F452328

General Info

Members Datasets Scaffolds Average Seq Length
480 258 458 303

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842134933|2842137984
Length 338
Sequence RLFLRLVDLLPLPSLRVQRAIAIAVILTQGGISVTGAIVRVTASGLGCPTWPQCFPGSFTPVPHAEVPGIHQAVEFGNRLITFLVVLTAAAAVLAVTRARRRREVLVYAWLMPASTVAQAVIGGVTVLTGLLWWTVAIHLLVSMAMVWLAVLLFVKIGEPDGGTPVRTVPKPLRQLTLLSAATLSAVLVTGTLVTGAGPHAGDKSIEQPVPRLQVEITTLVHLHSSLLIAYLSLLVALGFALLAVRAPRPVLIRLGVLIGIAAAQGMVGAVQFVTGVPAALVAVHVAGAAACTAATAALWASMRQRTETEALERDLDGDGEVALAVRTRGGVELPPTQ

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
8 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
9 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
10 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
11 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
12 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
13 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
14 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
15 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
16 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
17 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
18 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
19 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
20 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
21 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
24 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0
Isolates 4.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 11.67
Nodule 0.21
Rhizoplane 12.29
Rhizosphere 64.38
Stem 0
Stem Tuber 0
Unclassified 11.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10008737 3300001990 Bacteria 3382
2 JGI24743J22301_10010442 3300001991 Bacteria 1659
3 JGI24745J21846_1003885 3300002073 Bacteria 1580
4 JGI24744J21845_10002813 3300002077 Bacteria 3558
5 JGI24744J21845_10009273 3300002077 Bacteria 2020
6 Ga0055540_1000036 3300003792 Bacteria 164285
7 Ga0055540_1002615 3300003792 Bacteria 9360
8 Ga0055540_1004452 3300003792 Bacteria 6298
9 Ga0055540_1009783 3300003792 Bacteria 3267
10 Ga0070680_100208356 3300005336 Bacteria 1649
11 Ga0068868_100009943 3300005338 Bacteria 6871
12 Ga0068868_100355893 3300005338 Bacteria 1255
13 Ga0070660_100258417 3300005339 Bacteria 1422
14 Ga0070687_100032906 3300005343 Bacteria 2555
15 Ga0070692_10145624 3300005345 Bacteria 1345
16 Ga0070668_100020690 3300005347 Bacteria 4968
17 Ga0070668_100050667 3300005347 Bacteria 3197
18 Ga0070669_100001013 3300005353 Bacteria 20451
19 Ga0070675_100072821 3300005354 Bacteria 2852
20 Ga0070671_100014731 3300005355 Bacteria 6320
21 Ga0070671_100050906 3300005355 Bacteria 3445
22 Ga0070674_100005751 3300005356 Bacteria 7195
23 Ga0070688_100004006 3300005365 Bacteria 7638
24 Ga0070667_100000034 3300005367 Bacteria 173652
25 Ga0070667_100005191 3300005367 Bacteria 10885
26 Ga0070667_100064181 3300005367 Bacteria 3115
27 Ga0070710_10021426 3300005437 Bacteria 3369
28 Ga0070711_100023015 3300005439 Bacteria 4046
29 Ga0070705_100243279 3300005440 Bacteria 1258
30 Ga0070700_100002872 3300005441 Bacteria 8849
31 Ga0070700_100103047 3300005441 Bacteria 1884
32 Ga0070694_100061686 3300005444 Bacteria 2559
33 Ga0070663_100037098 3300005455 Bacteria 3391
34 Ga0070678_100009222 3300005456 Bacteria 5962
35 Ga0070678_100053167 3300005456 Bacteria 2944
36 Ga0070678_100143382 3300005456 Bacteria 1914
37 Ga0070662_100249425 3300005457 Bacteria 1426
38 Ga0070686_100020735 3300005544 Bacteria 3894
39 Ga0070696_100010246 3300005546 Bacteria 6274
40 Ga0070693_100034329 3300005547 Bacteria 2806
41 Ga0070665_100003530 3300005548 Bacteria 16627
42 Ga0070665_100052528 3300005548 Bacteria 4086
43 Ga0070665_100072425 3300005548 Bacteria 3454
44 Ga0070704_100002510 3300005549 Bacteria 10325
45 Ga0068854_100001379 3300005578 Bacteria 14624
46 Ga0070702_100204938 3300005615 Bacteria 1308
47 Ga0068859_100001610 3300005617 Bacteria 23071
48 Ga0068859_100021637 3300005617 Bacteria 6453
49 Ga0068864_100020617 3300005618 Bacteria 5514
50 Ga0068866_10012750 3300005718 Bacteria 3668
51 Ga0068866_10016000 3300005718 Bacteria 3344
52 Ga0068861_100001141 3300005719 Bacteria 16538
53 Ga0068870_10125829 3300005840 Bacteria 1482
54 Ga0068863_100001973 3300005841 Bacteria 20398
55 Ga0068863_100012366 3300005841 Bacteria 8243
56 Ga0068858_100020326 3300005842 Bacteria 6210
57 Ga0068858_100054164 3300005842 Bacteria 3709
58 Ga0068858_100218862 3300005842 Bacteria 1803
59 Ga0068860_100000011 3300005843 Bacteria 328172
60 Ga0068860_100000586 3300005843 Bacteria 43627
61 Ga0068862_100000012 3300005844 Bacteria 267598
62 Ga0068862_100223248 3300005844 Bacteria 1706
63 Ga0081455_10162689 3300005937 Bacteria 1709
64 Ga0081455_10234322 3300005937 Bacteria 1353
65 Ga0075365_10009455 3300006038 Bacteria 5605
66 Ga0075365_10087013 3300006038 Bacteria 2124
67 Ga0075365_10315400 3300006038 Bacteria 1101
68 Ga0075363_100005058 3300006048 Bacteria 5831
69 Ga0075363_100005895 3300006048 Bacteria 5516
70 Ga0075363_100010635 3300006048 Bacteria 4379
71 Ga0075364_10010561 3300006051 Bacteria 5583
72 Ga0075364_10013683 3300006051 Bacteria 4997
73 Ga0075364_10033276 3300006051 Bacteria 3318
74 Ga0075364_10296973 3300006051 Bacteria 1099
75 Ga0070716_100008822 3300006173 Bacteria 5010
76 Ga0070716_100031081 3300006173 Bacteria 2902
77 Ga0070712_100002108 3300006175 Bacteria 12219
78 Ga0070712_100006478 3300006175 Bacteria 7262
79 Ga0070712_100150217 3300006175 Bacteria 1788
80 Ga0075362_10071850 3300006177 Bacteria 1582
81 Ga0075369_10000918 3300006186 Bacteria 9755
82 Ga0075369_10000938 3300006186 Bacteria 9697
83 Ga0075369_10003188 3300006186 Bacteria 5950
84 Ga0075369_10070992 3300006186 Bacteria 1532
85 Ga0075369_10071139 3300006186 Bacteria 1531
86 Ga0075370_10008421 3300006353 Bacteria 5309
87 Ga0075370_10011326 3300006353 Bacteria 4683
88 Ga0068871_100313885 3300006358 Bacteria 1379
89 Ga0075428_100075949 3300006844 Bacteria 3668
90 Ga0075430_100026681 3300006846 Bacteria 4913
91 Ga0075430_100140933 3300006846 Bacteria 2008
92 Ga0068865_100001469 3300006881 Bacteria 13725
93 Ga0068865_100122144 3300006881 Bacteria 1938
94 Ga0097620_100001610 3300006931 Bacteria 23071
95 Ga0097620_100021637 3300006931 Bacteria 6453
96 Ga0105245_10047419 3300009098 Bacteria 3841
97 Ga0105247_10000007 3300009101 Bacteria 409490
98 Ga0105247_10013251 3300009101 Bacteria 4947
99 Ga0114129_10021108 3300009147 Bacteria 9247
100 Ga0105243_10000549 3300009148 Bacteria 37936
101 Ga0105243_10129809 3300009148 Bacteria 2136
102 Ga0105241_10022457 3300009174 Bacteria 4674
103 Ga0105241_10079313 3300009174 Bacteria 2567
104 Ga0105242_10003330 3300009176 Bacteria 12494
105 Ga0105248_10000040 3300009177 Bacteria 172452
106 Ga0105248_10010707 3300009177 Bacteria 10122
107 Ga0105248_10091454 3300009177 Bacteria 3427
108 Ga0105237_10000298 3300009545 Bacteria 68533
109 Ga0105237_10030280 3300009545 Bacteria 5499
110 Ga0105237_10069381 3300009545 Bacteria 3520
111 Ga0105237_10209888 3300009545 Bacteria 1947
112 Ga0105249_10000001 3300009553 Bacteria 504948
113 Ga0105249_10004974 3300009553 Bacteria 11464
114 Ga0105249_10010996 3300009553 Bacteria 7951
115 Ga0105249_10774758 3300009553 Bacteria 1022
116 Ga0105239_10006015 3300010375 Bacteria 14118
117 Ga0105239_10032449 3300010375 Bacteria 5738
118 Ga0105246_10067008 3300011119 Bacteria 2515
119 Ga0157369_10217672 3300013105 Bacteria 2000
120 Ga0157378_10007001 3300013297 Bacteria 9841
121 Ga0163162_10002303 3300013306 Bacteria 17917
122 Ga0163162_10173234 3300013306 Bacteria 2283
123 Ga0163162_10197060 3300013306 Bacteria 2143
124 Ga0157372_10011899 3300013307 Bacteria 9271
125 Ga0157375_10003698 3300013308 Bacteria 13279
126 Ga0157375_10244722 3300013308 Bacteria 1953
127 Ga0163163_10019801 3300014325 Bacteria 6328
128 Ga0163163_10074710 3300014325 Bacteria 3382
129 Ga0163163_10653386 3300014325 Bacteria 1115
130 Ga0157380_10017301 3300014326 Bacteria 5334
131 Ga0157380_10296709 3300014326 Bacteria 1487
132 Ga0157377_10007419 3300014745 Bacteria 5294
133 Ga0157379_10002847 3300014968 Bacteria 14589
134 Ga0213876_10017797 3300021384 Bacteria 3750
135 Ga0213876_10021672 3300021384 Bacteria 3398
136 Ga0213876_10085443 3300021384 Bacteria 1670
137 Ga0213875_10027927 3300021388 Bacteria 2684
138 Ga0209673_1010251 3300025273 Bacteria 3966
139 Ga0209051_1000021 3300025303 Bacteria 507633
140 Ga0209051_1001744 3300025303 Bacteria 17334
141 Ga0209051_1005309 3300025303 Bacteria 7583
142 Ga0209051_1007574 3300025303 Bacteria 5912
143 Ga0209051_1033675 3300025303 Bacteria 1933
144 Ga0207696_1055257 3300025711 Bacteria 1127
145 Ga0207692_10004759 3300025898 Bacteria 5393
146 Ga0207710_10000013 3300025900 Bacteria 409402
147 Ga0207710_10014822 3300025900 Bacteria 3292
148 Ga0207688_10000890 3300025901 Bacteria 15093
149 Ga0207688_10043011 3300025901 Bacteria 2515
150 Ga0207688_10106068 3300025901 Bacteria 1627
151 Ga0207680_10076092 3300025903 Bacteria 2095
152 Ga0207647_10019431 3300025904 Bacteria 4570
153 Ga0207647_10181288 3300025904 Bacteria 1223
154 Ga0207685_10074665 3300025905 Bacteria 1385
155 Ga0207643_10161141 3300025908 Bacteria 1350
156 Ga0207671_10006972 3300025914 Bacteria 9919
157 Ga0207671_10209727 3300025914 Bacteria 1523
158 Ga0207671_10270499 3300025914 Bacteria 1339
159 Ga0207693_10000569 3300025915 Bacteria 33235
160 Ga0207693_10003512 3300025915 Bacteria 13384
161 Ga0207663_10014839 3300025916 Bacteria 4280
162 Ga0207663_10045978 3300025916 Bacteria 2688
163 Ga0207663_10169585 3300025916 Bacteria 1549
164 Ga0207660_10115917 3300025917 Bacteria 2023
165 Ga0207657_10007393 3300025919 Bacteria 11268
166 Ga0207681_10006132 3300025923 Bacteria 7374
167 Ga0207681_10106788 3300025923 Bacteria 2029
168 Ga0207681_10144281 3300025923 Bacteria 1777
169 Ga0207659_10116119 3300025926 Bacteria 2043
170 Ga0207687_10000148 3300025927 Bacteria 46835
171 Ga0207664_10400855 3300025929 Bacteria 1220
172 Ga0207644_10011623 3300025931 Bacteria 5830
173 Ga0207644_10172342 3300025931 Bacteria 1690
174 Ga0207644_10219527 3300025931 Bacteria 1506
175 Ga0207690_10246304 3300025932 Bacteria 1378
176 Ga0207706_10008187 3300025933 Bacteria 9643
177 Ga0207706_10114139 3300025933 Bacteria 2376
178 Ga0207686_10010447 3300025934 Bacteria 5056
179 Ga0207709_10008353 3300025935 Bacteria 5731
180 Ga0207669_10279939 3300025937 Bacteria 1257
181 Ga0207704_10029369 3300025938 Bacteria 3065
182 Ga0207665_10008564 3300025939 Bacteria 6731
183 Ga0207665_10015816 3300025939 Bacteria 4952
184 Ga0207665_10182925 3300025939 Bacteria 1519
185 Ga0207691_10209014 3300025940 Bacteria 1696
186 Ga0207691_10311955 3300025940 Bacteria 1350
187 Ga0207711_10000209 3300025941 Bacteria 62724
188 Ga0207711_10105682 3300025941 Bacteria 2497
189 Ga0207689_10026812 3300025942 Bacteria 4825
190 Ga0207667_10588826 3300025949 Bacteria 1122
191 Ga0207712_10000006 3300025961 Bacteria 573204
192 Ga0207712_10002137 3300025961 Bacteria 12921
193 Ga0207668_10006104 3300025972 Bacteria 7106
194 Ga0207668_10013864 3300025972 Bacteria 4977
195 Ga0207640_10027617 3300025981 Bacteria 3460
196 Ga0207640_10076003 3300025981 Bacteria 2278
197 Ga0207658_10003623 3300025986 Bacteria 10910
198 Ga0207658_10004474 3300025986 Bacteria 9716
199 Ga0207658_10016040 3300025986 Bacteria 5146
200 Ga0207658_10016567 3300025986 Bacteria 5072
201 Ga0207658_10089155 3300025986 Bacteria 2387
202 Ga0207677_10000713 3300026023 Bacteria 19639
203 Ga0207677_10072324 3300026023 Bacteria 2437
204 Ga0207703_10007840 3300026035 Bacteria 8447
205 Ga0207703_10018614 3300026035 Bacteria 5424
206 Ga0207703_10029692 3300026035 Bacteria 4315
207 Ga0207703_10192860 3300026035 Bacteria 1806
208 Ga0207678_10005836 3300026067 Bacteria 10975
209 Ga0207678_10131330 3300026067 Bacteria 2136
210 Ga0207678_10217521 3300026067 Bacteria 1635
211 Ga0207708_10002975 3300026075 Bacteria 12488
212 Ga0207708_10011208 3300026075 Bacteria 6672
213 Ga0207641_10000692 3300026088 Bacteria 36370
214 Ga0207641_10016551 3300026088 Bacteria 6038
215 Ga0207648_10005356 3300026089 Bacteria 12936
216 Ga0207648_10134356 3300026089 Bacteria 2178
217 Ga0207676_10019924 3300026095 Bacteria 4900
218 Ga0207675_100002109 3300026118 Bacteria 19705
219 Ga0207675_100063136 3300026118 Bacteria 3461
220 Ga0207675_100280944 3300026118 Bacteria 1618
221 Ga0207675_100384336 3300026118 Bacteria 1381
222 Ga0207683_10001695 3300026121 Bacteria 19719
223 Ga0207698_10048784 3300026142 Bacteria 3217
224 Ga0268266_10005616 3300028379 Bacteria 11649
225 Ga0268266_10030273 3300028379 Bacteria 4600
226 Ga0268266_10038696 3300028379 Bacteria 4060
227 Ga0268266_10156352 3300028379 Bacteria 2060
228 Ga0268266_10431322 3300028379 Bacteria 1250
229 Ga0268265_10000016 3300028380 Bacteria 299380
230 Ga0268265_10098764 3300028380 Bacteria 2352
231 Ga0268265_10100417 3300028380 Bacteria 2335
232 Ga0268264_10000026 3300028381 Bacteria 459088
233 Ga0265327_10000081 3300031251 Bacteria 205988
234 Ga0265327_10013302 3300031251 Bacteria 5474
235 Ga0265327_10052224 3300031251 Bacteria 2129
236 Ga0307513_10046649 3300031456 Bacteria 4720
237 Ga0307405_10137743 3300031731 Bacteria 1697
238 Ga0307413_10066532 3300031824 Bacteria 2249
239 Ga0307409_100013856 3300031995 Bacteria 5214
240 Ga0307409_100422011 3300031995 Bacteria 1280
241 Ga0307415_100046210 3300032126 Bacteria 2924
242 Ga0316585_10048933 3300032137 Bacteria 1355
243 Ga0373932_0012740 3300035112 Bacteria 2077
244 Ga0373961_0030729 3300035241 Bacteria 1496
245 Ga0373931_0001728 3300035691 Bacteria 9462
246 Ga0316584_0080615 3300036712 Bacteria 2438
247 Ga0436364_0508354 3300037853 Bacteria 26019
248 Ga0436365_0079327 3300039437 Bacteria 10236
249 Ga0436365_0476482 3300039437 Bacteria 23188
250 Ga0436365_1578370 3300039437 Bacteria 10482
251 Ga0436365_1667107 3300039437 Bacteria 5620
252 Ga0436360_0369847 3300039438 Bacteria 1193
253 Ga0436363_1713773 3300039450 Bacteria 3722
254 Ga0439461_0007386 3300041410 Bacteria 1945
255 Ga0439466_0028693 3300041411 Bacteria 1919
256 Ga0451802_0378596 3300041460 Bacteria 2845
257 Ga0439442_009425 3300042002 Bacteria 1975
258 Ga0466972_0006019 3300044658 Bacteria 6095
259 Ga0466972_0022393 3300044658 Bacteria 3147
260 Ga0466972_0114078 3300044658 Bacteria 1276
261 Ga0466965_0000295 3300044683 Bacteria 16493
262 Ga0466965_0023286 3300044683 Bacteria 2990
263 Ga0466965_0106943 3300044683 Bacteria 1435
264 Ga0466966_0002419 3300044684 Bacteria 12198
265 Ga0466961_0006211 3300044693 Bacteria 7589
266 Ga0466971_0015143 3300044719 Bacteria 3393
267 Ga0466971_0051278 3300044719 Bacteria 1857
268 Ga0466968_0000717 3300044735 Bacteria 11466
269 Ga0466968_0024034 3300044735 Bacteria 2488
270 Ga0466970_0030193 3300044765 Bacteria 2857
271 Ga0466970_0030304 3300044765 Bacteria 2852
272 Ga0466970_0061320 3300044765 Bacteria 2015
273 Ga0466957_0009948 3300044842 Bacteria 5440
274 Ga0466957_0084401 3300044842 Bacteria 1982
275 Ga0466957_0096411 3300044842 Bacteria 1859
276 Ga0466957_0126776 3300044842 Bacteria 1631
277 Ga0466960_0032085 3300044901 Bacteria 2428
278 Ga0466959_0038158 3300045049 Bacteria 3549
279 Ga0466959_0077417 3300045049 Bacteria 2400
280 Ga0466959_0104215 3300045049 Bacteria 2029
281 Ga0466958_0021939 3300045836 Bacteria 3734
282 Ga0466958_0117424 3300045836 Bacteria 1663
283 Ga0466967_0003371 3300045976 Bacteria 10399
284 Ga0466967_0099863 3300045976 Bacteria 2651
285 Ga0466967_0154166 3300045976 Bacteria 2150
286 Ga0466967_0201818 3300045976 Bacteria 1884
287 Ga0466967_0367242 3300045976 Bacteria 1395
288 Ga0466967_0490466 3300045976 Bacteria 1205
289 Ga0495603_0016261 3300046455 Bacteria 4502
290 Ga0495638_0010590 3300046460 Bacteria 6389
291 Ga0495638_0074054 3300046460 Bacteria 2077
292 Ga0495641_0058237 3300046461 Bacteria 1748
293 Ga0495662_0027513 3300046476 Bacteria 2747
294 Ga0495630_0024249 3300046517 Bacteria 4487
295 Ga0495648_0001240 3300046524 Bacteria 25518
296 Ga0495640_0095859 3300046533 Bacteria 1952
297 Ga0495634_0085669 3300046642 Bacteria 2053
298 Ga0495581_0002659 3300047315 Bacteria 10165
299 Ga0495674_0116692 3300047319 Bacteria 2258
300 Ga0495672_0001370 3300047320 Bacteria 24098
301 Ga0495672_0014321 3300047320 Bacteria 5436
302 Ga0495676_0104155 3300047321 Bacteria 2094
303 Ga0495683_0000189 3300047323 Bacteria 59252
304 Ga0495673_0000415 3300047469 Bacteria 49621
305 Ga0495686_0006261 3300047472 Bacteria 9159
306 Ga0495593_0010117 3300047673 Bacteria 5458
307 Ga0496100_0000011 3300048903 Bacteria 190969
308 Ga0496100_0003705 3300048903 Bacteria 8006
309 Ga0496100_0007833 3300048903 Bacteria 5927
310 Ga0496100_0010522 3300048903 Bacteria 5239
311 Ga0496100_0017539 3300048903 Bacteria 4228
312 Ga0496101_0000011 3300048904 Bacteria 272153
313 Ga0496101_0000279 3300048904 Bacteria 36022
314 Ga0496101_0000439 3300048904 Bacteria 26573
315 Ga0496101_0001453 3300048904 Bacteria 14136
316 Ga0496101_0015888 3300048904 Bacteria 5080
317 Ga0496101_0106824 3300048904 Bacteria 2102
318 Ga0496102_0000012 3300048905 Bacteria 315470
319 Ga0496102_0001078 3300048905 Bacteria 25233
320 Ga0496102_0001404 3300048905 Bacteria 21366
321 Ga0496102_0012906 3300048905 Bacteria 7233
322 Ga0496102_0016994 3300048905 Bacteria 6367
323 Ga0496102_0105225 3300048905 Bacteria 2625
324 Ga0496103_0000005 3300048906 Bacteria 505416
325 Ga0496103_0000418 3300048906 Bacteria 37252
326 Ga0496103_0000765 3300048906 Bacteria 23745
327 Ga0496103_0002083 3300048906 Bacteria 12779
328 Ga0496104_0019880 3300048907 Bacteria 6150
329 Ga0496104_0072263 3300048907 Bacteria 3280
330 Ga0496104_0115473 3300048907 Bacteria 2576
331 Ga0496104_0172992 3300048907 Bacteria 2070
332 Ga0496105_0051169 3300048908 Bacteria 3413
333 Ga0496105_0296116 3300048908 Bacteria 1302
334 Ga0496106_0000676 3300048909 Bacteria 24433
335 Ga0496106_0003400 3300048909 Bacteria 11853
336 Ga0496106_0004651 3300048909 Bacteria 10178
337 Ga0496106_0056527 3300048909 Bacteria 2966
338 Ga0496106_0203532 3300048909 Bacteria 1576
339 Ga0496107_0001549 3300048910 Bacteria 14282
340 Ga0496107_0002904 3300048910 Bacteria 11326
341 Ga0496107_0094715 3300048910 Bacteria 2184
342 Ga0496107_0132010 3300048910 Bacteria 1844
343 Ga0496108_0000197 3300048911 Bacteria 55651
344 Ga0496108_0037838 3300048911 Bacteria 4020
345 Ga0496108_0060139 3300048911 Bacteria 3196
346 Ga0496108_0070176 3300048911 Bacteria 2957
347 Ga0496108_0342087 3300048911 Bacteria 1305
348 Ga0496109_0000179 3300048912 Bacteria 62857
349 Ga0496109_0000695 3300048912 Bacteria 28016
350 Ga0496109_0045196 3300048912 Bacteria 3995
351 Ga0496110_0021173 3300048913 Bacteria 5498
352 Ga0496110_0073179 3300048913 Bacteria 3041
353 Ga0496111_0045166 3300048914 Bacteria 3169
354 Ga0496111_0084227 3300048914 Bacteria 2324
355 Ga0496112_0075124 3300048915 Bacteria 3342
356 Ga0496112_0168569 3300048915 Bacteria 2155
357 Ga0496112_0491737 3300048915 Bacteria 1163
358 Ga0496113_0002537 3300048916 Bacteria 10645
359 Ga0496114_0000545 3300048917 Bacteria 27854
360 Ga0496114_0007633 3300048917 Bacteria 8554
361 Ga0496114_0299622 3300048917 Bacteria 1419
362 Ga0496115_0000399 3300048918 Bacteria 35785
363 Ga0496115_0108928 3300048918 Bacteria 2274
364 Ga0496115_0186629 3300048918 Bacteria 1713
365 Ga0496116_0000050 3300048919 Bacteria 311670
366 Ga0496116_0002785 3300048919 Bacteria 17965
367 Ga0496116_0029281 3300048919 Bacteria 3973
368 Ga0496117_0000042 3300048920 Bacteria 315470
369 Ga0496117_0000998 3300048920 Bacteria 43288
370 Ga0496117_0023030 3300048920 Bacteria 4977
371 Ga0496117_0110447 3300048920 Bacteria 1714
372 Ga0496118_0000037 3300048921 Bacteria 315470
373 Ga0496118_0001405 3300048921 Bacteria 36274
374 Ga0496118_0008804 3300048921 Bacteria 10341
375 Ga0496118_0015209 3300048921 Bacteria 7144
376 Ga0496119_0002814 3300048922 Bacteria 18617
377 Ga0496119_0005945 3300048922 Bacteria 11477
378 Ga0496119_0073937 3300048922 Bacteria 1986
379 Ga0496120_0000449 3300048923 Bacteria 65290
380 Ga0496120_0004500 3300048923 Bacteria 11663
381 Ga0496120_0023997 3300048923 Bacteria 3809
382 Ga0496121_0000014 3300048924 Bacteria 609379
383 Ga0496121_0000039 3300048924 Bacteria 351444
384 Ga0496122_0002141 3300048925 Bacteria 29009
385 Ga0496122_0012366 3300048925 Bacteria 8514
386 Ga0496123_0008243 3300048926 Bacteria 9608
387 Ga0496123_0010316 3300048926 Bacteria 8281
388 Ga0496124_0000019 3300048927 Bacteria 436995
389 Ga0496124_0010607 3300048927 Bacteria 9312
390 Ga0496125_0000014 3300048928 Bacteria 610124
391 Ga0496126_0000017 3300048929 Bacteria 610676
392 Ga0496126_0000236 3300048929 Bacteria 119350
393 Ga0496126_0006366 3300048929 Bacteria 13167
394 Ga0496126_0283564 3300048929 Bacteria 1371
395 Ga0495682_0086875 3300049460 Bacteria 1124
396 Ga0501032_0001236 3300049569 Bacteria 20498
397 Ga0501033_0020394 3300049570 Bacteria 5007
398 Ga0501034_0002932 3300049571 Bacteria 19775
399 Ga0501034_0023547 3300049571 Bacteria 6274
400 Ga0501036_0012412 3300049572 Bacteria 7058
401 Ga0501037_0000111 3300049573 Bacteria 75787
402 Ga0501037_0010254 3300049573 Bacteria 6877
403 Ga0501038_0000635 3300049574 Bacteria 31235
404 Ga0501039_0000326 3300049575 Bacteria 33921
405 Ga0501043_0000138 3300049579 Bacteria 67691
406 Ga0501043_0094312 3300049579 Bacteria 2353
407 Ga0501043_0279043 3300049579 Bacteria 1281
408 Ga0501047_0007470 3300049581 Bacteria 10288
409 Ga0501047_0058811 3300049581 Bacteria 3713
410 Ga0501047_0182343 3300049581 Bacteria 1966
411 Ga0501048_0013278 3300049582 Bacteria 6112
412 Ga0501067_0040414 3300049583 Bacteria 2591
413 Ga0501069_0011794 3300049585 Bacteria 4635
414 Ga0501069_0038833 3300049585 Bacteria 2629
415 Ga0501070_0000357 3300049586 Bacteria 41547
416 Ga0501070_0082830 3300049586 Bacteria 2655
417 Ga0501073_0008460 3300049589 Bacteria 7630
418 Ga0501080_0018907 3300049742 Bacteria 6380
419 Ga0501083_0061352 3300049744 Bacteria 2510
420 Ga0501035_0000595 3300049822 Bacteria 39851
421 Ga0501035_0009459 3300049822 Bacteria 9063
422 Ga0501035_0173460 3300049822 Bacteria 1862
423 Ga0501044_0001470 3300049823 Bacteria 27679
424 Ga0501044_0015220 3300049823 Bacteria 8285
425 nmdc:mga03n38_144831_c1 3300050490 Bacteria 1190
426 nmdc:mga03n38_146109_c1 3300050490 Bacteria 1186
427 nmdc:mga00v17_1135_c1 3300050491 Bacteria 13988
428 nmdc:mga00v17_1247_c1 3300050491 Bacteria 13325
429 nmdc:mga00v17_16249_c1 3300050491 Bacteria 4194
430 nmdc:mga00v17_17303_c1 3300050491 Bacteria 3789
431 nmdc:mga00v17_194013_c1 3300050491 Bacteria 1312
432 nmdc:mga0yw44_17814_c1 3300050492 Bacteria 3875
433 nmdc:mga0yw44_260380_c1 3300050492 Bacteria 1156
434 nmdc:mga0yw44_62348_c1 3300050492 Bacteria 2290
435 nmdc:mga0k408_133263_c1 3300050493 Bacteria 1475
436 nmdc:mga06z11_35087_c1 3300050494 Bacteria 2466
437 nmdc:mga07m45_24725_c1 3300050496 Bacteria 3292
438 nmdc:mga07m45_4058_c2 3300050496 Bacteria 6786
439 nmdc:mga07m45_61962_c1 3300050496 Bacteria 2119
440 nmdc:mga0qj67_133762_c1 3300050509 Bacteria 2009
441 nmdc:mga0qj67_4614_c1 3300050509 Bacteria 9994
442 nmdc:mga06r32_6190_c1 3300050510 Bacteria 10741
443 nmdc:mga0sz30_12184_c1 3300050516 Bacteria 3339
444 nmdc:mga0sz30_5651_c1 3300050516 Bacteria 2718
445 nmdc:mga0sz30_5941_c1 3300050516 Bacteria 4503
446 Ga0500635_0012042 3300053080 Bacteria 2473
447 Ga0500635_0033234 3300053080 Bacteria 1682
448 Ga0495619_0069978 3300053085 Bacteria 2346
449 Ga0500643_001809 3300053087 Bacteria 11698
450 Ga0500643_011290 3300053087 Bacteria 3266
451 Ga0500650_0135973 3300053098 Bacteria 1141
452 Ga0500608_081673 3300053122 Bacteria 1524
453 Ga0500616_0022316 3300053153 Bacteria 3536
454 Ga0500616_0022870 3300053153 Bacteria 3488
455 Ga0500627_0026044 3300053158 Bacteria 2410
456 Ga0500645_019256 3300053730 Bacteria 2124
457 Ga0466962_0005805 3300061719 Bacteria 5930
458 Ga0466962_0032774 3300061719 Bacteria 2486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0010316 Ga0496123_0010316_2103_3005 245
2 3300005355 Ga0070671_100014731 Ga0070671_1000147315 262
3 3300005548 Ga0070665_100003530 Ga0070665_1000035308 262
4 3300005841 Ga0068863_100012366 Ga0068863_1000123668 262
5 3300005842 Ga0068858_100218862 Ga0068858_1002188622 262
6 3300025931 Ga0207644_10011623 Ga0207644_100116234 262
7 3300026035 Ga0207703_10192860 Ga0207703_101928602 262
8 3300026088 Ga0207641_10016551 Ga0207641_100165514 262
9 3300028379 Ga0268266_10005616 Ga0268266_100056166 262
10 3300025986 Ga0207658_10016567 Ga0207658_100165674 263
11 3300006186 Ga0075369_10003188 Ga0075369_100031885 267
12 3300006038 Ga0075365_10087013 Ga0075365_100870133 268
13 3300048915 Ga0496112_0168569 Ga0496112_0168569_74_1045 268
14 3300048916 Ga0496113_0002537 Ga0496113_0002537_2162_3133 268
15 3300048925 Ga0496122_0012366 Ga0496122_0012366_7403_8374 268
16 3300050492 nmdc:mga0yw44_260380_c1 nmdc:mga0yw44_260380_c1_156_1136 268
17 3300013306 Ga0163162_10197060 Ga0163162_101970603 269
18 3300025901 Ga0207688_10106068 Ga0207688_101060682 269
19 3300048911 Ga0496108_0037838 Ga0496108_0037838_808_1734 269
20 3300053080 Ga0500635_0033234 Ga0500635_0033234_89_1045 269
21 3300045976 Ga0466967_0003371 Ga0466967_0003371_5383_6324 271
22 3300047323 Ga0495683_0000189 Ga0495683_0000189_16735_17724 272
23 3300006051 Ga0075364_10010561 Ga0075364_100105614 273
24 3300006051 Ga0075364_10296973 Ga0075364_102969731 273
25 3300014325 Ga0163163_10074710 Ga0163163_100747103 274
26 3300044842 Ga0466957_0096411 Ga0466957_0096411_782_1771 274
27 3300045976 Ga0466967_0099863 Ga0466967_0099863_1448_2437 274
28 3300046460 Ga0495638_0074054 Ga0495638_0074054_994_1950 276
29 3300053098 Ga0500650_0135973 Ga0500650_0135973_172_1128 276
30 3300053730 Ga0500645_019256 Ga0500645_019256_967_1923 276
31 3300032137 Ga0316585_10048933 Ga0316585_100489331 277
32 3300036712 Ga0316584_0080615 Ga0316584_0080615_219_1175 277
33 3300044719 Ga0466971_0051278 Ga0466971_0051278_859_1821 277
34 3300044842 Ga0466957_0084401 Ga0466957_0084401_437_1399 277
35 3300046455 Ga0495603_0016261 Ga0495603_0016261_1103_2059 277
36 3300046517 Ga0495630_0024249 Ga0495630_0024249_1979_2935 277
37 3300046533 Ga0495640_0095859 Ga0495640_0095859_80_1036 277
38 3300046642 Ga0495634_0085669 Ga0495634_0085669_566_1522 277
39 3300047315 Ga0495581_0002659 Ga0495581_0002659_3739_4695 277
40 3300047319 Ga0495674_0116692 Ga0495674_0116692_1024_1980 277
41 3300047320 Ga0495672_0014321 Ga0495672_0014321_2995_3951 277
42 3300047673 Ga0495593_0010117 Ga0495593_0010117_417_1373 277
43 3300048913 Ga0496110_0073179 Ga0496110_0073179_20_976 277
44 3300053085 Ga0495619_0069978 Ga0495619_0069978_1172_2128 277
45 3300053087 Ga0500643_011290 Ga0500643_011290_1414_2370 277
46 3300053158 Ga0500627_0026044 Ga0500627_0026044_812_1768 277
47 3300046461 Ga0495641_0058237 Ga0495641_0058237_698_1654 278
48 3300046476 Ga0495662_0027513 Ga0495662_0027513_1259_2215 278
49 3300047321 Ga0495676_0104155 Ga0495676_0104155_93_1049 278
50 3300048911 Ga0496108_0070176 Ga0496108_0070176_478_1386 279
51 3300048917 Ga0496114_0299622 Ga0496114_0299622_351_1259 279
52 3300053122 Ga0500608_081673 Ga0500608_081673_51_962 280
53 3300044683 Ga0466965_0000295 Ga0466965_0000295_4588_5532 281
54 3300050491 nmdc:mga00v17_17303_c1 nmdc:mga00v17_17303_c1_1806_2813 281
55 3300050491 nmdc:mga00v17_194013_c1 nmdc:mga00v17_194013_c1_71_1078 281
56 3300009545 Ga0105237_10069381 Ga0105237_100693812 283
57 3300031251 Ga0265327_10000081 Ga0265327_10000081158 283
58 3300044684 Ga0466966_0002419 Ga0466966_0002419_1591_2553 283
59 3300044693 Ga0466961_0006211 Ga0466961_0006211_770_1732 283
60 3300044842 Ga0466957_0009948 Ga0466957_0009948_3148_4110 283
61 3300045049 Ga0466959_0077417 Ga0466959_0077417_1299_2261 283
62 3300045836 Ga0466958_0021939 Ga0466958_0021939_2029_2991 283
63 3300005353 Ga0070669_100001013 Ga0070669_1000010138 284
64 3300005367 Ga0070667_100000034 Ga0070667_100000034178 284
65 3300005548 Ga0070665_100072425 Ga0070665_1000724253 284
66 3300005617 Ga0068859_100001610 Ga0068859_1000016103 284
67 3300005841 Ga0068863_100001973 Ga0068863_1000019739 284
68 3300005842 Ga0068858_100020326 Ga0068858_1000203265 284
69 3300005843 Ga0068860_100000011 Ga0068860_100000011223 284
70 3300005844 Ga0068862_100000012 Ga0068862_100000012194 284
71 3300006931 Ga0097620_100001610 Ga0097620_10000161023 284
72 3300009101 Ga0105247_10000007 Ga0105247_10000007220 284
73 3300009177 Ga0105248_10000040 Ga0105248_1000004025 284
74 3300009553 Ga0105249_10000001 Ga0105249_10000001266 284
75 3300014325 Ga0163163_10019801 Ga0163163_100198012 284
76 3300025900 Ga0207710_10000013 Ga0207710_10000013220 284
77 3300025923 Ga0207681_10006132 Ga0207681_100061326 284
78 3300025941 Ga0207711_10000209 Ga0207711_1000020942 284
79 3300025961 Ga0207712_10000006 Ga0207712_10000006226 284
80 3300025986 Ga0207658_10016040 Ga0207658_100160403 284
81 3300026035 Ga0207703_10007840 Ga0207703_100078404 284
82 3300026088 Ga0207641_10000692 Ga0207641_1000069227 284
83 3300028379 Ga0268266_10030273 Ga0268266_100302734 284
84 3300028380 Ga0268265_10000016 Ga0268265_10000016218 284
85 3300028381 Ga0268264_10000026 Ga0268264_10000026221 284
86 3300031251 Ga0265327_10052224 Ga0265327_100522241 284
87 3300048903 Ga0496100_0003705 Ga0496100_0003705_6693_7652 284
88 3300048904 Ga0496101_0001453 Ga0496101_0001453_8608_9567 284
89 3300048905 Ga0496102_0001404 Ga0496102_0001404_15781_16740 284
90 3300048905 Ga0496102_0016994 Ga0496102_0016994_4855_5835 284
91 3300048906 Ga0496103_0000765 Ga0496103_0000765_9689_10648 284
92 3300048907 Ga0496104_0019880 Ga0496104_0019880_4537_5517 284
93 3300048908 Ga0496105_0051169 Ga0496105_0051169_1307_2287 284
94 3300048919 Ga0496116_0029281 Ga0496116_0029281_2280_3239 284
95 3300048920 Ga0496117_0000998 Ga0496117_0000998_36909_37868 284
96 3300048921 Ga0496118_0008804 Ga0496118_0008804_8468_9427 284
97 3300006051 Ga0075364_10013683 Ga0075364_100136835 285
98 3300006186 Ga0075369_10000938 Ga0075369_100009387 285
99 3300025711 Ga0207696_1055257 Ga0207696_10552571 285
100 3300049586 Ga0501070_0082830 Ga0501070_0082830_744_1757 285
101 3300005367 Ga0070667_100064181 Ga0070667_1000641812 286
102 3300021384 Ga0213876_10085443 Ga0213876_100854432 287
103 3300039437 Ga0436365_1667107 Ga0436365_1667107_425_1345 287
104 iso_pu_bacteria 2775506925 2776372106 287
105 3300005367 Ga0070667_100005191 Ga0070667_1000051916 288
106 3300006175 Ga0070712_100150217 Ga0070712_1001502172 288
107 3300021388 Ga0213875_10027927 Ga0213875_100279273 288
108 3300025986 Ga0207658_10003623 Ga0207658_100036236 288
109 3300031251 Ga0265327_10013302 Ga0265327_100133024 288
110 3300048903 Ga0496100_0000011 Ga0496100_0000011_159964_160893 288
111 3300048904 Ga0496101_0000279 Ga0496101_0000279_13601_14530 288
112 3300048905 Ga0496102_0012906 Ga0496102_0012906_2697_3626 288
113 3300048906 Ga0496103_0002083 Ga0496103_0002083_7079_8008 288
114 3300048909 Ga0496106_0003400 Ga0496106_0003400_8126_9055 288
115 3300048909 Ga0496106_0203532 Ga0496106_0203532_283_1239 288
116 3300048910 Ga0496107_0001549 Ga0496107_0001549_7922_8851 288
117 3300048911 Ga0496108_0060139 Ga0496108_0060139_1373_2302 288
118 3300048912 Ga0496109_0000179 Ga0496109_0000179_40443_41372 288
119 3300048913 Ga0496110_0021173 Ga0496110_0021173_4134_5063 288
120 3300048914 Ga0496111_0045166 Ga0496111_0045166_1885_2814 288
121 3300048917 Ga0496114_0000545 Ga0496114_0000545_5609_6538 288
122 3300048919 Ga0496116_0002785 Ga0496116_0002785_8282_9211 288
123 3300048920 Ga0496117_0023030 Ga0496117_0023030_308_1237 288
124 3300048921 Ga0496118_0015209 Ga0496118_0015209_2166_3095 288
125 3300048922 Ga0496119_0005945 Ga0496119_0005945_7150_8079 288
126 3300048923 Ga0496120_0023997 Ga0496120_0023997_1339_2268 288
127 3300048924 Ga0496121_0000014 Ga0496121_0000014_414574_415503 288
128 3300048925 Ga0496122_0002141 Ga0496122_0002141_21493_22422 288
129 3300048926 Ga0496123_0008243 Ga0496123_0008243_903_1832 288
130 3300048927 Ga0496124_0000019 Ga0496124_0000019_414574_415503 288
131 3300048928 Ga0496125_0000014 Ga0496125_0000014_414574_415503 288
132 3300048929 Ga0496126_0000017 Ga0496126_0000017_195174_196103 288
133 3300049585 Ga0501069_0038833 Ga0501069_0038833_55_951 289
134 3300026067 Ga0207678_10217521 Ga0207678_102175212 290
135 3300005456 Ga0070678_100053167 Ga0070678_1000531672 291
136 3300009177 Ga0105248_10010707 Ga0105248_1001070710 291
137 3300028379 Ga0268266_10156352 Ga0268266_101563522 291
138 3300048903 Ga0496100_0007833 Ga0496100_0007833_3056_4033 291
139 3300048904 Ga0496101_0000439 Ga0496101_0000439_23264_24241 291
140 3300048904 Ga0496101_0015888 Ga0496101_0015888_802_1773 291
141 3300048907 Ga0496104_0072263 Ga0496104_0072263_2213_3190 291
142 3300048910 Ga0496107_0002904 Ga0496107_0002904_295_1272 291
143 3300048911 Ga0496108_0342087 Ga0496108_0342087_245_1222 291
144 3300048917 Ga0496114_0007633 Ga0496114_0007633_1094_2071 291
145 3300048918 Ga0496115_0000399 Ga0496115_0000399_27273_28250 291
146 3300046524 Ga0495648_0001240 Ga0495648_0001240_20139_21077 292
147 3300047320 Ga0495672_0001370 Ga0495672_0001370_21000_21938 292
148 3300047469 Ga0495673_0000415 Ga0495673_0000415_27164_28102 292
149 3300003792 Ga0055540_1000036 Ga0055540_1000036120 293
150 3300025303 Ga0209051_1000021 Ga0209051_1000021469 293
151 3300031456 Ga0307513_10046649 Ga0307513_100466494 293
152 3300048907 Ga0496104_0115473 Ga0496104_0115473_1572_2516 293
153 3300009553 Ga0105249_10010996 Ga0105249_100109964 294
154 3300014325 Ga0163163_10653386 Ga0163163_106533861 294
155 3300025931 Ga0207644_10219527 Ga0207644_102195272 294
156 3300026118 Ga0207675_100384336 Ga0207675_1003843361 294
157 3300048905 Ga0496102_0105225 Ga0496102_0105225_882_1811 294
158 3300048910 Ga0496107_0132010 Ga0496107_0132010_708_1652 294
159 3300048912 Ga0496109_0045196 Ga0496109_0045196_548_1477 294
160 3300048915 Ga0496112_0075124 Ga0496112_0075124_372_1301 294
161 3300048920 Ga0496117_0110447 Ga0496117_0110447_411_1340 294
162 3300048921 Ga0496118_0001405 Ga0496118_0001405_17767_18696 294
163 3300041411 Ga0439466_0028693 Ga0439466_0028693_568_1536 295
164 3300050496 nmdc:mga07m45_4058_c2 nmdc:mga07m45_4058_c2_2192_3202 295
165 3300003792 Ga0055540_1009783 Ga0055540_10097832 296
166 3300005347 Ga0070668_100020690 Ga0070668_1000206902 296
167 3300025303 Ga0209051_1005309 Ga0209051_10053093 296
168 3300025303 Ga0209051_1007574 Ga0209051_10075743 296
169 3300025972 Ga0207668_10013864 Ga0207668_100138642 296
170 3300041460 Ga0451802_0378596 Ga0451802_0378596_301_1272 296
171 3300044658 Ga0466972_0006019 Ga0466972_0006019_4719_5654 296
172 3300044765 Ga0466970_0030304 Ga0466970_0030304_1449_2384 296
173 3300045836 Ga0466958_0117424 Ga0466958_0117424_322_1257 296
174 3300061719 Ga0466962_0005805 Ga0466962_0005805_251_1186 296
175 3300006177 Ga0075362_10071850 Ga0075362_100718502 297
176 3300047472 Ga0495686_0006261 Ga0495686_0006261_1134_2153 297
177 3300050490 nmdc:mga03n38_146109_c1 nmdc:mga03n38_146109_c1_19_1029 297
178 3300050494 nmdc:mga06z11_35087_c1 nmdc:mga06z11_35087_c1_403_1413 297
179 3300006048 Ga0075363_100005895 Ga0075363_1000058952 298
180 3300026035 Ga0207703_10029692 Ga0207703_100296922 298
181 3300037853 Ga0436364_0508354 Ga0436364_0508354_7050_8006 298
182 3300039437 Ga0436365_1578370 Ga0436365_1578370_370_1326 298
183 3300044658 Ga0466972_0022393 Ga0466972_0022393_1335_2315 298
184 3300044683 Ga0466965_0023286 Ga0466965_0023286_211_1191 298
185 3300044735 Ga0466968_0000717 Ga0466968_0000717_78_1058 298
186 3300044765 Ga0466970_0030193 Ga0466970_0030193_575_1555 298
187 3300044842 Ga0466957_0126776 Ga0466957_0126776_280_1260 298
188 3300045049 Ga0466959_0038158 Ga0466959_0038158_1300_2280 298
189 3300045976 Ga0466967_0201818 Ga0466967_0201818_28_978 298
190 3300045976 Ga0466967_0367242 Ga0466967_0367242_261_1241 298
191 3300045976 Ga0466967_0490466 Ga0466967_0490466_215_1165 298
192 3300050516 nmdc:mga0sz30_5941_c1 nmdc:mga0sz30_5941_c1_972_1940 298
193 3300044901 Ga0466960_0032085 Ga0466960_0032085_587_1567 299
194 3300045049 Ga0466959_0104215 Ga0466959_0104215_912_1862 299
195 3300003792 Ga0055540_1002615 Ga0055540_10026157 300
196 3300003792 Ga0055540_1004452 Ga0055540_10044524 300
197 3300006038 Ga0075365_10315400 Ga0075365_103154002 300
198 3300006186 Ga0075369_10000918 Ga0075369_100009186 300
199 3300025273 Ga0209673_1010251 Ga0209673_10102513 300
200 3300025303 Ga0209051_1001744 Ga0209051_10017445 300
201 3300025303 Ga0209051_1033675 Ga0209051_10336752 300
202 3300050516 nmdc:mga0sz30_5651_c1 nmdc:mga0sz30_5651_c1_101_1084 300
203 3300025939 Ga0207665_10182925 Ga0207665_101829252 301
204 3300039450 Ga0436363_1713773 Ga0436363_1713773_443_1393 301
205 3300044719 Ga0466971_0015143 Ga0466971_0015143_2439_3368 301
206 3300061719 Ga0466962_0032774 Ga0466962_0032774_1038_1967 301
207 iso_pu_bacteria 2863067949 2863068164 301
208 iso_pu_bacteria 2866552031 2866556780 301
209 iso_pu_bacteria 8056207758 8056211215 301
210 3300044683 Ga0466965_0106943 Ga0466965_0106943_356_1285 302
211 3300045976 Ga0466967_0154166 Ga0466967_0154166_725_1654 302
212 iso_pu_bacteria 2939582691 2939585863 302
213 3300001991 JGI24743J22301_10010442 JGI24743J22301_100104421 303
214 3300005336 Ga0070680_100208356 Ga0070680_1002083562 303
215 3300005339 Ga0070660_100258417 Ga0070660_1002584171 303
216 3300005439 Ga0070711_100023015 Ga0070711_1000230152 303
217 3300005440 Ga0070705_100243279 Ga0070705_1002432792 303
218 3300005457 Ga0070662_100249425 Ga0070662_1002494252 303
219 3300005718 Ga0068866_10012750 Ga0068866_100127504 303
220 3300005719 Ga0068861_100001141 Ga0068861_10000114112 303
221 3300005842 Ga0068858_100054164 Ga0068858_1000541644 303
222 3300005843 Ga0068860_100000586 Ga0068860_10000058620 303
223 3300006173 Ga0070716_100008822 Ga0070716_1000088221 303
224 3300006175 Ga0070712_100002108 Ga0070712_1000021087 303
225 3300006175 Ga0070712_100006478 Ga0070712_1000064786 303
226 3300006881 Ga0068865_100001469 Ga0068865_1000014695 303
227 3300006881 Ga0068865_100122144 Ga0068865_1001221442 303
228 3300025898 Ga0207692_10004759 Ga0207692_100047594 303
229 3300025900 Ga0207710_10014822 Ga0207710_100148222 303
230 3300025903 Ga0207680_10076092 Ga0207680_100760921 303
231 3300025914 Ga0207671_10209727 Ga0207671_102097271 303
232 3300025915 Ga0207693_10000569 Ga0207693_100005697 303
233 3300025915 Ga0207693_10003512 Ga0207693_100035123 303
234 3300025916 Ga0207663_10014839 Ga0207663_100148394 303
235 3300025916 Ga0207663_10045978 Ga0207663_100459782 303
236 3300025917 Ga0207660_10115917 Ga0207660_101159172 303
237 3300025919 Ga0207657_10007393 Ga0207657_1000739311 303
238 3300025927 Ga0207687_10000148 Ga0207687_1000014822 303
239 3300025931 Ga0207644_10172342 Ga0207644_101723421 303
240 3300025932 Ga0207690_10246304 Ga0207690_102463041 303
241 3300025934 Ga0207686_10010447 Ga0207686_100104474 303
242 3300025935 Ga0207709_10008353 Ga0207709_100083535 303
243 3300025937 Ga0207669_10279939 Ga0207669_102799391 303
244 3300025938 Ga0207704_10029369 Ga0207704_100293692 303
245 3300025939 Ga0207665_10015816 Ga0207665_100158161 303
246 3300025940 Ga0207691_10311955 Ga0207691_103119552 303
247 3300025942 Ga0207689_10026812 Ga0207689_100268123 303
248 3300025961 Ga0207712_10002137 Ga0207712_100021371 303
249 3300025972 Ga0207668_10006104 Ga0207668_100061046 303
250 3300025986 Ga0207658_10004474 Ga0207658_100044744 303
251 3300026023 Ga0207677_10000713 Ga0207677_100007134 303
252 3300026067 Ga0207678_10005836 Ga0207678_100058366 303
253 3300026075 Ga0207708_10002975 Ga0207708_100029757 303
254 3300026075 Ga0207708_10011208 Ga0207708_100112082 303
255 3300026089 Ga0207648_10005356 Ga0207648_100053562 303
256 3300026118 Ga0207675_100002109 Ga0207675_1000021099 303
257 3300026121 Ga0207683_10001695 Ga0207683_100016959 303
258 3300028379 Ga0268266_10431322 Ga0268266_104313221 303
259 3300048922 Ga0496119_0073937 Ga0496119_0073937_915_1826 303
260 3300049460 Ga0495682_0086875 Ga0495682_0086875_14_925 303
261 3300005937 Ga0081455_10234322 Ga0081455_102343222 304
262 3300006038 Ga0075365_10009455 Ga0075365_100094554 304
263 3300006048 Ga0075363_100010635 Ga0075363_1000106354 304
264 3300006051 Ga0075364_10033276 Ga0075364_100332762 304
265 3300006186 Ga0075369_10070992 Ga0075369_100709922 304
266 3300006186 Ga0075369_10071139 Ga0075369_100711392 304
267 3300031731 Ga0307405_10137743 Ga0307405_101377432 304
268 3300031824 Ga0307413_10066532 Ga0307413_100665322 304
269 3300031995 Ga0307409_100013856 Ga0307409_1000138565 304
270 3300049569 Ga0501032_0001236 Ga0501032_0001236_8769_9779 304
271 3300049570 Ga0501033_0020394 Ga0501033_0020394_3723_4664 304
272 3300049571 Ga0501034_0002932 Ga0501034_0002932_1996_3006 304
273 3300049571 Ga0501034_0023547 Ga0501034_0023547_868_1809 304
274 3300049572 Ga0501036_0012412 Ga0501036_0012412_2786_3796 304
275 3300049573 Ga0501037_0000111 Ga0501037_0000111_29325_30335 304
276 3300049573 Ga0501037_0010254 Ga0501037_0010254_389_1330 304
277 3300049574 Ga0501038_0000635 Ga0501038_0000635_21589_22599 304
278 3300049575 Ga0501039_0000326 Ga0501039_0000326_3675_4685 304
279 3300049579 Ga0501043_0000138 Ga0501043_0000138_38077_39087 304
280 3300049579 Ga0501043_0279043 Ga0501043_0279043_270_1211 304
281 3300049581 Ga0501047_0007470 Ga0501047_0007470_5802_6743 304
282 3300049582 Ga0501048_0013278 Ga0501048_0013278_141_1082 304
283 3300049583 Ga0501067_0040414 Ga0501067_0040414_561_1571 304
284 3300049586 Ga0501070_0000357 Ga0501070_0000357_5162_6172 304
285 3300049589 Ga0501073_0008460 Ga0501073_0008460_3262_4272 304
286 3300049742 Ga0501080_0018907 Ga0501080_0018907_4667_5608 304
287 3300049744 Ga0501083_0061352 Ga0501083_0061352_459_1400 304
288 3300049822 Ga0501035_0009459 Ga0501035_0009459_6342_7283 304
289 3300049823 Ga0501044_0015220 Ga0501044_0015220_2141_3151 304
290 3300050491 nmdc:mga00v17_16249_c1 nmdc:mga00v17_16249_c1_1663_2673 304
291 3300050492 nmdc:mga0yw44_17814_c1 nmdc:mga0yw44_17814_c1_648_1658 304
292 3300050492 nmdc:mga0yw44_62348_c1 nmdc:mga0yw44_62348_c1_675_1685 304
293 3300050493 nmdc:mga0k408_133263_c1 nmdc:mga0k408_133263_c1_69_1079 304
294 3300053080 Ga0500635_0012042 Ga0500635_0012042_1447_2418 304
295 3300032126 Ga0307415_100046210 Ga0307415_1000462103 305
296 3300049585 Ga0501069_0011794 Ga0501069_0011794_1925_2860 305
297 3300005548 Ga0070665_100052528 Ga0070665_1000525284 306
298 3300005618 Ga0068864_100020617 Ga0068864_1000206172 306
299 3300005718 Ga0068866_10016000 Ga0068866_100160001 306
300 3300005840 Ga0068870_10125829 Ga0068870_101258292 306
301 3300005844 Ga0068862_100223248 Ga0068862_1002232482 306
302 3300025901 Ga0207688_10000890 Ga0207688_100008904 306
303 3300025904 Ga0207647_10019431 Ga0207647_100194312 306
304 3300025914 Ga0207671_10270499 Ga0207671_102704992 306
305 3300025923 Ga0207681_10144281 Ga0207681_101442812 306
306 3300025926 Ga0207659_10116119 Ga0207659_101161191 306
307 3300025940 Ga0207691_10209014 Ga0207691_102090142 306
308 3300025941 Ga0207711_10105682 Ga0207711_101056822 306
309 3300025949 Ga0207667_10588826 Ga0207667_105888261 306
310 3300025981 Ga0207640_10076003 Ga0207640_100760031 306
311 3300025986 Ga0207658_10089155 Ga0207658_100891551 306
312 3300026023 Ga0207677_10072324 Ga0207677_100723242 306
313 3300026035 Ga0207703_10018614 Ga0207703_100186143 306
314 3300026067 Ga0207678_10131330 Ga0207678_101313302 306
315 3300026089 Ga0207648_10134356 Ga0207648_101343562 306
316 3300026095 Ga0207676_10019924 Ga0207676_100199244 306
317 3300028379 Ga0268266_10038696 Ga0268266_100386964 306
318 3300028380 Ga0268265_10098764 Ga0268265_100987642 306
319 3300031995 Ga0307409_100422011 Ga0307409_1004220112 306
320 3300048923 Ga0496120_0004500 Ga0496120_0004500_7330_8292 306
321 3300048927 Ga0496124_0010607 Ga0496124_0010607_4424_5386 306
322 3300050490 nmdc:mga03n38_144831_c1 nmdc:mga03n38_144831_c1_73_1083 306
323 3300053153 Ga0500616_0022870 Ga0500616_0022870_336_1310 306
324 iso_pu_bacteria 2956939328 2956940180 306
325 3300005937 Ga0081455_10162689 Ga0081455_101626892 307
326 3300044658 Ga0466972_0114078 Ga0466972_0114078_12_962 307
327 3300044735 Ga0466968_0024034 Ga0466968_0024034_368_1318 307
328 3300050491 nmdc:mga00v17_1135_c1 nmdc:mga00v17_1135_c1_5644_6624 307
329 iso_pu_bacteria 2795385472 2795792774 307
330 3300021384 Ga0213876_10017797 Ga0213876_100177973 308
331 3300044765 Ga0466970_0061320 Ga0466970_0061320_999_1925 308
332 iso_pu_bacteria 3001119090 3001121599 308
333 3300006353 Ga0075370_10011326 Ga0075370_100113263 309
334 3300006846 Ga0075430_100140933 Ga0075430_1001409332 309
335 3300009174 Ga0105241_10022457 Ga0105241_100224572 309
336 3300039438 Ga0436360_0369847 Ga0436360_0369847_119_1060 309
337 3300050496 nmdc:mga07m45_24725_c1 nmdc:mga07m45_24725_c1_431_1360 309
338 3300050509 nmdc:mga0qj67_133762_c1 nmdc:mga0qj67_133762_c1_319_1248 309
339 iso_pu_bacteria 2738541264 2738668148 309
340 iso_pu_bacteria 2738541356 2739147218 309
341 iso_pu_bacteria 2974315732 2974317569 309
342 iso_pu_bacteria 2984523437 2984525778 309
343 3300005355 Ga0070671_100050906 Ga0070671_1000509062 310
344 3300048903 Ga0496100_0010522 Ga0496100_0010522_743_1681 311
345 3300048904 Ga0496101_0000011 Ga0496101_0000011_245076_246014 311
346 3300048905 Ga0496102_0000012 Ga0496102_0000012_57346_58284 311
347 3300048906 Ga0496103_0000005 Ga0496103_0000005_257179_258117 311
348 3300048908 Ga0496105_0296116 Ga0496105_0296116_82_1020 311
349 3300048909 Ga0496106_0004651 Ga0496106_0004651_3469_4407 311
350 3300048910 Ga0496107_0094715 Ga0496107_0094715_591_1529 311
351 3300048919 Ga0496116_0000050 Ga0496116_0000050_53567_54505 311
352 3300048920 Ga0496117_0000042 Ga0496117_0000042_257187_258125 311
353 3300048921 Ga0496118_0000037 Ga0496118_0000037_257187_258125 311
354 3300048922 Ga0496119_0002814 Ga0496119_0002814_8239_9177 311
355 3300048923 Ga0496120_0000449 Ga0496120_0000449_11505_12443 311
356 3300048924 Ga0496121_0000039 Ga0496121_0000039_310965_311903 311
357 3300048929 Ga0496126_0000236 Ga0496126_0000236_9341_10279 311
358 3300049579 Ga0501043_0094312 Ga0501043_0094312_1381_2316 311
359 3300049581 Ga0501047_0058811 Ga0501047_0058811_2195_3130 311
360 3300049822 Ga0501035_0000595 Ga0501035_0000595_36903_37838 311
361 3300049823 Ga0501044_0001470 Ga0501044_0001470_24641_25576 311
362 iso_pu_bacteria 2643221715 2644633682 311
363 iso_pu_bacteria 2902810491 2902815029 311
364 3300009545 Ga0105237_10000298 Ga0105237_1000029840 312
365 3300010375 Ga0105239_10006015 Ga0105239_100060155 312
366 3300025929 Ga0207664_10400855 Ga0207664_104008551 312
367 3300048929 Ga0496126_0283564 Ga0496126_0283564_65_1003 312
368 3300053087 Ga0500643_001809 Ga0500643_001809_2714_3652 312
369 3300053153 Ga0500616_0022316 Ga0500616_0022316_371_1360 312
370 3300006353 Ga0075370_10008421 Ga0075370_100084215 313
371 3300035112 Ga0373932_0012740 Ga0373932_0012740_933_1913 313
372 3300041410 Ga0439461_0007386 Ga0439461_0007386_882_1838 313
373 3300049581 Ga0501047_0182343 Ga0501047_0182343_318_1259 313
374 3300049822 Ga0501035_0173460 Ga0501035_0173460_403_1344 313
375 3300050491 nmdc:mga00v17_1247_c1 nmdc:mga00v17_1247_c1_11891_12832 313
376 3300050496 nmdc:mga07m45_61962_c1 nmdc:mga07m45_61962_c1_616_1557 313
377 3300050516 nmdc:mga0sz30_12184_c1 nmdc:mga0sz30_12184_c1_888_1829 313
378 iso_pu_bacteria 2643221687 2644486019 314
379 iso_pu_bacteria 2738541274 2738707709 314
380 iso_pu_bacteria 2738543028 2739332721 314
381 iso_pu_bacteria 2842134933 2842137984 314
382 iso_pu_bacteria 2902792274 2902795984 314
383 iso_pu_bacteria 2902799365 2902801122 314
384 iso_pu_bacteria 2902837492 2902840638 314
385 iso_pu_bacteria 2929212328 2929215435 314
386 3300006048 Ga0075363_100005058 Ga0075363_1000050582 316
387 3300050510 nmdc:mga06r32_6190_c1 nmdc:mga06r32_6190_c1_9758_10708 316
388 3300013105 Ga0157369_10217672 Ga0157369_102176722 317
389 3300013306 Ga0163162_10002303 Ga0163162_1000230315 317
390 3300005338 Ga0068868_100009943 Ga0068868_1000099436 318
391 3300005343 Ga0070687_100032906 Ga0070687_1000329062 318
392 3300005347 Ga0070668_100050667 Ga0070668_1000506673 318
393 3300005356 Ga0070674_100005751 Ga0070674_1000057512 318
394 3300005437 Ga0070710_10021426 Ga0070710_100214263 318
395 3300005546 Ga0070696_100010246 Ga0070696_1000102466 318
396 3300006173 Ga0070716_100031081 Ga0070716_1000310813 318
397 3300006358 Ga0068871_100313885 Ga0068871_1003138851 318
398 3300006844 Ga0075428_100075949 Ga0075428_1000759492 318
399 3300006846 Ga0075430_100026681 Ga0075430_1000266816 318
400 3300009147 Ga0114129_10021108 Ga0114129_100211086 318
401 3300009174 Ga0105241_10079313 Ga0105241_100793132 318
402 3300013308 Ga0157375_10244722 Ga0157375_102447222 318
403 3300025901 Ga0207688_10043011 Ga0207688_100430112 318
404 3300025904 Ga0207647_10181288 Ga0207647_101812882 318
405 3300025905 Ga0207685_10074665 Ga0207685_100746652 318
406 3300025914 Ga0207671_10006972 Ga0207671_100069723 318
407 3300025923 Ga0207681_10106788 Ga0207681_101067881 318
408 3300025981 Ga0207640_10027617 Ga0207640_100276172 318
409 3300026142 Ga0207698_10048784 Ga0207698_100487843 318
410 3300028380 Ga0268265_10100417 Ga0268265_101004173 318
411 3300039437 Ga0436365_0476482 Ga0436365_0476482_8526_9482 318
412 3300048915 Ga0496112_0491737 Ga0496112_0491737_134_1090 318
413 3300050509 nmdc:mga0qj67_4614_c1 nmdc:mga0qj67_4614_c1_6804_7760 318
414 3300042002 Ga0439442_009425 Ga0439442_009425_890_1864 319
415 3300005338 Ga0068868_100355893 Ga0068868_1003558931 321
416 3300014326 Ga0157380_10296709 Ga0157380_102967092 321
417 3300025916 Ga0207663_10169585 Ga0207663_101695852 321
418 3300026118 Ga0207675_100063136 Ga0207675_1000631362 321
419 3300048909 Ga0496106_0056527 Ga0496106_0056527_275_1240 321
420 3300021384 Ga0213876_10021672 Ga0213876_100216722 323
421 3300039437 Ga0436365_0079327 Ga0436365_0079327_3651_4622 323
422 3300048929 Ga0496126_0006366 Ga0496126_0006366_12041_13015 324
423 3300002077 JGI24744J21845_10009273 JGI24744J21845_100092734 325
424 3300005345 Ga0070692_10145624 Ga0070692_101456242 325
425 3300005365 Ga0070688_100004006 Ga0070688_1000040067 325
426 3300005441 Ga0070700_100002872 Ga0070700_1000028724 325
427 3300005444 Ga0070694_100061686 Ga0070694_1000616863 325
428 3300005455 Ga0070663_100037098 Ga0070663_1000370982 325
429 3300005456 Ga0070678_100009222 Ga0070678_1000092226 325
430 3300005544 Ga0070686_100020735 Ga0070686_1000207354 325
431 3300005547 Ga0070693_100034329 Ga0070693_1000343291 325
432 3300005549 Ga0070704_100002510 Ga0070704_1000025109 325
433 3300005578 Ga0068854_100001379 Ga0068854_10000137913 325
434 3300005617 Ga0068859_100021637 Ga0068859_1000216375 325
435 3300006931 Ga0097620_100021637 Ga0097620_1000216375 325
436 3300009098 Ga0105245_10047419 Ga0105245_100474194 325
437 3300009101 Ga0105247_10013251 Ga0105247_100132515 325
438 3300009148 Ga0105243_10000549 Ga0105243_100005499 325
439 3300009176 Ga0105242_10003330 Ga0105242_100033309 325
440 3300009177 Ga0105248_10091454 Ga0105248_100914543 325
441 3300009545 Ga0105237_10030280 Ga0105237_100302806 325
442 3300009553 Ga0105249_10004974 Ga0105249_100049749 325
443 3300010375 Ga0105239_10032449 Ga0105239_100324496 325
444 3300013297 Ga0157378_10007001 Ga0157378_100070019 325
445 3300013307 Ga0157372_10011899 Ga0157372_100118993 325
446 3300013308 Ga0157375_10003698 Ga0157375_100036982 325
447 3300014326 Ga0157380_10017301 Ga0157380_100173011 325
448 3300014745 Ga0157377_10007419 Ga0157377_100074192 325
449 3300014968 Ga0157379_10002847 Ga0157379_100028477 325
450 3300025933 Ga0207706_10008187 Ga0207706_100081876 325
451 3300025933 Ga0207706_10114139 Ga0207706_101141393 325
452 3300025939 Ga0207665_10008564 Ga0207665_100085644 325
453 3300035241 Ga0373961_0030729 Ga0373961_0030729_72_1052 325
454 3300035691 Ga0373931_0001728 Ga0373931_0001728_7496_8476 325
455 3300046460 Ga0495638_0010590 Ga0495638_0010590_2257_3234 325
456 3300048903 Ga0496100_0017539 Ga0496100_0017539_2124_3104 325
457 3300048904 Ga0496101_0106824 Ga0496101_0106824_32_1012 325
458 3300048905 Ga0496102_0001078 Ga0496102_0001078_23167_24147 325
459 3300048906 Ga0496103_0000418 Ga0496103_0000418_24678_25658 325
460 3300048909 Ga0496106_0000676 Ga0496106_0000676_22769_23749 325
461 3300048918 Ga0496115_0108928 Ga0496115_0108928_80_1060 325
462 3300048918 Ga0496115_0186629 Ga0496115_0186629_186_1166 325
463 3300001990 JGI24737J22298_10008737 JGI24737J22298_100087373 328
464 3300002073 JGI24745J21846_1003885 JGI24745J21846_10038853 328
465 3300002077 JGI24744J21845_10002813 JGI24744J21845_100028132 328
466 3300005354 Ga0070675_100072821 Ga0070675_1000728212 328
467 3300005441 Ga0070700_100103047 Ga0070700_1001030472 328
468 3300005456 Ga0070678_100143382 Ga0070678_1001433822 328
469 3300005615 Ga0070702_100204938 Ga0070702_1002049382 328
470 3300009148 Ga0105243_10129809 Ga0105243_101298092 328
471 3300009545 Ga0105237_10209888 Ga0105237_102098881 328
472 3300009553 Ga0105249_10774758 Ga0105249_107747581 328
473 3300011119 Ga0105246_10067008 Ga0105246_100670082 328
474 3300013306 Ga0163162_10173234 Ga0163162_101732342 328
475 3300025908 Ga0207643_10161141 Ga0207643_101611412 328
476 3300026118 Ga0207675_100280944 Ga0207675_1002809442 328
477 3300048907 Ga0496104_0172992 Ga0496104_0172992_552_1541 328
478 3300048911 Ga0496108_0000197 Ga0496108_0000197_25639_26628 328
479 3300048912 Ga0496109_0000695 Ga0496109_0000695_11197_12186 328
480 3300048914 Ga0496111_0084227 Ga0496111_0084227_667_1656 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02628

COX15-CtaA

Cytochrome oxidase assembly protein

19

297

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ied-assembly1.cif.gz_A crystal structure of heme a synthase from bacillus subtilis 0.7204 20 312
6ied-assembly1.cif.gz_A crystal structure of heme a synthase from bacillus subtilis 0.6848 20 312
8aw5-assembly1.cif.gz_A cryo-em structure of heme a synthase trimer from aquifex aeolicus 0.6362 29 316
8aw5-assembly1.cif.gz_A cryo-em structure of heme a synthase trimer from aquifex aeolicus 0.6158 29 316
2e8u-assembly1.cif.gz_B s. cerevisiae geranylgeranyl pyrophosphate synthase in complex with magnesium and ipp (p21) 0.4152 8 210
ID Description Score Start End Superfamily
af_G5EGK1_1860_1981_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.596 22 170 1.20.120.230
af_G5EGK1_1860_1981_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5924 22 170 1.20.120.230
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5903 10 168 1.20.120.1770
af_Q17958_2_210_1.20.120.1950 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.576 162 317 1.20.120.1950
af_Q9VF70_2_206_1.20.120.1950 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5732 159 318 1.20.120.1950
ID Description Score Start End GO Terms
AF-A0A3N5JVM4-F1-model_v4 Cytochrome oxidase assembly protein 0.9547 188 317 GO:0016020
AF-A0A655EWW9-F1-model_v4 deleted 0.9409 81 328
AF-A0A0U1DGC1-F1-model_v4 Cytochrome aa3 controlling protein 0.9271 183 328 GO:0016020
AF-A0A655EWW9-F1-model_v4 deleted 0.9264 81 328
AF-A0A848K7F9-F1-model_v4 Heme A synthase 0.9184 10 327 GO:0006784
GO:0016020
GO:0016653

Feature Viewer

pLDDT pTM Quality
82.78 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map