F451346

General Info

Members Datasets Scaffolds Average Seq Length
475 270 442 277

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10039319|Ga0157379_100393196
Length 335
Sequence MRGSAAARPYAARRDEAWLEDWRGLPTVYAAFALTAVASAGSSCAILSRLSPNRPEIRKMPQASVIVVGNEKGGAGKSTIAIHTAVALMHAGAKVAVLDLDLRQQTMGRFFANRRQWLDANGATAPLPMEHLVSSQGPELARAPEAEVVARFQAAFDACSEAADFLLIDTPGADTAVSRVAHGLADLIVTPMNDSFVDFDMLGVVDPVSLELVRHSLYSETVWDSRKARAAKDRKMIDWVVLRNRLAPTEARNRKRLDERVEALSRKVGFRIGPGLRDRVIYRELFPFGLTIADLSPSIRPVAMSLQHVAARQELRAVMSALGIQGLDGEMMAAE

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
18 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
19 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
20 2818991435 Caulobacter henricii 536 Isolate Unclassified
21 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
22 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
23 2849560528 Caulobacter zeae 410 Isolate Unclassified
24 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
25 2851153111 Caulobacter radicis 736 Isolate Unclassified
26 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
27 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
28 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
29 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
30 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
31 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
32 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
243 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
251 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
252 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
257 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
270 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.63
Metatranscriptomes 0.42
Isolates 6.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.63
Nodule 0
Rhizoplane 3.79
Rhizosphere 60.21
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10147033 3300003320 Bacteria 2883
2 rootL2_10253124 3300003322 Bacteria 1568
3 Ga0006562J51391_1072425 3300003578 Bacteria 4060
4 Ga0006562J51391_1072426 3300003578 Bacteria 3390
5 Ga0055537_1012150 3300003773 Bacteria 1696
6 Ga0055536_1001292 3300003781 Bacteria 15406
7 Ga0055536_1003995 3300003781 Bacteria 7705
8 Ga0055536_1009691 3300003781 Bacteria 3941
9 Ga0055528_1020876 3300003790 Bacteria 2104
10 Ga0055530_10003575 3300003791 Bacteria 8739
11 Ga0055530_10005357 3300003791 Bacteria 6132
12 Ga0055530_10008623 3300003791 Bacteria 4046
13 Ga0055531_10002210 3300003794 Bacteria 13231
14 Ga0055531_10009893 3300003794 Bacteria 4823
15 Ga0055531_10014056 3300003794 Bacteria 3637
16 Ga0055531_10026710 3300003794 Bacteria 2049
17 Ga0065165_1000506 3300005262 Bacteria 60005
18 Ga0065165_1001123 3300005262 Bacteria 31534
19 Ga0065165_1005703 3300005262 Bacteria 6853
20 Ga0070658_10057801 3300005327 Bacteria 3156
21 Ga0070670_100000062 3300005331 Bacteria 112560
22 Ga0068869_100016197 3300005334 Bacteria 5020
23 Ga0070666_10067022 3300005335 Bacteria 2437
24 Ga0070666_10122631 3300005335 Bacteria 1803
25 Ga0070660_100377269 3300005339 Bacteria 1170
26 Ga0070691_10006841 3300005341 Bacteria 5213
27 Ga0070668_100000756 3300005347 Bacteria 22178
28 Ga0070668_100001425 3300005347 Bacteria 17250
29 Ga0070668_100021162 3300005347 Bacteria 4917
30 Ga0070669_100058247 3300005353 Bacteria 2835
31 Ga0070671_100099095 3300005355 Bacteria 2444
32 Ga0070671_100208388 3300005355 Bacteria 1658
33 Ga0070659_100004424 3300005366 Bacteria 10036
34 Ga0070659_100012605 3300005366 Bacteria 6269
35 Ga0070659_100056213 3300005366 Bacteria 3103
36 Ga0070667_100000992 3300005367 Bacteria 26039
37 Ga0070667_100001445 3300005367 Bacteria 21264
38 Ga0070662_100186466 3300005457 Bacteria 1638
39 Ga0070681_10006887 3300005458 Bacteria 11063
40 Ga0070681_10020866 3300005458 Bacteria 6561
41 Ga0070681_10058150 3300005458 Bacteria 3846
42 Ga0070679_100013405 3300005530 Bacteria 7850
43 Ga0070679_100029997 3300005530 Bacteria 5367
44 Ga0068853_100035468 3300005539 Bacteria 4237
45 Ga0068853_100036577 3300005539 Bacteria 4176
46 Ga0068853_100151348 3300005539 Bacteria 2089
47 Ga0070665_100000121 3300005548 Bacteria 147683
48 Ga0070665_100000735 3300005548 Bacteria 43654
49 Ga0070665_100019396 3300005548 Bacteria 6823
50 Ga0068855_100014248 3300005563 Bacteria 9578
51 Ga0068855_100025982 3300005563 Bacteria 7005
52 Ga0068855_100072192 3300005563 Bacteria 4013
53 Ga0068855_100086495 3300005563 Bacteria 3625
54 Ga0068855_100121178 3300005563 Bacteria 2993
55 Ga0068855_100254541 3300005563 Bacteria 1958
56 Ga0070664_100003912 3300005564 Bacteria 12017
57 Ga0070664_100157762 3300005564 Bacteria 2006
58 Ga0068854_100435518 3300005578 Bacteria 1092
59 Ga0068856_100328572 3300005614 Bacteria 1547
60 Ga0068852_100247765 3300005616 Bacteria 1706
61 Ga0068859_100000401 3300005617 Bacteria 43052
62 Ga0068864_100000272 3300005618 Bacteria 46010
63 Ga0068864_100048055 3300005618 Bacteria 3667
64 Ga0068863_100001838 3300005841 Bacteria 21096
65 Ga0068863_100009604 3300005841 Bacteria 9436
66 Ga0068863_100020721 3300005841 Bacteria 6279
67 Ga0068858_100000820 3300005842 Bacteria 32422
68 Ga0068858_100114129 3300005842 Bacteria 2523
69 Ga0068858_100361683 3300005842 Bacteria 1391
70 Ga0068860_100001184 3300005843 Bacteria 28547
71 Ga0068860_100192403 3300005843 Bacteria 1974
72 Ga0068862_100001790 3300005844 Bacteria 19442
73 Ga0068862_100008689 3300005844 Bacteria 8403
74 Ga0068862_100051836 3300005844 Bacteria 3510
75 Ga0070717_10063852 3300006028 Bacteria 3057
76 Ga0075368_10026723 3300006042 Bacteria 2221
77 Ga0075364_10002233 3300006051 Bacteria 10861
78 Ga0075362_10136976 3300006177 Bacteria 1168
79 Ga0075367_10002882 3300006178 Bacteria 8003
80 Ga0075369_10005214 3300006186 Bacteria 4841
81 Ga0075366_10119247 3300006195 Bacteria 1589
82 Ga0075370_10037037 3300006353 Bacteria 2742
83 Ga0075370_10082479 3300006353 Bacteria 1849
84 Ga0068871_100333480 3300006358 Bacteria 1338
85 Ga0068865_100000215 3300006881 Bacteria 32196
86 Ga0097620_100000401 3300006931 Bacteria 43052
87 Ga0105240_10001656 3300009093 Bacteria 37802
88 Ga0105240_10011605 3300009093 Bacteria 12258
89 Ga0105240_10037936 3300009093 Bacteria 6187
90 Ga0105240_10037992 3300009093 Bacteria 6182
91 Ga0105240_10051911 3300009093 Bacteria 5157
92 Ga0105240_10244486 3300009093 Bacteria 2078
93 Ga0105240_10294416 3300009093 Bacteria 1859
94 Ga0105240_10952201 3300009093 Bacteria 921
95 Ga0105243_10788709 3300009148 Bacteria 935
96 Ga0105241_10028448 3300009174 Bacteria 4166
97 Ga0105242_10095718 3300009176 Bacteria 2507
98 Ga0105248_10001025 3300009177 Bacteria 30911
99 Ga0105248_10002925 3300009177 Bacteria 18953
100 Ga0105248_10010874 3300009177 Bacteria 10047
101 Ga0105248_10048209 3300009177 Bacteria 4778
102 Ga0105248_10166808 3300009177 Bacteria 2482
103 Ga0105248_10830082 3300009177 Bacteria 1043
104 Ga0105237_10186076 3300009545 Bacteria 2077
105 Ga0105238_10032425 3300009551 Bacteria 5317
106 Ga0105238_10047484 3300009551 Bacteria 4328
107 Ga0105238_10233617 3300009551 Bacteria 1815
108 Ga0105238_10349072 3300009551 Bacteria 1468
109 Ga0105239_10072031 3300010375 Bacteria 3798
110 Ga0157373_10002798 3300013100 Bacteria 13195
111 Ga0157373_10010121 3300013100 Bacteria 6948
112 Ga0157370_10005877 3300013104 Bacteria 13679
113 Ga0157370_10201153 3300013104 Bacteria 1848
114 Ga0157370_10351206 3300013104 Bacteria 1359
115 Ga0157369_10105315 3300013105 Bacteria 3003
116 Ga0163162_10115659 3300013306 Bacteria 2782
117 Ga0163163_10002216 3300014325 Bacteria 16346
118 Ga0163163_10021374 3300014325 Bacteria 6106
119 Ga0163163_10138927 3300014325 Bacteria 2472
120 Ga0163163_10458588 3300014325 Bacteria 1335
121 Ga0157379_10010279 3300014968 Bacteria 8149
122 Ga0157379_10023996 3300014968 Bacteria 5413
123 Ga0157379_10039319 3300014968 Bacteria 4220
124 Ga0157379_10171188 3300014968 Bacteria 1961
125 Ga0183365_10003 3300015684 Bacteria 414944
126 Ga0213876_10011726 3300021384 Bacteria 4676
127 Ga0213876_10091378 3300021384 Bacteria 1612
128 Ga0209026_1000665 3300025250 Bacteria 20993
129 Ga0209565_1000268 3300025263 Bacteria 53879
130 Ga0209673_1000600 3300025273 Bacteria 55820
131 Ga0209675_1013552 3300025291 Bacteria 2540
132 Ga0209676_1000422 3300025292 Bacteria 74541
133 Ga0209676_1000733 3300025292 Bacteria 44859
134 Ga0209676_1001881 3300025292 Bacteria 17151
135 Ga0209676_1002114 3300025292 Bacteria 15245
136 Ga0209564_1014304 3300025295 Bacteria 3310
137 Ga0209564_1028146 3300025295 Bacteria 1805
138 Ga0209758_1003091 3300025297 Bacteria 15770
139 Ga0209758_1003541 3300025297 Bacteria 14048
140 Ga0209758_1004330 3300025297 Bacteria 11914
141 Ga0209050_1000161 3300025298 Bacteria 155713
142 Ga0209050_1000463 3300025298 Bacteria 72380
143 Ga0209050_1001754 3300025298 Bacteria 21523
144 Ga0209050_1006498 3300025298 Bacteria 6896
145 Ga0209256_1000784 3300025299 Bacteria 40988
146 Ga0209256_1002149 3300025299 Bacteria 17030
147 Ga0209051_1013007 3300025303 Bacteria 3985
148 Ga0209257_1000252 3300025304 Bacteria 123718
149 Ga0209257_1000687 3300025304 Bacteria 52593
150 Ga0209257_1000696 3300025304 Bacteria 52123
151 Ga0209257_1001589 3300025304 Bacteria 26085
152 Ga0209257_1001679 3300025304 Bacteria 24960
153 Ga0207710_10158519 3300025900 Bacteria 1101
154 Ga0207680_10006205 3300025903 Bacteria 5765
155 Ga0207705_10003067 3300025909 Bacteria 12739
156 Ga0207707_10015719 3300025912 Bacteria 6596
157 Ga0207707_10135330 3300025912 Bacteria 2154
158 Ga0207695_10000575 3300025913 Bacteria 74997
159 Ga0207695_10001510 3300025913 Bacteria 38653
160 Ga0207695_10006375 3300025913 Bacteria 15351
161 Ga0207695_10024675 3300025913 Bacteria 6754
162 Ga0207695_10080511 3300025913 Bacteria 3298
163 Ga0207671_10435470 3300025914 Bacteria 1044
164 Ga0207660_10005502 3300025917 Bacteria 8228
165 Ga0207657_10017123 3300025919 Bacteria 6964
166 Ga0207652_10014581 3300025921 Bacteria 6371
167 Ga0207652_10027838 3300025921 Bacteria 4713
168 Ga0207681_10025593 3300025923 Bacteria 3797
169 Ga0207681_10077735 3300025923 Bacteria 2334
170 Ga0207694_10011988 3300025924 Bacteria 6536
171 Ga0207650_10000084 3300025925 Bacteria 125773
172 Ga0207650_10039269 3300025925 Bacteria 3459
173 Ga0207644_10009319 3300025931 Bacteria 6445
174 Ga0207644_10012909 3300025931 Bacteria 5554
175 Ga0207644_10395277 3300025931 Bacteria 1129
176 Ga0207644_10522840 3300025931 Bacteria 980
177 Ga0207690_10000255 3300025932 Bacteria 38626
178 Ga0207690_10015504 3300025932 Bacteria 4619
179 Ga0207690_10026020 3300025932 Bacteria 3683
180 Ga0207706_10259809 3300025933 Bacteria 1516
181 Ga0207704_10001951 3300025938 Bacteria 9242
182 Ga0207711_10003429 3300025941 Bacteria 13711
183 Ga0207711_10011176 3300025941 Bacteria 7460
184 Ga0207711_10016724 3300025941 Bacteria 6091
185 Ga0207689_10210645 3300025942 Bacteria 1606
186 Ga0207679_10001983 3300025945 Bacteria 12699
187 Ga0207667_10063682 3300025949 Bacteria 3853
188 Ga0207667_10113878 3300025949 Bacteria 2788
189 Ga0207667_10601063 3300025949 Bacteria 1109
190 Ga0207712_10003816 3300025961 Bacteria 9511
191 Ga0207668_10000032 3300025972 Bacteria 122020
192 Ga0207668_10001102 3300025972 Bacteria 16095
193 Ga0207640_10383365 3300025981 Bacteria 1140
194 Ga0207658_10002456 3300025986 Bacteria 13548
195 Ga0207658_10007654 3300025986 Bacteria 7354
196 Ga0207703_10000133 3300026035 Bacteria 90055
197 Ga0207703_10010959 3300026035 Bacteria 7065
198 Ga0207703_10081703 3300026035 Bacteria 2695
199 Ga0207639_10024339 3300026041 Bacteria 4381
200 Ga0207639_10068081 3300026041 Bacteria 2773
201 Ga0207639_10315343 3300026041 Bacteria 1387
202 Ga0207678_10208080 3300026067 Bacteria 1673
203 Ga0207641_10000168 3300026088 Bacteria 92126
204 Ga0207641_10007435 3300026088 Bacteria 9113
205 Ga0207641_10046039 3300026088 Bacteria 3676
206 Ga0207676_10001565 3300026095 Bacteria 16874
207 Ga0207676_10078875 3300026095 Bacteria 2668
208 Ga0207698_10628212 3300026142 Bacteria 1062
209 Ga0207698_10807499 3300026142 Bacteria 941
210 Ga0209813_10017671 3300027866 Bacteria 1961
211 Ga0268266_10000106 3300028379 Bacteria 175109
212 Ga0268266_10004308 3300028379 Bacteria 13694
213 Ga0268266_10029655 3300028379 Bacteria 4649
214 Ga0268266_10125587 3300028379 Bacteria 2289
215 Ga0268265_10010090 3300028380 Bacteria 6375
216 Ga0268265_10016912 3300028380 Bacteria 5021
217 Ga0268265_10058189 3300028380 Bacteria 2950
218 Ga0268265_10179634 3300028380 Bacteria 1817
219 Ga0268265_10189122 3300028380 Bacteria 1776
220 Ga0268264_10000383 3300028381 Bacteria 63883
221 Ga0268264_10290907 3300028381 Bacteria 1534
222 Ga0307517_10002579 3300028786 Bacteria 28853
223 Ga0307515_10024951 3300028794 Bacteria 10375
224 Ga0307515_10076755 3300028794 Bacteria 4425
225 Ga0265338_10254144 3300028800 Bacteria 1295
226 Ga0307511_10012159 3300030521 Bacteria 8455
227 Ga0265327_10000568 3300031251 Bacteria 62780
228 Ga0265327_10004036 3300031251 Bacteria 13338
229 Ga0307513_10000162 3300031456 Bacteria 96000
230 Ga0307513_10001556 3300031456 Bacteria 32890
231 Ga0307513_10015667 3300031456 Bacteria 9176
232 Ga0265314_10090222 3300031711 Bacteria 1997
233 Ga0307516_10000820 3300031730 Bacteria 42605
234 Ga0307406_10001031 3300031901 Bacteria 15518
235 Ga0307406_10264450 3300031901 Bacteria 1303
236 Ga0307412_10012905 3300031911 Bacteria 4882
237 Ga0307414_10044749 3300032004 Bacteria 3026
238 Ga0307414_10052352 3300032004 Bacteria 2841
239 Ga0307414_10083104 3300032004 Bacteria 2350
240 Ga0307414_10209938 3300032004 Bacteria 1590
241 Ga0307414_10283865 3300032004 Bacteria 1392
242 Ga0307510_10017505 3300033180 Bacteria 8447
243 Ga0373944_0017378 3300035089 Bacteria 2041
244 Ga0373927_0000368 3300035695 Bacteria 34930
245 Ga0373925_0000507 3300037068 Bacteria 39351
246 Ga0373925_0221216 3300037068 Bacteria 1511
247 Ga0395899_0000013 3300037312 Bacteria 510397
248 Ga0395899_0000187 3300037312 Bacteria 90916
249 Ga0395899_0049611 3300037312 Bacteria 3119
250 Ga0395900_0001321 3300037418 Bacteria 30057
251 Ga0395900_0154569 3300037418 Bacteria 2343
252 Ga0395900_0534342 3300037418 Bacteria 1119
253 Ga0395898_0003504 3300037466 Bacteria 17510
254 Ga0395905_0013956 3300037471 Bacteria 7683
255 Ga0395905_0414371 3300037471 Bacteria 1243
256 Ga0436364_0445342 3300037853 Bacteria 3939
257 Ga0395901_0000412 3300038443 Bacteria 50385
258 Ga0436365_0959321 3300039437 Bacteria 5350
259 Ga0436365_1332887 3300039437 Bacteria 1640
260 Ga0436365_1544656 3300039437 Bacteria 122419
261 Ga0436361_0021486 3300039447 Bacteria 1080
262 Ga0436361_0255562 3300039447 Bacteria 4349
263 Ga0439445_0006851 3300042004 Bacteria 2630
264 Ga0439435_0003429 3300042436 Bacteria 3296
265 Ga0466964_0140130 3300044706 Bacteria 1111
266 Ga0466964_0194306 3300044706 Bacteria 970
267 Ga0466959_0331332 3300045049 Bacteria 1039
268 Ga0495627_000814 3300046453 Bacteria 22803
269 Ga0495590_0000543 3300046457 Bacteria 18090
270 Ga0495638_0000837 3300046460 Bacteria 32298
271 Ga0495638_0002445 3300046460 Bacteria 15160
272 Ga0495638_0006641 3300046460 Bacteria 8400
273 Ga0495638_0008327 3300046460 Bacteria 7357
274 Ga0495650_0000020 3300046471 Bacteria 533839
275 Ga0495584_0175676 3300046491 Bacteria 1089
276 Ga0495585_0088412 3300046492 Bacteria 1671
277 Ga0495607_0039775 3300046501 Bacteria 2806
278 Ga0495583_0000069 3300046506 Bacteria 186863
279 Ga0495583_0006763 3300046506 Bacteria 7413
280 Ga0495606_0012171 3300046507 Bacteria 6934
281 Ga0495610_0000092 3300046512 Bacteria 105874
282 Ga0495610_0002246 3300046512 Bacteria 16341
283 Ga0495610_0003620 3300046512 Bacteria 11911
284 Ga0495616_0002407 3300046513 Bacteria 12455
285 Ga0495620_0062186 3300046515 Bacteria 1551
286 Ga0495631_0001468 3300046518 Bacteria 14303
287 Ga0495632_0002860 3300046519 Bacteria 12735
288 Ga0495637_0017814 3300046520 Bacteria 3301
289 Ga0495643_0012771 3300046522 Bacteria 5053
290 Ga0495648_0001063 3300046524 Bacteria 27865
291 Ga0495642_0051674 3300046528 Bacteria 1691
292 Ga0495654_0000010 3300046530 Bacteria 378481
293 Ga0495621_0069268 3300046539 Bacteria 1296
294 Ga0495597_0005278 3300046542 Bacteria 6862
295 Ga0495597_0035196 3300046542 Bacteria 2260
296 Ga0495622_0012307 3300046557 Bacteria 3957
297 Ga0495633_0054952 3300046558 Bacteria 1872
298 Ga0495633_0254761 3300046558 Bacteria 800
299 Ga0495668_0000060 3300046616 Bacteria 193823
300 Ga0495668_0009021 3300046616 Bacteria 6159
301 Ga0495668_0009229 3300046616 Bacteria 6069
302 Ga0495668_0065153 3300046616 Bacteria 2005
303 Ga0495668_0088314 3300046616 Bacteria 1700
304 Ga0495668_0128842 3300046616 Bacteria 1385
305 Ga0495611_0009851 3300046648 Bacteria 4042
306 Ga0495625_0000295 3300046660 Bacteria 77306
307 Ga0495625_0003355 3300046660 Bacteria 16107
308 Ga0495625_0005189 3300046660 Bacteria 12005
309 Ga0495625_0005990 3300046660 Bacteria 10926
310 Ga0495625_0035656 3300046660 Bacteria 3664
311 Ga0495625_0036173 3300046660 Bacteria 3631
312 Ga0495625_0046437 3300046660 Bacteria 3134
313 Ga0495625_0051133 3300046660 Bacteria 2963
314 Ga0495625_0082230 3300046660 Bacteria 2240
315 Ga0495669_0000196 3300046684 Bacteria 37390
316 Ga0495669_0000407 3300046684 Bacteria 20891
317 Ga0495669_0019338 3300046684 Bacteria 2939
318 Ga0495649_0001628 3300046694 Bacteria 16707
319 Ga0495589_0045914 3300046794 Bacteria 2169
320 Ga0495660_0013917 3300046810 Bacteria 4663
321 Ga0495636_0032781 3300047318 Bacteria 2132
322 Ga0495674_0147830 3300047319 Bacteria 1972
323 Ga0495672_0003177 3300047320 Bacteria 14280
324 Ga0495672_0047823 3300047320 Bacteria 2541
325 Ga0495679_012177 3300047446 Bacteria 3284
326 Ga0495673_0000272 3300047469 Bacteria 71031
327 Ga0495673_0001128 3300047469 Bacteria 22901
328 Ga0495673_0003005 3300047469 Bacteria 11356
329 Ga0495686_0001631 3300047472 Bacteria 23417
330 Ga0495686_0003519 3300047472 Bacteria 13513
331 Ga0495686_0006940 3300047472 Bacteria 8557
332 Ga0495686_0057625 3300047472 Bacteria 2424
333 Ga0495602_0101069 3300048088 Bacteria 2366
334 Ga0496102_0009772 3300048905 Bacteria 8251
335 Ga0496102_0031297 3300048905 Bacteria 4772
336 Ga0496104_0124048 3300048907 Bacteria 2480
337 Ga0496105_0499793 3300048908 Bacteria 955
338 Ga0496107_0000111 3300048910 Bacteria 39492
339 Ga0496107_0053215 3300048910 Bacteria 2920
340 Ga0496108_0015302 3300048911 Bacteria 6258
341 Ga0496108_0596887 3300048911 Bacteria 962
342 Ga0496109_0021809 3300048912 Bacteria 5668
343 Ga0496112_0040935 3300048915 Bacteria 4532
344 Ga0496112_0047372 3300048915 Bacteria 4217
345 Ga0496113_0486366 3300048916 Bacteria 991
346 Ga0496115_0001542 3300048918 Bacteria 16531
347 Ga0496115_0002932 3300048918 Bacteria 12296
348 Ga0496115_0010459 3300048918 Bacteria 6933
349 Ga0496115_0230004 3300048918 Bacteria 1529
350 Ga0496115_0323328 3300048918 Bacteria 1261
351 Ga0496115_0351032 3300048918 Bacteria 1203
352 Ga0496116_0027591 3300048919 Bacteria 4132
353 Ga0496117_0024299 3300048920 Bacteria 4798
354 Ga0496118_0027084 3300048921 Bacteria 4859
355 Ga0496119_0033941 3300048922 Bacteria 3371
356 Ga0496121_0000855 3300048924 Bacteria 55079
357 Ga0496121_0003941 3300048924 Bacteria 20545
358 Ga0496122_0023626 3300048925 Bacteria 5407
359 Ga0496123_0004744 3300048926 Bacteria 14070
360 Ga0496124_0042203 3300048927 Bacteria 3929
361 Ga0496125_0000598 3300048928 Bacteria 61438
362 Ga0496126_0159262 3300048929 Bacteria 1930
363 Ga0496126_0406879 3300048929 Bacteria 1102
364 Ga0495678_000786 3300049459 Bacteria 28456
365 Ga0501034_0027748 3300049571 Bacteria 5757
366 Ga0501034_0093180 3300049571 Bacteria 3009
367 Ga0501034_0312050 3300049571 Bacteria 1507
368 Ga0501034_0361152 3300049571 Bacteria 1379
369 Ga0501043_0268838 3300049579 Bacteria 1309
370 Ga0501047_0054381 3300049581 Bacteria 3872
371 Ga0501047_0187154 3300049581 Bacteria 1935
372 Ga0501238_001895 3300049671 Bacteria 2442
373 Ga0501044_0006012 3300049823 Bacteria 13408
374 nmdc:mga03n38_12738_c1 3300050490 Bacteria 3174
375 nmdc:mga03n38_154441_c1 3300050490 Bacteria 1157
376 nmdc:mga00v17_1879_c1 3300050491 Bacteria 10863
377 nmdc:mga0k408_20665_c2 3300050493 Bacteria 3229
378 nmdc:mga0k408_234756_c1 3300050493 Bacteria 1095
379 nmdc:mga07m45_17172_c1 3300050496 Bacteria 3882
380 nmdc:mga07m45_66846_c1 3300050496 Bacteria 2043
381 Ga0500635_0000102 3300053080 Bacteria 51023
382 Ga0500635_0000588 3300053080 Bacteria 9634
383 Ga0500578_0001292 3300053086 Bacteria 25857
384 Ga0500578_0098947 3300053086 Bacteria 1847
385 Ga0500643_008427 3300053087 Bacteria 4050
386 Ga0500643_018068 3300053087 Bacteria 2348
387 Ga0500644_0000254 3300053088 Bacteria 30245
388 Ga0500644_0008853 3300053088 Bacteria 2670
389 Ga0500644_0016324 3300053088 Bacteria 2136
390 Ga0500583_0063170 3300053092 Bacteria 1753
391 Ga0500651_0020132 3300053093 Bacteria 4152
392 Ga0500651_0032276 3300053093 Bacteria 3300
393 Ga0500566_0065830 3300053094 Bacteria 2043
394 Ga0500641_0001385 3300053096 Bacteria 8645
395 Ga0500641_0030209 3300053096 Bacteria 2127
396 Ga0500654_140937 3300053099 Bacteria 879
397 Ga0500556_0000611 3300053104 Bacteria 22870
398 Ga0500556_0003435 3300053104 Bacteria 4664
399 Ga0500556_0023080 3300053104 Bacteria 2028
400 Ga0500556_0046738 3300053104 Bacteria 1550
401 Ga0500562_000828 3300053108 Bacteria 7536
402 Ga0500562_000898 3300053108 Bacteria 7232
403 Ga0500562_001766 3300053108 Bacteria 5405
404 Ga0500569_002004 3300053109 Bacteria 3952
405 Ga0500594_0000101 3300053118 Bacteria 25282
406 Ga0500595_004866 3300053119 Bacteria 5945
407 Ga0500595_009159 3300053119 Bacteria 4009
408 Ga0500595_020823 3300053119 Bacteria 2352
409 Ga0500607_075641 3300053121 Bacteria 1728
410 Ga0500608_000007 3300053122 Bacteria 100296
411 Ga0500608_002647 3300053122 Bacteria 6563
412 Ga0500608_017092 3300053122 Bacteria 3289
413 Ga0500614_002150 3300053123 Bacteria 4491
414 Ga0500618_000448 3300053125 Bacteria 26872
415 Ga0500652_121823 3300053131 Bacteria 1090
416 Ga0500559_0000232 3300053136 Bacteria 44275
417 Ga0500559_0022356 3300053136 Bacteria 2681
418 Ga0500564_000054 3300053138 Bacteria 29883
419 Ga0500577_0000570 3300053142 Bacteria 9524
420 Ga0500577_0114137 3300053142 Bacteria 1118
421 Ga0500590_019373 3300053148 Bacteria 3526
422 Ga0500603_013613 3300053150 Bacteria 1888
423 Ga0500604_0022004 3300053151 Bacteria 1807
424 Ga0500616_0010042 3300053153 Bacteria 5689
425 Ga0500616_0122033 3300053153 Bacteria 1243
426 Ga0500622_0001613 3300053156 Bacteria 17711
427 Ga0500622_0005804 3300053156 Bacteria 7318
428 Ga0500622_0012037 3300053156 Bacteria 4700
429 Ga0500622_0048885 3300053156 Bacteria 2181
430 Ga0500624_004685 3300053157 Bacteria 1806
431 Ga0500627_0161255 3300053158 Bacteria 1012
432 Ga0500633_0014851 3300053160 Bacteria 2221
433 Ga0500634_0101273 3300053161 Bacteria 1441
434 Ga0500638_081416 3300053162 Bacteria 1537
435 Ga0500636_0008328 3300053177 Bacteria 6014
436 Ga0500636_0095765 3300053177 Bacteria 1694
437 Ga0500625_125097 3300053729 Bacteria 1024
438 Ga0500645_000853 3300053730 Bacteria 17865
439 Ga0500645_002537 3300053730 Bacteria 8060
440 Ga0500645_010257 3300053730 Bacteria 3107
441 Ga0500609_004090 3300053731 Bacteria 2030
442 Ga0500596_000174 3300053735 Bacteria 10274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0254761 Ga0495633_0254761_19_714 226
2 3300003781 Ga0055536_1001292 Ga0055536_100129210 252
3 3300003791 Ga0055530_10005357 Ga0055530_100053571 252
4 3300025292 Ga0209676_1000422 Ga0209676_100042269 252
5 3300025298 Ga0209050_1000463 Ga0209050_100046315 252
6 3300025303 Ga0209051_1013007 Ga0209051_10130073 252
7 3300048929 Ga0496126_0406879 Ga0496126_0406879_92_928 254
8 3300003781 Ga0055536_1003995 Ga0055536_10039953 257
9 3300003791 Ga0055530_10008623 Ga0055530_100086233 257
10 3300003794 Ga0055531_10002210 Ga0055531_1000221014 257
11 3300025292 Ga0209676_1002114 Ga0209676_10021145 257
12 3300025298 Ga0209050_1001754 Ga0209050_10017544 257
13 3300025304 Ga0209257_1001679 Ga0209257_100167920 257
14 3300053156 Ga0500622_0005804 Ga0500622_0005804_2479_3315 257
15 3300053119 Ga0500595_004866 Ga0500595_004866_4427_5206 258
16 3300005563 Ga0068855_100121178 Ga0068855_1001211782 259
17 3300021384 Ga0213876_10011726 Ga0213876_100117263 259
18 3300025913 Ga0207695_10006375 Ga0207695_1000637510 259
19 3300025949 Ga0207667_10601063 Ga0207667_106010631 259
20 3300039437 Ga0436365_1544656 Ga0436365_1544656_106287_107066 259
21 3300031251 Ga0265327_10000568 Ga0265327_1000056825 260
22 3300046616 Ga0495668_0000060 Ga0495668_0000060_21854_22690 260
23 3300009093 Ga0105240_10001656 Ga0105240_1000165613 262
24 3300005844 Ga0068862_100051836 Ga0068862_1000518363 263
25 3300028380 Ga0268265_10058189 Ga0268265_100581893 263
26 3300037068 Ga0373925_0221216 Ga0373925_0221216_87_887 263
27 3300005458 Ga0070681_10058150 Ga0070681_100581502 265
28 3300005563 Ga0068855_100025982 Ga0068855_1000259826 265
29 3300005563 Ga0068855_100072192 Ga0068855_1000721925 265
30 3300005616 Ga0068852_100247765 Ga0068852_1002477652 265
31 3300006186 Ga0075369_10005214 Ga0075369_100052146 265
32 3300009093 Ga0105240_10294416 Ga0105240_102944163 265
33 3300013104 Ga0157370_10201153 Ga0157370_102011533 265
34 3300025913 Ga0207695_10024675 Ga0207695_100246756 265
35 3300025949 Ga0207667_10063682 Ga0207667_100636825 265
36 3300025949 Ga0207667_10113878 Ga0207667_101138782 265
37 3300037312 Ga0395899_0049611 Ga0395899_0049611_1282_2088 265
38 3300037418 Ga0395900_0154569 Ga0395900_0154569_1109_1915 265
39 3300037418 Ga0395900_0534342 Ga0395900_0534342_111_917 265
40 3300048927 Ga0496124_0042203 Ga0496124_0042203_1886_2722 265
41 3300049581 Ga0501047_0187154 Ga0501047_0187154_989_1795 265
42 3300053122 Ga0500608_000007 Ga0500608_000007_40809_41645 266
43 iso_pu_bacteria 2643221614 2644084748 267
44 iso_pu_bacteria 2643221661 2644342300 267
45 iso_pu_bacteria 2643221666 2644365600 267
46 3300031711 Ga0265314_10090222 Ga0265314_100902222 268
47 3300031251 Ga0265327_10004036 Ga0265327_100040363 269
48 3300037471 Ga0395905_0414371 Ga0395905_0414371_404_1222 269
49 iso_pu_bacteria 2928972540 2928975218 269
50 iso_pu_bacteria 2941485952 2941488535 269
51 iso_pu_bacteria 2977240413 2977241788 269
52 iso_pu_bacteria 2510917020 2511124101 270
53 iso_pu_bacteria 2582581279 2585146907 270
54 iso_pu_bacteria 2582581280 2585154799 270
55 iso_pu_bacteria 2582581293 2585198315 270
56 iso_pu_bacteria 2585428106 2587919418 270
57 iso_pu_bacteria 2643221545 2643750799 270
58 iso_pu_bacteria 2643221552 2643779246 270
59 iso_pu_bacteria 2643221574 2643883627 270
60 iso_pu_bacteria 2643221583 2643925667 270
61 iso_pu_bacteria 2643221584 2643928025 270
62 iso_pu_bacteria 2643221640 2644225248 270
63 iso_pu_bacteria 2643221642 2644232556 270
64 iso_pu_bacteria 2643221663 2644354351 270
65 iso_pu_bacteria 2643221691 2644509873 270
66 iso_pu_bacteria 2643221699 2644551840 270
67 iso_pu_bacteria 2643221699 2644553131 270
68 iso_pu_bacteria 2791355048 2792463418 270
69 iso_pu_bacteria 2818991435 2819540032 270
70 iso_pu_bacteria 2818991454 2819648968 270
71 iso_pu_bacteria 2843744320 2843748983 270
72 iso_pu_bacteria 2849560528 2849562968 270
73 iso_pu_bacteria 2849573788 2849573919 270
74 iso_pu_bacteria 2851153111 2851155584 270
75 iso_pu_bacteria 2857504554 2857504619 270
76 iso_pu_bacteria 2884960567 2884960724 270
77 iso_pu_bacteria 2898329390 2898333685 270
78 iso_pu_bacteria 2928531327 2928534376 270
79 3300005334 Ga0068869_100016197 Ga0068869_1000161973 271
80 3300005355 Ga0070671_100208388 Ga0070671_1002083881 271
81 3300005457 Ga0070662_100186466 Ga0070662_1001864662 271
82 3300005564 Ga0070664_100157762 Ga0070664_1001577621 271
83 3300005618 Ga0068864_100048055 Ga0068864_1000480553 271
84 3300006028 Ga0070717_10063852 Ga0070717_100638523 271
85 3300006358 Ga0068871_100333480 Ga0068871_1003334802 271
86 3300006881 Ga0068865_100000215 Ga0068865_10000021519 271
87 3300009093 Ga0105240_10952201 Ga0105240_109522011 271
88 3300009177 Ga0105248_10001025 Ga0105248_1000102514 271
89 3300009545 Ga0105237_10186076 Ga0105237_101860762 271
90 3300009551 Ga0105238_10047484 Ga0105238_100474844 271
91 3300013100 Ga0157373_10002798 Ga0157373_100027985 271
92 3300014325 Ga0163163_10138927 Ga0163163_101389273 271
93 3300014325 Ga0163163_10458588 Ga0163163_104585881 271
94 3300025924 Ga0207694_10011988 Ga0207694_100119883 271
95 3300025931 Ga0207644_10012909 Ga0207644_100129093 271
96 3300025931 Ga0207644_10395277 Ga0207644_103952772 271
97 3300025931 Ga0207644_10522840 Ga0207644_105228401 271
98 3300025933 Ga0207706_10259809 Ga0207706_102598092 271
99 3300025938 Ga0207704_10001951 Ga0207704_100019513 271
100 3300025941 Ga0207711_10003429 Ga0207711_100034293 271
101 3300025942 Ga0207689_10210645 Ga0207689_102106453 271
102 3300026041 Ga0207639_10315343 Ga0207639_103153431 271
103 3300026142 Ga0207698_10807499 Ga0207698_108074991 271
104 3300028379 Ga0268266_10125587 Ga0268266_101255871 271
105 3300028786 Ga0307517_10002579 Ga0307517_100025797 271
106 3300031456 Ga0307513_10001556 Ga0307513_100015563 271
107 3300031456 Ga0307513_10015667 Ga0307513_100156679 271
108 3300031901 Ga0307406_10264450 Ga0307406_102644502 271
109 3300033180 Ga0307510_10017505 Ga0307510_100175057 271
110 3300037312 Ga0395899_0000187 Ga0395899_0000187_13588_14412 271
111 3300037418 Ga0395900_0001321 Ga0395900_0001321_15251_16075 271
112 3300037466 Ga0395898_0003504 Ga0395898_0003504_10145_10969 271
113 3300037471 Ga0395905_0013956 Ga0395905_0013956_1333_2157 271
114 3300038443 Ga0395901_0000412 Ga0395901_0000412_14019_14843 271
115 3300046491 Ga0495584_0175676 Ga0495584_0175676_232_1056 271
116 3300046506 Ga0495583_0006763 Ga0495583_0006763_814_1638 271
117 3300046528 Ga0495642_0051674 Ga0495642_0051674_399_1223 271
118 3300046616 Ga0495668_0088314 Ga0495668_0088314_314_1138 271
119 3300046648 Ga0495611_0009851 Ga0495611_0009851_993_1817 271
120 3300046660 Ga0495625_0036173 Ga0495625_0036173_2614_3438 271
121 3300047318 Ga0495636_0032781 Ga0495636_0032781_485_1309 271
122 3300047319 Ga0495674_0147830 Ga0495674_0147830_702_1526 271
123 3300047320 Ga0495672_0047823 Ga0495672_0047823_1146_1970 271
124 3300048911 Ga0496108_0015302 Ga0496108_0015302_2005_2964 271
125 3300048911 Ga0496108_0596887 Ga0496108_0596887_84_908 271
126 3300048912 Ga0496109_0021809 Ga0496109_0021809_2206_3165 271
127 3300048915 Ga0496112_0040935 Ga0496112_0040935_3270_4094 271
128 3300048915 Ga0496112_0047372 Ga0496112_0047372_2558_3517 271
129 3300048916 Ga0496113_0486366 Ga0496113_0486366_117_941 271
130 3300053087 Ga0500643_008427 Ga0500643_008427_2480_3304 271
131 3300053096 Ga0500641_0001385 Ga0500641_0001385_638_1462 271
132 3300053104 Ga0500556_0003435 Ga0500556_0003435_1779_2603 271
133 3300053104 Ga0500556_0023080 Ga0500556_0023080_552_1376 271
134 3300053108 Ga0500562_000898 Ga0500562_000898_889_1713 271
135 3300053131 Ga0500652_121823 Ga0500652_121823_171_995 271
136 3300053151 Ga0500604_0022004 Ga0500604_0022004_798_1622 271
137 3300053153 Ga0500616_0010042 Ga0500616_0010042_2377_3201 271
138 3300053156 Ga0500622_0012037 Ga0500622_0012037_2485_3309 271
139 3300053158 Ga0500627_0161255 Ga0500627_0161255_84_908 271
140 3300053730 Ga0500645_002537 Ga0500645_002537_3411_4235 271
141 3300053730 Ga0500645_010257 Ga0500645_010257_531_1355 271
142 3300005366 Ga0070659_100056213 Ga0070659_1000562133 272
143 3300005539 Ga0068853_100035468 Ga0068853_1000354684 272
144 3300005564 Ga0070664_100003912 Ga0070664_1000039126 272
145 3300013100 Ga0157373_10010121 Ga0157373_100101215 272
146 3300025932 Ga0207690_10026020 Ga0207690_100260203 272
147 3300025945 Ga0207679_10001983 Ga0207679_100019836 272
148 3300026041 Ga0207639_10024339 Ga0207639_100243394 272
149 3300035089 Ga0373944_0017378 Ga0373944_0017378_435_1262 272
150 3300035695 Ga0373927_0000368 Ga0373927_0000368_30416_31243 272
151 3300037068 Ga0373925_0000507 Ga0373925_0000507_34837_35664 272
152 3300037312 Ga0395899_0000013 Ga0395899_0000013_245285_246109 272
153 3300039447 Ga0436361_0021486 Ga0436361_0021486_158_988 272
154 3300039447 Ga0436361_0255562 Ga0436361_0255562_500_1318 272
155 3300045049 Ga0466959_0331332 Ga0466959_0331332_125_949 272
156 3300048918 Ga0496115_0323328 Ga0496115_0323328_234_1064 272
157 3300053142 Ga0500577_0114137 Ga0500577_0114137_69_896 272
158 3300003578 Ga0006562J51391_1072425 Ga0006562J51391_10724255 273
159 3300003578 Ga0006562J51391_1072426 Ga0006562J51391_10724264 273
160 3300005339 Ga0070660_100377269 Ga0070660_1003772692 273
161 3300005366 Ga0070659_100012605 Ga0070659_1000126053 273
162 3300005458 Ga0070681_10006887 Ga0070681_1000688711 273
163 3300005530 Ga0070679_100029997 Ga0070679_1000299977 273
164 3300005539 Ga0068853_100036577 Ga0068853_1000365774 273
165 3300005563 Ga0068855_100014248 Ga0068855_10001424811 273
166 3300009177 Ga0105248_10830082 Ga0105248_108300822 273
167 3300009551 Ga0105238_10349072 Ga0105238_103490722 273
168 3300013104 Ga0157370_10005877 Ga0157370_1000587713 273
169 3300013104 Ga0157370_10351206 Ga0157370_103512062 273
170 3300013105 Ga0157369_10105315 Ga0157369_101053152 273
171 3300025909 Ga0207705_10003067 Ga0207705_1000306712 273
172 3300025912 Ga0207707_10015719 Ga0207707_100157193 273
173 3300025917 Ga0207660_10005502 Ga0207660_100055023 273
174 3300025919 Ga0207657_10017123 Ga0207657_100171234 273
175 3300025921 Ga0207652_10014581 Ga0207652_100145814 273
176 3300025932 Ga0207690_10015504 Ga0207690_100155044 273
177 3300026041 Ga0207639_10068081 Ga0207639_100680813 273
178 3300026142 Ga0207698_10628212 Ga0207698_106282121 273
179 3300028800 Ga0265338_10254144 Ga0265338_102541441 273
180 3300031456 Ga0307513_10000162 Ga0307513_1000016257 273
181 3300031730 Ga0307516_10000820 Ga0307516_1000082027 273
182 3300032004 Ga0307414_10209938 Ga0307414_102099382 273
183 3300046539 Ga0495621_0069268 Ga0495621_0069268_146_979 273
184 3300046684 Ga0495669_0000196 Ga0495669_0000196_7034_7864 273
185 3300046684 Ga0495669_0000407 Ga0495669_0000407_2085_2915 273
186 3300046694 Ga0495649_0001628 Ga0495649_0001628_6622_7464 273
187 3300048925 Ga0496122_0023626 Ga0496122_0023626_1429_2265 273
188 3300048926 Ga0496123_0004744 Ga0496123_0004744_3499_4335 273
189 3300048928 Ga0496125_0000598 Ga0496125_0000598_54211_55056 273
190 3300049571 Ga0501034_0027748 Ga0501034_0027748_260_1096 273
191 3300053108 Ga0500562_000828 Ga0500562_000828_1609_2439 273
192 3300003322 rootL2_10253124 rootL2_102531241 274
193 3300003773 Ga0055537_1012150 Ga0055537_10121502 274
194 3300003781 Ga0055536_1009691 Ga0055536_10096913 274
195 3300003790 Ga0055528_1020876 Ga0055528_10208762 274
196 3300003791 Ga0055530_10003575 Ga0055530_100035753 274
197 3300003794 Ga0055531_10009893 Ga0055531_100098933 274
198 3300003794 Ga0055531_10014056 Ga0055531_100140563 274
199 3300003794 Ga0055531_10026710 Ga0055531_100267103 274
200 3300005262 Ga0065165_1000506 Ga0065165_100050665 274
201 3300005262 Ga0065165_1001123 Ga0065165_10011232 274
202 3300005262 Ga0065165_1005703 Ga0065165_10057035 274
203 3300005327 Ga0070658_10057801 Ga0070658_100578014 274
204 3300005331 Ga0070670_100000062 Ga0070670_10000006295 274
205 3300005335 Ga0070666_10067022 Ga0070666_100670223 274
206 3300005335 Ga0070666_10122631 Ga0070666_101226312 274
207 3300005341 Ga0070691_10006841 Ga0070691_100068415 274
208 3300005347 Ga0070668_100000756 Ga0070668_10000075615 274
209 3300005347 Ga0070668_100001425 Ga0070668_10000142514 274
210 3300005347 Ga0070668_100021162 Ga0070668_1000211621 274
211 3300005353 Ga0070669_100058247 Ga0070669_1000582472 274
212 3300005355 Ga0070671_100099095 Ga0070671_1000990953 274
213 3300005366 Ga0070659_100004424 Ga0070659_10000442410 274
214 3300005367 Ga0070667_100000992 Ga0070667_1000009923 274
215 3300005367 Ga0070667_100001445 Ga0070667_1000014453 274
216 3300005458 Ga0070681_10020866 Ga0070681_100208663 274
217 3300005530 Ga0070679_100013405 Ga0070679_1000134054 274
218 3300005539 Ga0068853_100151348 Ga0068853_1001513482 274
219 3300005548 Ga0070665_100000121 Ga0070665_10000012196 274
220 3300005548 Ga0070665_100000735 Ga0070665_10000073532 274
221 3300005548 Ga0070665_100019396 Ga0070665_1000193962 274
222 3300005563 Ga0068855_100086495 Ga0068855_1000864952 274
223 3300005563 Ga0068855_100254541 Ga0068855_1002545412 274
224 3300005578 Ga0068854_100435518 Ga0068854_1004355181 274
225 3300005614 Ga0068856_100328572 Ga0068856_1003285722 274
226 3300005617 Ga0068859_100000401 Ga0068859_1000004012 274
227 3300005618 Ga0068864_100000272 Ga0068864_1000002722 274
228 3300005841 Ga0068863_100001838 Ga0068863_10000183818 274
229 3300005841 Ga0068863_100009604 Ga0068863_1000096043 274
230 3300005841 Ga0068863_100020721 Ga0068863_1000207217 274
231 3300005842 Ga0068858_100000820 Ga0068858_10000082031 274
232 3300005842 Ga0068858_100114129 Ga0068858_1001141293 274
233 3300005842 Ga0068858_100361683 Ga0068858_1003616832 274
234 3300005843 Ga0068860_100001184 Ga0068860_10000118416 274
235 3300005843 Ga0068860_100192403 Ga0068860_1001924032 274
236 3300005844 Ga0068862_100001790 Ga0068862_1000017905 274
237 3300005844 Ga0068862_100008689 Ga0068862_1000086894 274
238 3300006042 Ga0075368_10026723 Ga0075368_100267232 274
239 3300006051 Ga0075364_10002233 Ga0075364_1000223312 274
240 3300006177 Ga0075362_10136976 Ga0075362_101369761 274
241 3300006178 Ga0075367_10002882 Ga0075367_100028821 274
242 3300006195 Ga0075366_10119247 Ga0075366_101192472 274
243 3300006353 Ga0075370_10037037 Ga0075370_100370372 274
244 3300006353 Ga0075370_10082479 Ga0075370_100824792 274
245 3300006931 Ga0097620_100000401 Ga0097620_1000004012 274
246 3300009093 Ga0105240_10011605 Ga0105240_1001160512 274
247 3300009093 Ga0105240_10037936 Ga0105240_100379362 274
248 3300009093 Ga0105240_10037992 Ga0105240_100379923 274
249 3300009093 Ga0105240_10051911 Ga0105240_100519113 274
250 3300009093 Ga0105240_10244486 Ga0105240_102444863 274
251 3300009148 Ga0105243_10788709 Ga0105243_107887091 274
252 3300009174 Ga0105241_10028448 Ga0105241_100284482 274
253 3300009176 Ga0105242_10095718 Ga0105242_100957182 274
254 3300009177 Ga0105248_10002925 Ga0105248_1000292516 274
255 3300009177 Ga0105248_10010874 Ga0105248_100108746 274
256 3300009177 Ga0105248_10048209 Ga0105248_100482093 274
257 3300009177 Ga0105248_10166808 Ga0105248_101668082 274
258 3300009551 Ga0105238_10032425 Ga0105238_100324251 274
259 3300009551 Ga0105238_10233617 Ga0105238_102336172 274
260 3300010375 Ga0105239_10072031 Ga0105239_100720314 274
261 3300013306 Ga0163162_10115659 Ga0163162_101156593 274
262 3300014325 Ga0163163_10002216 Ga0163163_1000221611 274
263 3300014325 Ga0163163_10021374 Ga0163163_100213744 274
264 3300014968 Ga0157379_10010279 Ga0157379_100102795 274
265 3300014968 Ga0157379_10023996 Ga0157379_100239964 274
266 3300014968 Ga0157379_10039319 Ga0157379_100393196 274
267 3300014968 Ga0157379_10171188 Ga0157379_101711883 274
268 3300021384 Ga0213876_10091378 Ga0213876_100913782 274
269 3300025250 Ga0209026_1000665 Ga0209026_100066514 274
270 3300025263 Ga0209565_1000268 Ga0209565_100026854 274
271 3300025273 Ga0209673_1000600 Ga0209673_10006002 274
272 3300025291 Ga0209675_1013552 Ga0209675_10135522 274
273 3300025292 Ga0209676_1000733 Ga0209676_100073314 274
274 3300025292 Ga0209676_1001881 Ga0209676_10018813 274
275 3300025295 Ga0209564_1014304 Ga0209564_10143043 274
276 3300025295 Ga0209564_1028146 Ga0209564_10281462 274
277 3300025297 Ga0209758_1003091 Ga0209758_10030917 274
278 3300025297 Ga0209758_1003541 Ga0209758_10035413 274
279 3300025297 Ga0209758_1004330 Ga0209758_100433016 274
280 3300025298 Ga0209050_1000161 Ga0209050_1000161173 274
281 3300025298 Ga0209050_1006498 Ga0209050_10064984 274
282 3300025299 Ga0209256_1000784 Ga0209256_100078428 274
283 3300025299 Ga0209256_1002149 Ga0209256_10021499 274
284 3300025304 Ga0209257_1000252 Ga0209257_10002523 274
285 3300025304 Ga0209257_1000687 Ga0209257_10006879 274
286 3300025304 Ga0209257_1000696 Ga0209257_100069610 274
287 3300025304 Ga0209257_1001589 Ga0209257_10015893 274
288 3300025900 Ga0207710_10158519 Ga0207710_101585191 274
289 3300025903 Ga0207680_10006205 Ga0207680_100062053 274
290 3300025912 Ga0207707_10135330 Ga0207707_101353303 274
291 3300025913 Ga0207695_10000575 Ga0207695_1000057585 274
292 3300025913 Ga0207695_10001510 Ga0207695_1000151020 274
293 3300025913 Ga0207695_10080511 Ga0207695_100805112 274
294 3300025914 Ga0207671_10435470 Ga0207671_104354701 274
295 3300025921 Ga0207652_10027838 Ga0207652_100278384 274
296 3300025923 Ga0207681_10025593 Ga0207681_100255932 274
297 3300025925 Ga0207650_10000084 Ga0207650_1000008495 274
298 3300025925 Ga0207650_10039269 Ga0207650_100392693 274
299 3300025931 Ga0207644_10009319 Ga0207644_100093196 274
300 3300025932 Ga0207690_10000255 Ga0207690_1000025525 274
301 3300025941 Ga0207711_10011176 Ga0207711_100111763 274
302 3300025941 Ga0207711_10016724 Ga0207711_100167243 274
303 3300025961 Ga0207712_10003816 Ga0207712_100038165 274
304 3300025972 Ga0207668_10000032 Ga0207668_1000003232 274
305 3300025972 Ga0207668_10001102 Ga0207668_100011026 274
306 3300025981 Ga0207640_10383365 Ga0207640_103833651 274
307 3300025986 Ga0207658_10002456 Ga0207658_100024568 274
308 3300025986 Ga0207658_10007654 Ga0207658_100076545 274
309 3300026035 Ga0207703_10000133 Ga0207703_1000013332 274
310 3300026035 Ga0207703_10010959 Ga0207703_100109596 274
311 3300026035 Ga0207703_10081703 Ga0207703_100817033 274
312 3300026067 Ga0207678_10208080 Ga0207678_102080802 274
313 3300026088 Ga0207641_10000168 Ga0207641_1000016831 274
314 3300026088 Ga0207641_10007435 Ga0207641_100074357 274
315 3300026088 Ga0207641_10046039 Ga0207641_100460392 274
316 3300026095 Ga0207676_10001565 Ga0207676_100015652 274
317 3300026095 Ga0207676_10078875 Ga0207676_100788751 274
318 3300027866 Ga0209813_10017671 Ga0209813_100176712 274
319 3300028379 Ga0268266_10000106 Ga0268266_1000010668 274
320 3300028379 Ga0268266_10004308 Ga0268266_1000430813 274
321 3300028379 Ga0268266_10029655 Ga0268266_100296552 274
322 3300028380 Ga0268265_10010090 Ga0268265_100100904 274
323 3300028380 Ga0268265_10016912 Ga0268265_100169123 274
324 3300028380 Ga0268265_10179634 Ga0268265_101796343 274
325 3300028380 Ga0268265_10189122 Ga0268265_101891222 274
326 3300028381 Ga0268264_10000383 Ga0268264_1000038367 274
327 3300028381 Ga0268264_10290907 Ga0268264_102909071 274
328 3300028794 Ga0307515_10024951 Ga0307515_100249513 274
329 3300028794 Ga0307515_10076755 Ga0307515_100767552 274
330 3300030521 Ga0307511_10012159 Ga0307511_100121593 274
331 3300031901 Ga0307406_10001031 Ga0307406_1000103111 274
332 3300031911 Ga0307412_10012905 Ga0307412_100129056 274
333 3300032004 Ga0307414_10044749 Ga0307414_100447492 274
334 3300032004 Ga0307414_10052352 Ga0307414_100523522 274
335 3300032004 Ga0307414_10083104 Ga0307414_100831042 274
336 3300032004 Ga0307414_10283865 Ga0307414_102838652 274
337 3300039437 Ga0436365_0959321 Ga0436365_0959321_658_1488 274
338 3300039437 Ga0436365_1332887 Ga0436365_1332887_316_1146 274
339 3300042004 Ga0439445_0006851 Ga0439445_0006851_902_1738 274
340 3300042436 Ga0439435_0003429 Ga0439435_0003429_1085_1921 274
341 3300044706 Ga0466964_0140130 Ga0466964_0140130_38_874 274
342 3300044706 Ga0466964_0194306 Ga0466964_0194306_123_953 274
343 3300046453 Ga0495627_000814 Ga0495627_000814_9690_10526 274
344 3300046457 Ga0495590_0000543 Ga0495590_0000543_16732_17568 274
345 3300046460 Ga0495638_0000837 Ga0495638_0000837_12170_13006 274
346 3300046460 Ga0495638_0002445 Ga0495638_0002445_10062_10898 274
347 3300046460 Ga0495638_0006641 Ga0495638_0006641_1049_1885 274
348 3300046460 Ga0495638_0008327 Ga0495638_0008327_734_1570 274
349 3300046471 Ga0495650_0000020 Ga0495650_0000020_193674_194510 274
350 3300046492 Ga0495585_0088412 Ga0495585_0088412_362_1192 274
351 3300046501 Ga0495607_0039775 Ga0495607_0039775_1648_2484 274
352 3300046506 Ga0495583_0000069 Ga0495583_0000069_165536_166372 274
353 3300046507 Ga0495606_0012171 Ga0495606_0012171_5178_6014 274
354 3300046512 Ga0495610_0000092 Ga0495610_0000092_77264_78100 274
355 3300046512 Ga0495610_0002246 Ga0495610_0002246_9001_9837 274
356 3300046512 Ga0495610_0003620 Ga0495610_0003620_10801_11637 274
357 3300046513 Ga0495616_0002407 Ga0495616_0002407_216_1052 274
358 3300046515 Ga0495620_0062186 Ga0495620_0062186_557_1420 274
359 3300046518 Ga0495631_0001468 Ga0495631_0001468_445_1281 274
360 3300046519 Ga0495632_0002860 Ga0495632_0002860_768_1604 274
361 3300046520 Ga0495637_0017814 Ga0495637_0017814_2248_3084 274
362 3300046522 Ga0495643_0012771 Ga0495643_0012771_3027_3890 274
363 3300046524 Ga0495648_0001063 Ga0495648_0001063_7641_8477 274
364 3300046530 Ga0495654_0000010 Ga0495654_0000010_157387_158223 274
365 3300046542 Ga0495597_0005278 Ga0495597_0005278_4461_5324 274
366 3300046542 Ga0495597_0035196 Ga0495597_0035196_1210_2046 274
367 3300046557 Ga0495622_0012307 Ga0495622_0012307_687_1550 274
368 3300046558 Ga0495633_0054952 Ga0495633_0054952_762_1598 274
369 3300046616 Ga0495668_0009021 Ga0495668_0009021_966_1802 274
370 3300046616 Ga0495668_0009229 Ga0495668_0009229_3294_4130 274
371 3300046616 Ga0495668_0065153 Ga0495668_0065153_1025_1861 274
372 3300046616 Ga0495668_0128842 Ga0495668_0128842_77_940 274
373 3300046660 Ga0495625_0000295 Ga0495625_0000295_30853_31689 274
374 3300046660 Ga0495625_0003355 Ga0495625_0003355_7460_8296 274
375 3300046660 Ga0495625_0005189 Ga0495625_0005189_5521_6357 274
376 3300046660 Ga0495625_0005990 Ga0495625_0005990_60_896 274
377 3300046660 Ga0495625_0035656 Ga0495625_0035656_2569_3405 274
378 3300046660 Ga0495625_0046437 Ga0495625_0046437_1878_2714 274
379 3300046660 Ga0495625_0051133 Ga0495625_0051133_2080_2916 274
380 3300046660 Ga0495625_0082230 Ga0495625_0082230_796_1632 274
381 3300046684 Ga0495669_0019338 Ga0495669_0019338_1377_2207 274
382 3300046794 Ga0495589_0045914 Ga0495589_0045914_842_1678 274
383 3300046810 Ga0495660_0013917 Ga0495660_0013917_3034_3870 274
384 3300047320 Ga0495672_0003177 Ga0495672_0003177_3882_4718 274
385 3300047446 Ga0495679_012177 Ga0495679_012177_879_1715 274
386 3300047469 Ga0495673_0000272 Ga0495673_0000272_28651_29487 274
387 3300047469 Ga0495673_0001128 Ga0495673_0001128_2793_3629 274
388 3300047469 Ga0495673_0003005 Ga0495673_0003005_1883_2719 274
389 3300047472 Ga0495686_0001631 Ga0495686_0001631_8477_9313 274
390 3300047472 Ga0495686_0003519 Ga0495686_0003519_10262_11095 274
391 3300047472 Ga0495686_0006940 Ga0495686_0006940_3137_3973 274
392 3300047472 Ga0495686_0057625 Ga0495686_0057625_124_960 274
393 3300048088 Ga0495602_0101069 Ga0495602_0101069_113_976 274
394 3300048905 Ga0496102_0009772 Ga0496102_0009772_4342_5172 274
395 3300048905 Ga0496102_0031297 Ga0496102_0031297_2266_3096 274
396 3300048907 Ga0496104_0124048 Ga0496104_0124048_1548_2381 274
397 3300048908 Ga0496105_0499793 Ga0496105_0499793_25_855 274
398 3300048910 Ga0496107_0000111 Ga0496107_0000111_30814_31650 274
399 3300048910 Ga0496107_0053215 Ga0496107_0053215_54_884 274
400 3300048918 Ga0496115_0001542 Ga0496115_0001542_13446_14285 274
401 3300048918 Ga0496115_0002932 Ga0496115_0002932_8716_9549 274
402 3300048918 Ga0496115_0010459 Ga0496115_0010459_3686_4522 274
403 3300048918 Ga0496115_0230004 Ga0496115_0230004_664_1497 274
404 3300048918 Ga0496115_0351032 Ga0496115_0351032_179_1015 274
405 3300048919 Ga0496116_0027591 Ga0496116_0027591_1688_2518 274
406 3300048920 Ga0496117_0024299 Ga0496117_0024299_1594_2424 274
407 3300048921 Ga0496118_0027084 Ga0496118_0027084_1256_2086 274
408 3300048922 Ga0496119_0033941 Ga0496119_0033941_1967_2797 274
409 3300048924 Ga0496121_0000855 Ga0496121_0000855_22967_23797 274
410 3300048924 Ga0496121_0003941 Ga0496121_0003941_7366_8202 274
411 3300048929 Ga0496126_0159262 Ga0496126_0159262_600_1436 274
412 3300049459 Ga0495678_000786 Ga0495678_000786_8131_8967 274
413 3300049571 Ga0501034_0312050 Ga0501034_0312050_352_1185 274
414 3300049579 Ga0501043_0268838 Ga0501043_0268838_388_1221 274
415 3300049581 Ga0501047_0054381 Ga0501047_0054381_2085_2918 274
416 3300049671 Ga0501238_001895 Ga0501238_001895_1414_2250 274
417 3300049823 Ga0501044_0006012 Ga0501044_0006012_7681_8514 274
418 3300050490 nmdc:mga03n38_12738_c1 nmdc:mga03n38_12738_c1_781_1611 274
419 3300050490 nmdc:mga03n38_154441_c1 nmdc:mga03n38_154441_c1_163_999 274
420 3300050491 nmdc:mga00v17_1879_c1 nmdc:mga00v17_1879_c1_587_1417 274
421 3300050493 nmdc:mga0k408_20665_c2 nmdc:mga0k408_20665_c2_1143_1979 274
422 3300050493 nmdc:mga0k408_234756_c1 nmdc:mga0k408_234756_c1_246_1076 274
423 3300050496 nmdc:mga07m45_17172_c1 nmdc:mga07m45_17172_c1_2209_3039 274
424 3300050496 nmdc:mga07m45_66846_c1 nmdc:mga07m45_66846_c1_432_1262 274
425 3300053080 Ga0500635_0000102 Ga0500635_0000102_42044_42907 274
426 3300053086 Ga0500578_0001292 Ga0500578_0001292_16787_17623 274
427 3300053086 Ga0500578_0098947 Ga0500578_0098947_404_1240 274
428 3300053087 Ga0500643_018068 Ga0500643_018068_329_1159 274
429 3300053088 Ga0500644_0000254 Ga0500644_0000254_15804_16640 274
430 3300053088 Ga0500644_0008853 Ga0500644_0008853_1684_2523 274
431 3300053088 Ga0500644_0016324 Ga0500644_0016324_510_1346 274
432 3300053092 Ga0500583_0063170 Ga0500583_0063170_260_1123 274
433 3300053093 Ga0500651_0020132 Ga0500651_0020132_2458_3321 274
434 3300053093 Ga0500651_0032276 Ga0500651_0032276_1505_2344 274
435 3300053094 Ga0500566_0065830 Ga0500566_0065830_984_1847 274
436 3300053096 Ga0500641_0030209 Ga0500641_0030209_579_1412 274
437 3300053099 Ga0500654_140937 Ga0500654_140937_32_865 274
438 3300053104 Ga0500556_0000611 Ga0500556_0000611_10733_11569 274
439 3300053104 Ga0500556_0046738 Ga0500556_0046738_708_1538 274
440 3300053108 Ga0500562_001766 Ga0500562_001766_4535_5371 274
441 3300053109 Ga0500569_002004 Ga0500569_002004_2375_3238 274
442 3300053118 Ga0500594_0000101 Ga0500594_0000101_16200_17036 274
443 3300053119 Ga0500595_009159 Ga0500595_009159_1428_2291 274
444 3300053119 Ga0500595_020823 Ga0500595_020823_1244_2077 274
445 3300053121 Ga0500607_075641 Ga0500607_075641_194_1057 274
446 3300053122 Ga0500608_017092 Ga0500608_017092_2248_3111 274
447 3300053123 Ga0500614_002150 Ga0500614_002150_504_1367 274
448 3300053125 Ga0500618_000448 Ga0500618_000448_1207_2043 274
449 3300053136 Ga0500559_0000232 Ga0500559_0000232_23736_24572 274
450 3300053136 Ga0500559_0022356 Ga0500559_0022356_336_1199 274
451 3300053138 Ga0500564_000054 Ga0500564_000054_10163_10999 274
452 3300053142 Ga0500577_0000570 Ga0500577_0000570_3368_4204 274
453 3300053148 Ga0500590_019373 Ga0500590_019373_1615_2478 274
454 3300053150 Ga0500603_013613 Ga0500603_013613_621_1484 274
455 3300053153 Ga0500616_0122033 Ga0500616_0122033_115_951 274
456 3300053156 Ga0500622_0001613 Ga0500622_0001613_16734_17570 274
457 3300053156 Ga0500622_0048885 Ga0500622_0048885_769_1605 274
458 3300053157 Ga0500624_004685 Ga0500624_004685_379_1242 274
459 3300053160 Ga0500633_0014851 Ga0500633_0014851_1064_1900 274
460 3300053161 Ga0500634_0101273 Ga0500634_0101273_534_1370 274
461 3300053162 Ga0500638_081416 Ga0500638_081416_171_1034 274
462 3300053177 Ga0500636_0008328 Ga0500636_0008328_621_1484 274
463 3300053177 Ga0500636_0095765 Ga0500636_0095765_416_1279 274
464 3300053729 Ga0500625_125097 Ga0500625_125097_30_893 274
465 3300053730 Ga0500645_000853 Ga0500645_000853_10054_10890 274
466 3300053731 Ga0500609_004090 Ga0500609_004090_769_1605 274
467 3300053735 Ga0500596_000174 Ga0500596_000174_4262_5125 274
468 3300003320 rootH2_10147033 rootH2_101470333 275
469 3300015684 Ga0183365_10003 Ga0183365_10003208 275
470 3300025923 Ga0207681_10077735 Ga0207681_100777352 275
471 3300037853 Ga0436364_0445342 Ga0436364_0445342_1180_2016 275
472 3300049571 Ga0501034_0093180 Ga0501034_0093180_1566_2417 275
473 3300049571 Ga0501034_0361152 Ga0501034_0361152_160_1011 275
474 3300053080 Ga0500635_0000588 Ga0500635_0000588_560_1423 275
475 3300053122 Ga0500608_002647 Ga0500608_002647_5257_6108 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09140

MipZ

ATPase MipZ

64

326

0.99

PF13614

AAA_31

AAA domain

63

124

0.89

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

66

270

0.83

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

62

194

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xj4-assembly1.cif.gz_A structure of the bacterial cell division regulator protein mipz 0.9456 4 265
2xj9-assembly1.cif.gz_A dimer structure of the bacterial cell division regulator mipz 0.9386 3 265
2xit-assembly1.cif.gz_A crystal structure of monomeric mipz 0.9375 2 265
2xj9-assembly1.cif.gz_B dimer structure of the bacterial cell division regulator mipz 0.9349 3 265
2xj9-assembly1.cif.gz_A dimer structure of the bacterial cell division regulator mipz 0.9217 3 265
ID Description Score Start End Superfamily
2xitB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9326 4 265 3.40.50.300
2xitB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8873 4 265 3.40.50.300
4e07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7881 4 263 3.40.50.300
4e07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7676 4 263 3.40.50.300
2erxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6832 108 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A259JCL6-F1-model_v4 deleted 0.9696 1 129
AF-A0A318BDD1-F1-model_v4 ATPase 0.9673 1 167
AF-V4Q615-F1-model_v4 ATPase 0.9629 2 273
AF-A0A318BDD1-F1-model_v4 ATPase 0.9617 1 167
AF-A0A259JCL6-F1-model_v4 deleted 0.9552 1 129

Feature Viewer

pLDDT pTM Quality
85.83 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map