_10000000251	186
4	3300006914	Ga0075436_100100931	Ga0075436_1001009312	186
5	3300007076	Ga0075435_100002145	Ga0075435_10000214514	186
6	3300005546	Ga0070696_100011993	Ga0070696_1000119936	187
7	3300027462	Ga0210000_1017598	Ga0210000_10175982	187
8	3300027471	Ga0209995_1020562	Ga0209995_10205622	187
9	3300027543	Ga0209999_1013554	Ga0209999_10135542	187
10	3300027695	Ga0209966_1006922	Ga0209966_10069223	187
11	3300046462	Ga0495651_0694732	Ga0495651_0694732_23_589	187
12	3300046476	Ga0495662_0070318	Ga0495662_0070318_865_1431	187
13	3300046511	Ga0495608_0092150	Ga0495608_0092150_1171_1737	187
14	3300046516	Ga0495628_0049311	Ga0495628_0049311_2538_3104	187
15	3300046533	Ga0495640_0111844	Ga0495640_0111844_295_861	187
16	3300046535	Ga0495586_0210757	Ga0495586_0210757_156_722	187
17	3300046663	Ga0495635_0147095	Ga0495635_0147095_714_1280	187
18	3300046680	Ga0495646_0411760	Ga0495646_0411760_22_588	187
19	3300046690	Ga0495624_0028242	Ga0495624_0028242_13_579	187
20	3300047315	Ga0495581_0407782	Ga0495581_0407782_35_604	187
21	3300047471	Ga0495684_0390084	Ga0495684_0390084_332_898	187
22	3300049514	Ga0501291_089293	Ga0501291_089293_18_584	187
23	3300053077	Ga0495601_0061819	Ga0495601_0061819_355_921	187
24	3300005338	Ga0068868_100345625	Ga0068868_1003456252	188
25	3300005295	Ga0065707_10037969	Ga0065707_100379693	189
26	3300005536	Ga0070697_100017800	Ga0070697_1000178003	189
27	3300006846	Ga0075430_100119041	Ga0075430_1001190411	189
28	3300006852	Ga0075433_10022480	Ga0075433_100224806	189
29	3300006914	Ga0075436_100128870	Ga0075436_1001288703	189
30	3300007076	Ga0075435_100072067	Ga0075435_1000720672	189
31	3300045051	Ga0451576_1153114	Ga0451576_1153114_50_625	189
32	3300046462	Ga0495651_0204564	Ga0495651_0204564_367_987	189
33	3300046499	Ga0495594_0065355	Ga0495594_0065355_1402_1998	189
34	3300046675	Ga0495657_0059450	Ga0495657_0059450_39_635	189
35	3300047317	Ga0495604_0176102	Ga0495604_0176102_375_995	189
36	3300048912	Ga0496109_0421560	Ga0496109_0421560_21_590	189
37	3300049570	Ga0501033_0847500	Ga0501033_0847500_25_603	189
38	3300049585	Ga0501069_0070029	Ga0501069_0070029_1275_1925	189
39	3300050507	nmdc:mga05p37_846529_c1	nmdc:mga05p37_846529_c1_17_592	189
40	3300005549	Ga0070704_100004098	Ga0070704_1000040982	193
41	3300026089	Ga0207648_10300596	Ga0207648_103005962	195
42	3300035118	Ga0373954_0002456	Ga0373954_0002456_2783_3403	195
43	3300035172	Ga0373955_0245850	Ga0373955_0245850_263_883	195
44	3300036401	Ga0373937_0075618	Ga0373937_0075618_882_1502	195
45	3300047317	Ga0495604_0325341	Ga0495604_0325341_62_682	195
46	3300047322	Ga0495680_0044296	Ga0495680_0044296_2241_2858	195
47	3300027471	Ga0209995_1009696	Ga0209995_10096962	199
48	3300027543	Ga0209999_1019167	Ga0209999_10191672	199
49	3300031911	Ga0307412_10167141	Ga0307412_101671412	199
50	3300005536	Ga0070697_100637729	Ga0070697_1006377291	201
51	3300006051	Ga0075364_10615448	Ga0075364_106154481	201
52	3300009147	Ga0114129_10578218	Ga0114129_105782183	201
53	3300027665	Ga0209983_1063439	Ga0209983_10634391	201
54	3300027717	Ga0209998_10011093	Ga0209998_100110933	201
55	3300039062	Ga0400483_243392	Ga0400483_243392_327_965	201
56	3300049824	Ga0501045_0156145	Ga0501045_0156145_705_1334	201
57	3300050507	nmdc:mga05p37_243932_c1	nmdc:mga05p37_243932_c1_292_978	201
58	3300060353	Ga0501082_0536533	Ga0501082_0536533_64_693	201
59	3300061734	Ga0530510_0027372	Ga0530510_0027372_2374_3003	201
60	3300031727	Ga0316576_10021103	Ga0316576_100211033	202
61	3300032137	Ga0316585_10072822	Ga0316585_100728221	202
62	3300035398	Ga0316574_0034734	Ga0316574_0034734_215_907	202
63	3300035398	Ga0316574_0145401	Ga0316574_0145401_723_1367	202
64	3300005329	Ga0070683_100167815	Ga0070683_1001678153	203
65	3300005547	Ga0070693_100233993	Ga0070693_1002339932	203
66	3300013105	Ga0157369_11044673	Ga0157369_110446731	203
67	3300025944	Ga0207661_10219368	Ga0207661_102193682	203
68	3300026041	Ga0207639_10153313	Ga0207639_101533131	203
69	3300027364	Ga0209967_1021200	Ga0209967_10212001	203
70	3300027543	Ga0209999_1023257	Ga0209999_10232571	203
71	3300032005	Ga0307411_10090957	Ga0307411_100909573	203
72	3300046537	Ga0495598_0006675	Ga0495598_0006675_1110_1724	203
73	3300049580	Ga0501046_0047293	Ga0501046_0047293_2559_3173	203
74	3300049661	Ga0501217_048323	Ga0501217_048323_158_772	203
75	3300049743	Ga0501081_0114865	Ga0501081_0114865_981_1595	203
76	3300050512	nmdc:mga0n895_738_c1	nmdc:mga0n895_738_c1_9942_10556	203
77	3300050513	nmdc:mga0rr50_988_c1	nmdc:mga0rr50_988_c1_14393_15007	203
78	3300050514	nmdc:mga08x19_33319_c1	nmdc:mga08x19_33319_c1_991_1605	203
79	3300005345	Ga0070692_10022032	Ga0070692_100220324	204
80	3300005441	Ga0070700_100471553	Ga0070700_1004715532	204
81	3300006844	Ga0075428_100157659	Ga0075428_1001576593	204
82	3300006846	Ga0075430_100002744	Ga0075430_10000274411	204
83	3300006852	Ga0075433_10946590	Ga0075433_109465901	204
84	3300007076	Ga0075435_100005634	Ga0075435_1000056343	204
85	3300007265	Ga0099794_10075728	Ga0099794_100757282	204
86	3300009094	Ga0111539_10832987	Ga0111539_108329871	204
87	3300009176	Ga0105242_10321221	Ga0105242_103212211	204
88	3300025931	Ga0207644_10613177	Ga0207644_106131772	204
89	3300026075	Ga0207708_10238534	Ga0207708_102385342	204
90	3300027671	Ga0209588_1073212	Ga0209588_10732121	204
91	3300032005	Ga0307411_10128614	Ga0307411_101286142	204
92	3300035083	Ga0373926_0001237	Ga0373926_0001237_1279_1899	204
93	3300035084	Ga0373928_0003480	Ga0373928_0003480_2021_2641	204
94	3300035088	Ga0373940_0000228	Ga0373940_0000228_4005_4625	204
95	3300035112	Ga0373932_0000697	Ga0373932_0000697_9499_10119	204
96	3300035113	Ga0373936_0000086	Ga0373936_0000086_31506_32126	204
97	3300035114	Ga0373939_0007879	Ga0373939_0007879_1737_2357	204
98	3300035115	Ga0373941_0011242	Ga0373941_0011242_1237_1857	204
99	3300035115	Ga0373941_0147021	Ga0373941_0147021_160_780	204
100	3300035116	Ga0373945_0010702	Ga0373945_0010702_1362_1982	204
101	3300035117	Ga0373953_0017488	Ga0373953_0017488_988_1605	204
102	3300035118	Ga0373954_0000082	Ga0373954_0000082_6483_7100	204
103	3300035120	Ga0373957_0027114	Ga0373957_0027114_1211_1828	204
104	3300035170	Ga0373943_0020182	Ga0373943_0020182_547_1167	204
105	3300035171	Ga0373946_0006828	Ga0373946_0006828_1819_2439	204
106	3300035207	Ga0373942_0010415	Ga0373942_0010415_1398_2018	204
107	3300035241	Ga0373961_0001991	Ga0373961_0001991_1354_1974	204
108	3300035241	Ga0373961_0064284	Ga0373961_0064284_448_1068	204
109	3300035242	Ga0373962_0006766	Ga0373962_0006766_295_915	204
110	3300035691	Ga0373931_0000123	Ga0373931_0000123_22524_23144	204
111	3300035692	Ga0373935_0018482	Ga0373935_0018482_1596_2216	204
112	3300035695	Ga0373927_0026529	Ga0373927_0026529_1540_2160	204
113	3300035724	Ga0373933_0001013	Ga0373933_0001013_165_782	204
114	3300035724	Ga0373933_0009338	Ga0373933_0009338_763_1380	204
115	3300035725	Ga0373947_0010202	Ga0373947_0010202_3761_4381	204
116	3300035725	Ga0373947_0087880	Ga0373947_0087880_1036_1656	204
117	3300036401	Ga0373937_0000696	Ga0373937_0000696_9995_10612	204
118	3300036401	Ga0373937_0011742	Ga0373937_0011742_5975_6592	204
119	3300037068	Ga0373925_0031618	Ga0373925_0031618_1218_1838	204
120	3300037068	Ga0373925_0043051	Ga0373925_0043051_630_1250	204
121	3300041410	Ga0439461_0004046	Ga0439461_0004046_100_723	204
122	3300041411	Ga0439466_0030916	Ga0439466_0030916_771_1394	204
123	3300042001	Ga0439441_003033	Ga0439441_003033_1786_2403	204
124	3300042435	Ga0439434_0007915	Ga0439434_0007915_63_686	204
125	3300042436	Ga0439435_0000215	Ga0439435_0000215_276_914	204
126	3300042436	Ga0439435_0001547	Ga0439435_0001547_1876_2499	204
127	3300042437	Ga0439444_0023983	Ga0439444_0023983_352_969	204
128	3300042461	Ga0439460_0000034	Ga0439460_0000034_4164_4802	204
129	3300044712	Ga0453684_0100617	Ga0453684_0100617_842_1462	204
130	3300045051	Ga0451576_0001013	Ga0451576_0001013_44827_45447	204
131	3300045051	Ga0451576_0025444	Ga0451576_0025444_27_647	204
132	3300046454	Ga0495592_0235328	Ga0495592_0235328_62_679	204
133	3300046455	Ga0495603_0012968	Ga0495603_0012968_2905_3525	204
134	3300046455	Ga0495603_0096620	Ga0495603_0096620_456_1073	204
135	3300046472	Ga0495580_0015367	Ga0495580_0015367_1759_2379	204
136	3300046473	Ga0495582_0040051	Ga0495582_0040051_1268_1888	204
137	3300046475	Ga0495639_0003798	Ga0495639_0003798_1880_2500	204
138	3300046499	Ga0495594_0018117	Ga0495594_0018117_1904_2524	204
139	3300046526	Ga0495666_0040936	Ga0495666_0040936_466_1086	204
140	3300046531	Ga0495665_0064156	Ga0495665_0064156_508_1128	204
141	3300046681	Ga0495647_0002694	Ga0495647_0002694_1604_2224	204
142	3300046683	Ga0495658_0020769	Ga0495658_0020769_1625_2245	204
143	3300046691	Ga0495670_0182694	Ga0495670_0182694_104_724	204
144	3300047471	Ga0495684_0631058	Ga0495684_0631058_64_681	204
145	3300049568	Ga0501031_0204665	Ga0501031_0204665_175_798	204
146	3300049569	Ga0501032_0192952	Ga0501032_0192952_478_1098	204
147	3300049572	Ga0501036_0135880	Ga0501036_0135880_145_762	204
148	3300049574	Ga0501038_0454572	Ga0501038_0454572_14_631	204
149	3300049575	Ga0501039_0913266	Ga0501039_0913266_45_665	204
150	3300049576	Ga0501040_0035301	Ga0501040_0035301_1910_2527	204
151	3300049577	Ga0501041_0018988	Ga0501041_0018988_904_1521	204
152	3300049578	Ga0501042_0022388	Ga0501042_0022388_246_863	204
153	3300049582	Ga0501048_0416725	Ga0501048_0416725_19_636	204
154	3300049586	Ga0501070_0016825	Ga0501070_0016825_267_887	204
155	3300049587	Ga0501071_0034423	Ga0501071_0034423_770_1390	204
156	3300049588	Ga0501072_0109239	Ga0501072_0109239_59_691	204
157	3300049588	Ga0501072_0458327	Ga0501072_0458327_171_788	204
158	3300049589	Ga0501073_0381265	Ga0501073_0381265_175_795	204
159	3300049590	Ga0501074_0002951	Ga0501074_0002951_8987_9607	204
160	3300049591	Ga0501075_0007270	Ga0501075_0007270_3102_3722	204
161	3300049823	Ga0501044_0284488	Ga0501044_0284488_713_1333	204
162	3300050509	nmdc:mga0qj67_1103_c1	nmdc:mga0qj67_1103_c1_10348_10965	204
163	3300050511	nmdc:mga08y16_176052_c1	nmdc:mga08y16_176052_c1_1471_2091	204
164	3300050513	nmdc:mga0rr50_248382_c1	nmdc:mga0rr50_248382_c1_259_879	204
165	3300053085	Ga0495619_0527400	Ga0495619_0527400_122_739	204
166	3300005295	Ga0065707_10103363	Ga0065707_101033634	205
167	3300006173	Ga0070716_100042732	Ga0070716_1000427323	205
168	3300006846	Ga0075430_100003759	Ga0075430_1000037596	205
169	3300006846	Ga0075430_100041331	Ga0075430_1000413313	205
170	3300006847	Ga0075431_100010233	Ga0075431_1000102335	205
171	3300006847	Ga0075431_100235693	Ga0075431_1002356933	205
172	3300006914	Ga0075436_100011332	Ga0075436_1000113325	205
173	3300006914	Ga0075436_100138606	Ga0075436_1001386063	205
174	3300007265	Ga0099794_10002127	Ga0099794_100021276	205
175	3300007265	Ga0099794_10077557	Ga0099794_100775572	205
176	3300009094	Ga0111539_10014131	Ga0111539_100141312	205
177	3300009147	Ga0114129_11323437	Ga0114129_113234372	205
178	3300009148	Ga0105243_10005965	Ga0105243_100059658	205
179	3300009553	Ga0105249_10000709	Ga0105249_1000070916	205
180	3300014326	Ga0157380_10004906	Ga0157380_100049063	205
181	3300025907	Ga0207645_10080162	Ga0207645_100801622	205
182	3300025918	Ga0207662_10082393	Ga0207662_100823932	205
183	3300025939	Ga0207665_10103753	Ga0207665_101037533	205
184	3300027360	Ga0209969_1009596	Ga0209969_10095962	205
185	3300027471	Ga0209995_1018558	Ga0209995_10185583	205
186	3300027512	Ga0209179_1047883	Ga0209179_10478832	205
187	3300027665	Ga0209983_1011569	Ga0209983_10115693	205
188	3300027671	Ga0209588_1008774	Ga0209588_10087744	205
189	3300027671	Ga0209588_1016477	Ga0209588_10164773	205
190	3300027682	Ga0209971_1005895	Ga0209971_10058953	205
191	3300027876	Ga0209974_10051664	Ga0209974_100516642	205
192	3300028381	Ga0268264_10469296	Ga0268264_104692962	205
193	3300031548	Ga0307408_100391898	Ga0307408_1003918982	205
194	3300031548	Ga0307408_100627476	Ga0307408_1006274761	205
195	3300031852	Ga0307410_10357312	Ga0307410_103573122	205
196	3300031903	Ga0307407_10127283	Ga0307407_101272832	205
197	3300032002	Ga0307416_100035966	Ga0307416_1000359663	205
198	3300032002	Ga0307416_100130932	Ga0307416_1001309322	205
199	3300032005	Ga0307411_10125269	Ga0307411_101252692	205
200	3300035086	Ga0373934_0000565	Ga0373934_0000565_9986_10603	205
201	3300035117	Ga0373953_0048854	Ga0373953_0048854_754_1371	205
202	3300035119	Ga0373956_0000155	Ga0373956_0000155_9913_10530	205
203	3300035120	Ga0373957_0054208	Ga0373957_0054208_716_1333	205
204	3300035172	Ga0373955_0008818	Ga0373955_0008818_613_1230	205
205	3300035724	Ga0373933_0005656	Ga0373933_0005656_1567_2184	205
206	3300036401	Ga0373937_0056532	Ga0373937_0056532_1764_2381	205
207	3300041408	Ga0439453_0005795	Ga0439453_0005795_721_1341	205
208	3300042001	Ga0439441_000627	Ga0439441_000627_1952_2572	205
209	3300042011	Ga0439454_011986	Ga0439454_011986_371_991	205
210	3300042013	Ga0439456_020427	Ga0439456_020427_413_1033	205
211	3300042437	Ga0439444_0004720	Ga0439444_0004720_790_1410	205
212	3300045976	Ga0466967_0479024	Ga0466967_0479024_228_845	205
213	3300046462	Ga0495651_0004288	Ga0495651_0004288_6641_7258	205
214	3300046491	Ga0495584_0104262	Ga0495584_0104262_523_1143	205
215	3300047318	Ga0495636_0147635	Ga0495636_0147635_149_766	205
216	3300050507	nmdc:mga05p37_124078_c1	nmdc:mga05p37_124078_c1_2302_2922	205
217	3300050508	nmdc:mga09592_152264_c1	nmdc:mga09592_152264_c1_1238_1858	205
218	3300050509	nmdc:mga0qj67_81113_c1	nmdc:mga0qj67_81113_c1_139_759	205
219	3300050510	nmdc:mga06r32_39277_c1	nmdc:mga06r32_39277_c1_1513_2133	205
220	3300050510	nmdc:mga06r32_44734_c1	nmdc:mga06r32_44734_c1_3350_3967	205
221	3300050511	nmdc:mga08y16_261890_c1	nmdc:mga08y16_261890_c1_1116_1736	205
222	3300050511	nmdc:mga08y16_61309_c1	nmdc:mga08y16_61309_c1_3087_3707	205
223	3300050515	nmdc:mga0a205_396951_c1	nmdc:mga0a205_396951_c1_23_640	205
224	3300005288	Ga0065714_10316704	Ga0065714_103167041	206
225	3300005328	Ga0070676_10486865	Ga0070676_104868652	206
226	3300005330	Ga0070690_100011618	Ga0070690_1000116182	206
227	3300005330	Ga0070690_100189020	Ga0070690_1001890202	206
228	3300005334	Ga0068869_100075791	Ga0068869_1000757912	206
229	3300005334	Ga0068869_100687476	Ga0068869_1006874762	206
230	3300005335	Ga0070666_10087084	Ga0070666_100870842	206
231	3300005336	Ga0070680_100133527	Ga0070680_1001335272	206
232	3300005337	Ga0070682_100145396	Ga0070682_1001453962	206
233	3300005338	Ga0068868_100061609	Ga0068868_1000616092	206
234	3300005340	Ga0070689_100001092	Ga0070689_1000010924	206
235	3300005343	Ga0070687_100000811	Ga0070687_10000081111	206
236	3300005343	Ga0070687_100365334	Ga0070687_1003653342	206
237	3300005345	Ga0070692_10026343	Ga0070692_100263432	206
238	3300005355	Ga0070671_100085256	Ga0070671_1000852563	206
239	3300005364	Ga0070673_101432470	Ga0070673_1014324701	206
240	3300005365	Ga0070688_100089093	Ga0070688_1000890932	206
241	3300005367	Ga0070667_100402715	Ga0070667_1004027153	206
242	3300005436	Ga0070713_100534394	Ga0070713_1005343942	206
243	3300005440	Ga0070705_100000473	Ga0070705_10000047314	206
244	3300005441	Ga0070700_100006345	Ga0070700_1000063455	206
245	3300005444	Ga0070694_100001201	Ga0070694_1000012019	206
246	3300005444	Ga0070694_100243372	Ga0070694_1002433721	206
247	3300005444	Ga0070694_100424059	Ga0070694_1004240592	206
248	3300005456	Ga0070678_100165000	Ga0070678_1001650002	206
249	3300005457	Ga0070662_100128409	Ga0070662_1001284092	206
250	3300005458	Ga0070681_10000135	Ga0070681_100001353	206
251	3300005458	Ga0070681_10250977	Ga0070681_102509772	206
252	3300005518	Ga0070699_100121357	Ga0070699_1001213572	206
253	3300005543	Ga0070672_100266151	Ga0070672_1002661511	206
254	3300005544	Ga0070686_100119035	Ga0070686_1001190352	206
255	3300005544	Ga0070686_100298055	Ga0070686_1002980553	206
256	3300005545	Ga0070695_100003136	Ga0070695_10000313611	206
257	3300005546	Ga0070696_100007911	Ga0070696_1000079117	206
258	3300005546	Ga0070696_100231121	Ga0070696_1002311212	206
259	3300005547	Ga0070693_100000008	Ga0070693_10000000877	206
260	3300005548	Ga0070665_100111092	Ga0070665_1001110923	206
261	3300005549	Ga0070704_100009382	Ga0070704_1000093822	206
262	3300005549	Ga0070704_100373523	Ga0070704_1003735232	206
263	3300005563	Ga0068855_100011714	Ga0068855_1000117142	206
264	3300005563	Ga0068855_100844472	Ga0068855_1008444721	206
265	3300005564	Ga0070664_100508788	Ga0070664_1005087882	206
266	3300005577	Ga0068857_100665291	Ga0068857_1006652912	206
267	3300005578	Ga0068854_100002295	Ga0068854_10000229511	206
268	3300005614	Ga0068856_100032122	Ga0068856_1000321225	206
269	3300005614	Ga0068856_100237322	Ga0068856_1002373222	206
270	3300005615	Ga0070702_100000801	Ga0070702_1000008012	206
271	3300005617	Ga0068859_100003274	Ga0068859_1000032744	206
272	3300005718	Ga0068866_10008284	Ga0068866_100082842	206
273	3300005719	Ga0068861_101067045	Ga0068861_1010670452	206
274	3300005840	Ga0068870_10089937	Ga0068870_100899372	206
275	3300005841	Ga0068863_100297780	Ga0068863_1002977802	206
276	3300005842	Ga0068858_100003684	Ga0068858_10000368413	206
277	3300005842	Ga0068858_100142192	Ga0068858_1001421923	206
278	3300005843	Ga0068860_100020876	Ga0068860_1000208762	206
279	3300005844	Ga0068862_100011556	Ga0068862_1000115568	206
280	3300005844	Ga0068862_100453849	Ga0068862_1004538492	206
281	3300005844	Ga0068862_100803431	Ga0068862_1008034311	206
282	3300005985	Ga0081539_10000803	Ga0081539_1000080347	206
283	3300006173	Ga0070716_100150834	Ga0070716_1001508343	206
284	3300006237	Ga0097621_100007035	Ga0097621_1000070357	206
285	3300006237	Ga0097621_100092909	Ga0097621_1000929093	206
286	3300006358	Ga0068871_100152909	Ga0068871_1001529092	206
287	3300006358	Ga0068871_100280483	Ga0068871_1002804831	206
288	3300006844	Ga0075428_100000615	Ga0075428_10000061520	206
289	3300006847	Ga0075431_100163430	Ga0075431_1001634302	206
290	3300006852	Ga0075433_10000285	Ga0075433_1000028519	206
291	3300006871	Ga0075434_100023564	Ga0075434_1000235644	206
292	3300006871	Ga0075434_100735235	Ga0075434_1007352353	206
293	3300006880	Ga0075429_100000150	Ga0075429_1000001504	206
294	3300006881	Ga0068865_100013159	Ga0068865_1000131592	206
295	3300006881	Ga0068865_100791170	Ga0068865_1007911701	206
296	3300006914	Ga0075436_100000541	Ga0075436_1000005415	206
297	3300006914	Ga0075436_100000939	Ga0075436_1000009392	206
298	3300006914	Ga0075436_100048526	Ga0075436_1000485262	206
299	3300006931	Ga0097620_100003274	Ga0097620_1000032744	206
300	3300007265	Ga0099794_10095640	Ga0099794_100956401	206
301	3300009094	Ga0111539_10015864	Ga0111539_100158647	206
302	3300009094	Ga0111539_10027196	Ga0111539_100271962	206
303	3300009098	Ga0105245_10000776	Ga0105245_1000077614	206
304	3300009147	Ga0114129_10000534	Ga0114129_1000053439	206
305	3300009148	Ga0105243_10005007	Ga0105243_1000500712	206
306	3300009174	Ga0105241_10066162	Ga0105241_100661622	206
307	3300009176	Ga0105242_10089589	Ga0105242_100895892	206
308	3300009553	Ga0105249_10011664	Ga0105249_100116642	206
309	3300010375	Ga0105239_10281048	Ga0105239_102810482	206
310	3300011119	Ga0105246_10264891	Ga0105246_102648912	206
311	3300013296	Ga0157374_10250946	Ga0157374_102509462	206
312	3300013297	Ga0157378_10029968	Ga0157378_100299685	206
313	3300013306	Ga0163162_10169139	Ga0163162_101691393	206
314	3300013306	Ga0163162_10260930	Ga0163162_102609302	206
315	3300013308	Ga0157375_10378704	Ga0157375_103787042	206
316	3300014326	Ga0157380_10206918	Ga0157380_102069182	206
317	3300014745	Ga0157377_10114239	Ga0157377_101142391	206
318	3300014745	Ga0157377_10307293	Ga0157377_103072932	206
319	3300014968	Ga0157379_10256942	Ga0157379_102569422	206
320	3300014969	Ga0157376_10004088	Ga0157376_100040889	206
321	3300025899	Ga0207642_10242062	Ga0207642_102420622	206
322	3300025903	Ga0207680_10070537	Ga0207680_100705372	206
323	3300025908	Ga0207643_10320595	Ga0207643_103205952	206
324	3300025908	Ga0207643_10324997	Ga0207643_103249972	206
325	3300025912	Ga0207707_10003800	Ga0207707_100038004	206
326	3300025912	Ga0207707_10233537	Ga0207707_102335372	206
327	3300025917	Ga0207660_10052304	Ga0207660_100523042	206
328	3300025918	Ga0207662_10000388	Ga0207662_100003889	206
329	3300025918	Ga0207662_10091653	Ga0207662_100916533	206
330	3300025921	Ga0207652_10038483	Ga0207652_100384832	206
331	3300025927	Ga0207687_10186795	Ga0207687_101867952	206
332	3300025927	Ga0207687_10931569	Ga0207687_109315691	206
333	3300025933	Ga0207706_10110438	Ga0207706_101104383	206
334	3300025935	Ga0207709_10015271	Ga0207709_100152712	206
335	3300025936	Ga0207670_10147489	Ga0207670_101474892	206
336	3300025936	Ga0207670_10218936	Ga0207670_102189362	206
337	3300025938	Ga0207704_10110298	Ga0207704_101102982	206
338	3300025942	Ga0207689_10006400	Ga0207689_1000640011	206
339	3300025942	Ga0207689_10092055	Ga0207689_100920553	206
340	3300025942	Ga0207689_10153052	Ga0207689_101530522	206
341	3300025942	Ga0207689_10325096	Ga0207689_103250961	206
342	3300025949	Ga0207667_10027042	Ga0207667_100270427	206
343	3300025960	Ga0207651_10365509	Ga0207651_103655091	206
344	3300025961	Ga0207712_10150565	Ga0207712_101505652	206
345	3300025981	Ga0207640_10017877	Ga0207640_100178772	206
346	3300026023	Ga0207677_10076171	Ga0207677_100761712	206
347	3300026023	Ga0207677_10095632	Ga0207677_100956322	206
348	3300026035	Ga0207703_10156521	Ga0207703_101565211	206
349	3300026035	Ga0207703_10295121	Ga0207703_102951212	206
350	3300026075	Ga0207708_10005256	Ga0207708_100052562	206
351	3300026078	Ga0207702_10266080	Ga0207702_102660802	206
352	3300026078	Ga0207702_10404153	Ga0207702_104041532	206
353	3300026088	Ga0207641_10018861	Ga0207641_100188614	206
354	3300026089	Ga0207648_10000708	Ga0207648_1000070811	206
355	3300026095	Ga0207676_10203880	Ga0207676_102038803	206
356	3300026095	Ga0207676_10243656	Ga0207676_102436562	206
357	3300026118	Ga0207675_100000120	Ga0207675_10000012064	206
358	3300026118	Ga0207675_100044365	Ga0207675_1000443655	206
359	3300026121	Ga0207683_10476687	Ga0207683_104766872	206
360	3300027671	Ga0209588_1030875	Ga0209588_10308752	206
361	3300027907	Ga0207428_10000758	Ga0207428_1000075832	206
362	3300027907	Ga0207428_10139019	Ga0207428_101390192	206
363	3300028380	Ga0268265_10021495	Ga0268265_100214956	206
364	3300028381	Ga0268264_10193545	Ga0268264_101935452	206
365	3300032005	Ga0307411_10772356	Ga0307411_107723561	206
366	3300035084	Ga0373928_0024057	Ga0373928_0024057_357_980	206
367	3300035086	Ga0373934_0027954	Ga0373934_0027954_1432_2079	206
368	3300035111	Ga0373923_0093756	Ga0373923_0093756_338_985	206
369	3300035112	Ga0373932_0066205	Ga0373932_0066205_326_952	206
370	3300035113	Ga0373936_0005754	Ga0373936_0005754_2413_3060	206
371	3300035115	Ga0373941_0004697	Ga0373941_0004697_1372_1995	206
372	3300035117	Ga0373953_0011279	Ga0373953_0011279_1256_1903	206
373	3300035118	Ga0373954_0019260	Ga0373954_0019260_294_941	206
374	3300035118	Ga0373954_0020395	Ga0373954_0020395_853_1500	206
375	3300035119	Ga0373956_0196129	Ga0373956_0196129_178_825	206
376	3300035119	Ga0373956_0228501	Ga0373956_0228501_59_706	206
377	3300035120	Ga0373957_0018491	Ga0373957_0018491_474_1121	206
378	3300035120	Ga0373957_0259971	Ga0373957_0259971_46_693	206
379	3300035171	Ga0373946_0028870	Ga0373946_0028870_1438_2085	206
380	3300035172	Ga0373955_0010403	Ga0373955_0010403_73_720	206
381	3300035410	Ga0373924_0025636	Ga0373924_0025636_181_828	206
382	3300035691	Ga0373931_0048267	Ga0373931_0048267_667_1293	206
383	3300035724	Ga0373933_0025147	Ga0373933_0025147_185_832	206
384	3300035724	Ga0373933_0191780	Ga0373933_0191780_486_1133	206
385	3300035725	Ga0373947_0119922	Ga0373947_0119922_473_1120	206
386	3300036401	Ga0373937_0144217	Ga0373937_0144217_178_825	206
387	3300036401	Ga0373937_0508483	Ga0373937_0508483_413_1060	206
388	3300044683	Ga0466965_0087201	Ga0466965_0087201_263_886	206
389	3300044706	Ga0466964_0018470	Ga0466964_0018470_921_1547	206
390	3300044842	Ga0466957_0063677	Ga0466957_0063677_573_1199	206
391	3300045051	Ga0451576_0033625	Ga0451576_0033625_2913_3539	206
392	3300045976	Ga0466967_0001149	Ga0466967_0001149_10331_10957	206
393	3300046454	Ga0495592_0001120	Ga0495592_0001120_9088_9735	206
394	3300046454	Ga0495592_0056837	Ga0495592_0056837_2047_2694	206
395	3300046454	Ga0495592_0146955	Ga0495592_0146955_131_778	206
396	3300046461	Ga0495641_0011876	Ga0495641_0011876_4237_4884	206
397	3300046462	Ga0495651_0172049	Ga0495651_0172049_295_942	206
398	3300046463	Ga0495653_0061115	Ga0495653_0061115_413_1060	206
399	3300046472	Ga0495580_0022988	Ga0495580_0022988_2863_3510	206
400	3300046475	Ga0495639_0089619	Ga0495639_0089619_131_778	206
401	3300046477	Ga0495664_0002269	Ga0495664_0002269_9214_9861	206
402	3300046511	Ga0495608_0049910	Ga0495608_0049910_1075_1722	206
403	3300046511	Ga0495608_0328141	Ga0495608_0328141_178_825	206
404	3300046514	Ga0495618_0045889	Ga0495618_0045889_132_779	206
405	3300046516	Ga0495628_0000904	Ga0495628_0000904_26443_27090	206
406	3300046516	Ga0495628_0022309	Ga0495628_0022309_2173_2820	206
407	3300046517	Ga0495630_0172628	Ga0495630_0172628_843_1490	206
408	3300046525	Ga0495663_0197121	Ga0495663_0197121_30_653	206
409	3300046528	Ga0495642_0070629	Ga0495642_0070629_237_860	206
410	3300046529	Ga0495652_0005891	Ga0495652_0005891_5830_6477	206
411	3300046529	Ga0495652_0079136	Ga0495652_0079136_1414_2061	206
412	3300046529	Ga0495652_0115055	Ga0495652_0115055_303_950	206
413	3300046533	Ga0495640_0159615	Ga0495640_0159615_132_779	206
414	3300046535	Ga0495586_0058071	Ga0495586_0058071_132_779	206
415	3300046535	Ga0495586_0278705	Ga0495586_0278705_132_779	206
416	3300046536	Ga0495587_0013022	Ga0495587_0013022_2189_2836	206
417	3300046536	Ga0495587_0339886	Ga0495587_0339886_115_762	206
418	3300046543	Ga0495645_0000272	Ga0495645_0000272_14339_14986	206
419	3300046559	Ga0495667_0260232	Ga0495667_0260232_181_828	206
420	3300046559	Ga0495667_0364237	Ga0495667_0364237_85_732	206
421	3300046642	Ga0495634_0045760	Ga0495634_0045760_906_1553	206
422	3300046663	Ga0495635_0052360	Ga0495635_0052360_1968_2615	206
423	3300046675	Ga0495657_0250110	Ga0495657_0250110_240_887	206
424	3300046678	Ga0495599_0001029	Ga0495599_0001029_7149_7796	206
425	3300046678	Ga0495599_0010568	Ga0495599_0010568_2916_3563	206
426	3300046681	Ga0495647_0015767	Ga0495647_0015767_131_778	206
427	3300046681	Ga0495647_0033019	Ga0495647_0033019_1127_1774	206
428	3300046683	Ga0495658_0034045	Ga0495658_0034045_2015_2662	206
429	3300046684	Ga0495669_0004956	Ga0495669_0004956_4133_4756	206
430	3300047317	Ga0495604_0329717	Ga0495604_0329717_178_825	206
431	3300047319	Ga0495674_0008936	Ga0495674_0008936_6398_7045	206
432	3300047322	Ga0495680_0146734	Ga0495680_0146734_476_1123	206
433	3300047444	Ga0495675_0005852	Ga0495675_0005852_5408_6055	206
434	3300047471	Ga0495684_0113250	Ga0495684_0113250_1205_1852	206
435	3300048089	Ga0495614_0130750	Ga0495614_0130750_320_967	206
436	3300048924	Ga0496121_0007521	Ga0496121_0007521_8874_9566	206
437	3300049568	Ga0501031_0283026	Ga0501031_0283026_312_941	206
438	3300049571	Ga0501034_0012117	Ga0501034_0012117_393_1013	206
439	3300049572	Ga0501036_0717101	Ga0501036_0717101_132_758	206
440	3300049573	Ga0501037_0212708	Ga0501037_0212708_417_1037	206
441	3300049575	Ga0501039_0110288	Ga0501039_0110288_286_915	206
442	3300049582	Ga0501048_0052733	Ga0501048_0052733_1856_2485	206
443	3300049582	Ga0501048_0121456	Ga0501048_0121456_79_705	206
444	3300049584	Ga0501068_0004380	Ga0501068_0004380_1132_1752	206
445	3300049586	Ga0501070_0065697	Ga0501070_0065697_618_1238	206
446	3300049587	Ga0501071_0922270	Ga0501071_0922270_19_645	206
447	3300049589	Ga0501073_0001128	Ga0501073_0001128_1880_2500	206
448	3300049590	Ga0501074_0038393	Ga0501074_0038393_1218_1838	206
449	3300049590	Ga0501074_0474421	Ga0501074_0474421_132_761	206
450	3300049591	Ga0501075_0025905	Ga0501075_0025905_2601_3230	206
451	3300049592	Ga0501076_0044220	Ga0501076_0044220_1034_1663	206
452	3300049593	Ga0501077_0296850	Ga0501077_0296850_59_679	206
453	3300049661	Ga0501217_049167	Ga0501217_049167_343_966	206
454	3300049741	Ga0501079_0430337	Ga0501079_0430337_191_817	206
455	3300049742	Ga0501080_0000288	Ga0501080_0000288_22516_23136	206
456	3300049742	Ga0501080_0737454	Ga0501080_0737454_129_749	206
457	3300049743	Ga0501081_0020734	Ga0501081_0020734_366_995	206
458	3300049824	Ga0501045_0443802	Ga0501045_0443802_283_909	206
459	3300050507	nmdc:mga05p37_453_c1	nmdc:mga05p37_453_c1_13964_14590	206
460	3300050508	nmdc:mga09592_1204_c1	nmdc:mga09592_1204_c1_1348_1974	206
461	3300050509	nmdc:mga0qj67_2672_c1	nmdc:mga0qj67_2672_c1_9424_10050	206
462	3300050510	nmdc:mga06r32_147484_c1	nmdc:mga06r32_147484_c1_947_1573	206
463	3300050511	nmdc:mga08y16_4362_c1	nmdc:mga08y16_4362_c1_9396_10022	206
464	3300050511	nmdc:mga08y16_8215_c1	nmdc:mga08y16_8215_c1_2465_3091	206
465	3300050512	nmdc:mga0n895_32044_c1	nmdc:mga0n895_32044_c1_767_1393	206
466	3300050512	nmdc:mga0n895_32810_c1	nmdc:mga0n895_32810_c1_1725_2348	206
467	3300050513	nmdc:mga0rr50_3029_c1	nmdc:mga0rr50_3029_c1_2171_2797	206
468	3300050514	nmdc:mga08x19_39004_c1	nmdc:mga08x19_39004_c1_881_1504	206
469	3300050514	nmdc:mga08x19_548_c1	nmdc:mga08x19_548_c1_1389_2015	206
470	3300050515	nmdc:mga0a205_1234_c1	nmdc:mga0a205_1234_c1_767_1393	206
471	3300050515	nmdc:mga0a205_6478_c1	nmdc:mga0a205_6478_c1_9718_10341	206
472	3300053077	Ga0495601_0017753	Ga0495601_0017753_3523_4170	206
473	3300053077	Ga0495601_0116913	Ga0495601_0116913_815_1462	206
474	3300053077	Ga0495601_0461476	Ga0495601_0461476_131_778	206
475	3300053084	Ga0495595_0004520	Ga0495595_0004520_1781_2428	206
476	3300053085	Ga0495619_0048821	Ga0495619_0048821_2011_2658	206
477	3300053085	Ga0495619_0481300	Ga0495619_0481300_76_723	206
478	3300053131	Ga0500652_145689	Ga0500652_145689_196_906	206
479	3300053153	Ga0500616_0175640	Ga0500616_0175640_150_773	206
480	3300054114	Ga0501084_0148291	Ga0501084_0148291_844_1464	206
481	3300061734	Ga0530510_0068528	Ga0530510_0068528_580_1209	206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

38

111

0.93 PF00043

GST_C

Glutathione S-transferase, C-terminal domain

139

226

0.92 PF02798

GST_N

Glutathione S-transferase, N-terminal domain

30

110

0.92 PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

156

221

0.87 PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

33

114

0.86 PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

142

230

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5hfk-assembly1.cif.gz_B	crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione	0.9878	1	201
3gx0-assembly1.cif.gz_A-2	crystal structure of gsh-dependent disulfide bond oxidoreductase	0.9833	1	201
4l8e-assembly1.cif.gz_A-2	crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit	0.9732	3	200
6tah-assembly1.cif.gz_CAA	crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione	0.9726	1	204
4ecj-assembly1.cif.gz_B	crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione	0.9701	1	204

ID	Description	Score	Start	End	Superfamily
af_P77526_87_192_1.20.1050.10	Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;	0.9897	86	189	1.20.1050.10
af_P77526_93_209_1.20.1050.130	Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;	0.9873	93	201	1.20.1050.130
4ikhA01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9852	2	85	3.40.30.10
4l8eA01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9829	3	84	3.40.30.10
4mf6A01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9823	2	85	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A523FIZ1-F1-model_v4	Glutathione S-transferase family protein	0.9993	1	71	GO:0016740
AF-A0A536Y920-F1-model_v4	Glutathione S-transferase family protein	0.9987	1	203	GO:0016740
AF-A0A522VNS2-F1-model_v4	Glutathione S-transferase family protein	0.9956	1	164	GO:0016740
AF-A0A2N2ULG0-F1-model_v4	Glutathione S-transferase	0.9942	1	187	GO:0016740
AF-A0A2S6TNY2-F1-model_v4	Disulfide-bond oxidoreductase YfcG (EC 1.8.4.-)	0.9937	2	119	GO:0016491

Feature Viewer

pLDDT	pTM	Quality
96.77	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F452354

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

38

111

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

139

226

0.92

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

30

110

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

156

221

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

33

114

0.86

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

142

230

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map