F450635

General Info

Members Datasets Scaffolds Average Seq Length
471 397 310 299

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0088984|Ga0395898_0088984_1162_2130
Length 322
Sequence VTTDLGDLSAFVAVGRARGFRDAARASGKSASGLSEAVRRLEAALGVRLLYRTTRSVAPTEAGTRLLERLSSALTEVESALDVVNGFRDKPAGTLRLNVPISAARLVLPGIVPRFLAAYPEIRLEVIAEDSFVDVHAAGFDAGIRYDERLQQDVIALPIGPRTQRFAVAAAPAYLDRRGRPRHPRELLEHACLRGRFSGRAMHAWEFECDGEVVRIEPTGPLVVSLGTATDLAVEAAIAGSGIISLFEDWLRPHFESGALEPVLEPWWQSFSGPFLYYSGRRLVPAPLRAFIDFIKASPVPVAPRGEKRRRPRTSNDRQKAQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
11 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
12 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
13 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
14 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
15 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
16 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
17 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
18 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
19 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
20 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
21 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
22 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
23 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2643221607 Rhizobium sp. Root73 Isolate Unclassified
26 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
27 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
28 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
29 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
30 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
31 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
32 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
33 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
34 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
35 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
36 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
37 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
38 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
39 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
40 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
41 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
42 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
43 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
44 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
45 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
46 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
47 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
48 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
49 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
50 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
51 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
52 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
53 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
54 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
55 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
56 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
57 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
58 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
59 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
60 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
61 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
62 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
63 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
64 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
65 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
66 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
67 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
68 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
69 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
70 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
71 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
72 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
73 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
74 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
75 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
76 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
77 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
78 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
79 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
80 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
81 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
82 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
83 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
84 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
85 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
86 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
87 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
88 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
89 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
90 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
91 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
92 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
93 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
94 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
95 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
96 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
97 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
98 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
99 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
100 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
101 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
102 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
103 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
104 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
105 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
106 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
107 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
108 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
109 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
110 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
111 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
112 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
113 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
114 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
115 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
116 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
117 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
118 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
119 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
120 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
121 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
122 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
123 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
124 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
125 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
126 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
127 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
128 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
129 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
130 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
131 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
132 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
133 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
134 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
135 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
136 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
137 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
138 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
139 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
140 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
141 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
142 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
143 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
144 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
145 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
146 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
147 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
148 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
149 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
150 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
151 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
152 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
153 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
154 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
155 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
156 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
157 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
158 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
159 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
160 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
161 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
162 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
163 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
164 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
165 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
166 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
167 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
168 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
169 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
170 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
171 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
172 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
173 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
174 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
175 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
176 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
177 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
178 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
182 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
183 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
184 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
185 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
186 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
187 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
188 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
189 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
190 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
191 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
192 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
193 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
194 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
195 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
196 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
197 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
198 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
199 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
200 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
201 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
202 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
203 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
204 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
205 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
206 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
207 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
208 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
209 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
210 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
211 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
212 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
213 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
214 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
215 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
216 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
217 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
218 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
219 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
220 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
221 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
222 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
223 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
225 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
226 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
227 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
229 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
230 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
231 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
232 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
233 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
234 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
235 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
236 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
237 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
238 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
239 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
240 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
241 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
242 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
245 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
246 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
247 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
248 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
249 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
250 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
251 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
252 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
253 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
255 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
312 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
313 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
314 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
318 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
319 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
320 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
321 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
322 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
324 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
328 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
329 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
394 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
395 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
396 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
397 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.82
Metatranscriptomes 0
Isolates 34.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 30.36
Rhizoplane 2.55
Rhizosphere 57.75
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3036483 2162886012 Bacteria 1211
2 JGI24736J21556_1002639 3300001904 Bacteria 3145
3 Ga0055536_1007815 3300003781 Bacteria 4718
4 Ga0055540_1001511 3300003792 Bacteria 13782
5 Ga0055531_10000698 3300003794 Bacteria 28630
6 Ga0070658_10060378 3300005327 Bacteria 3088
7 Ga0070676_10016254 3300005328 Bacteria 4112
8 Ga0070683_100031336 3300005329 Bacteria 4834
9 Ga0070683_100143098 3300005329 Bacteria 2265
10 Ga0070690_100007713 3300005330 Bacteria 6172
11 Ga0070670_100341501 3300005331 Bacteria 1314
12 Ga0070677_10037834 3300005333 Bacteria 1884
13 Ga0070666_10194088 3300005335 Bacteria 1427
14 Ga0070680_100132823 3300005336 Bacteria 2083
15 Ga0070680_100314781 3300005336 Bacteria 1328
16 Ga0070682_100115267 3300005337 Bacteria 1797
17 Ga0068868_100087102 3300005338 Bacteria 2511
18 Ga0070660_100057831 3300005339 Bacteria 3005
19 Ga0070689_100391822 3300005340 Unclassified 1172
20 Ga0070687_100047310 3300005343 Bacteria 2206
21 Ga0070661_100036825 3300005344 Bacteria 3556
22 Ga0070661_100096339 3300005344 Bacteria 2195
23 Ga0070668_100035306 3300005347 Bacteria 3812
24 Ga0070669_100307639 3300005353 Bacteria 1276
25 Ga0070675_100091970 3300005354 Bacteria 2542
26 Ga0070671_100064242 3300005355 Bacteria 3057
27 Ga0070674_100049571 3300005356 Bacteria 2887
28 Ga0070673_100007788 3300005364 Bacteria 7089
29 Ga0070688_100001159 3300005365 Bacteria 13129
30 Ga0070659_100010096 3300005366 Bacteria 6950
31 Ga0070659_100088920 3300005366 Bacteria 2474
32 Ga0070667_100259181 3300005367 Bacteria 1556
33 Ga0070714_100477825 3300005435 Bacteria 1186
34 Ga0070701_10044741 3300005438 Bacteria 2269
35 Ga0070705_100023621 3300005440 Bacteria 3305
36 Ga0070694_100192528 3300005444 Bacteria 1515
37 Ga0070708_100408720 3300005445 Bacteria 1280
38 Ga0070663_100053536 3300005455 Bacteria 2881
39 Ga0070663_100111363 3300005455 Bacteria 2057
40 Ga0070678_100070119 3300005456 Bacteria 2619
41 Ga0070662_100422890 3300005457 Bacteria 1102
42 Ga0070681_10118628 3300005458 Bacteria 2582
43 Ga0068867_100059926 3300005459 Bacteria 2822
44 Ga0070685_10048627 3300005466 Bacteria 2443
45 Ga0070679_100197988 3300005530 Bacteria 1976
46 Ga0070684_100044131 3300005535 Bacteria 3854
47 Ga0070684_100161302 3300005535 Bacteria 2034
48 Ga0068853_100041900 3300005539 Bacteria 3913
49 Ga0068853_100388942 3300005539 Bacteria 1304
50 Ga0070672_100269498 3300005543 Bacteria 1437
51 Ga0070686_100003665 3300005544 Bacteria 8434
52 Ga0070695_100234877 3300005545 Bacteria 1327
53 Ga0070696_100112032 3300005546 Bacteria 1966
54 Ga0070693_100049588 3300005547 Bacteria 2396
55 Ga0070704_100513210 3300005549 Unclassified 1042
56 Ga0068855_100098376 3300005563 Bacteria 3370
57 Ga0068855_100098413 3300005563 Bacteria 3370
58 Ga0068855_100174018 3300005563 Bacteria 2437
59 Ga0068855_100181482 3300005563 Bacteria 2379
60 Ga0068855_100270227 3300005563 Bacteria 1891
61 Ga0070664_100179828 3300005564 Bacteria 1879
62 Ga0068857_100032292 3300005577 Bacteria 4629
63 Ga0068857_100063699 3300005577 Bacteria 3278
64 Ga0068854_100010605 3300005578 Bacteria 5980
65 Ga0068854_100182753 3300005578 Bacteria 1639
66 Ga0068856_100049723 3300005614 Bacteria 4132
67 Ga0068856_100052360 3300005614 Bacteria 4025
68 Ga0070702_100042932 3300005615 Bacteria 2545
69 Ga0068852_100065317 3300005616 Bacteria 3174
70 Ga0068852_100141330 3300005616 Bacteria 2228
71 Ga0068852_100368593 3300005616 Bacteria 1406
72 Ga0068859_100500329 3300005617 Bacteria 1310
73 Ga0068864_100073589 3300005618 Bacteria 2979
74 Ga0068866_10012789 3300005718 Bacteria 3664
75 Ga0068861_100019909 3300005719 Bacteria 4798
76 Ga0068851_10000346 3300005834 Bacteria 20836
77 Ga0068870_10000581 3300005840 Bacteria 13889
78 Ga0068863_100189633 3300005841 Bacteria 1975
79 Ga0068858_100079199 3300005842 Bacteria 3053
80 Ga0068860_100301225 3300005843 Bacteria 1570
81 Ga0068862_100016741 3300005844 Bacteria 6104
82 Ga0075367_10206677 3300006178 Bacteria 1227
83 Ga0097621_100065670 3300006237 Bacteria 2987
84 Ga0075370_10155410 3300006353 Bacteria 1341
85 Ga0075370_10228262 3300006353 Bacteria 1101
86 Ga0068871_100045998 3300006358 Bacteria 3514
87 Ga0068865_100049668 3300006881 Bacteria 2893
88 Ga0097620_100500307 3300006931 Bacteria 1310
89 Ga0105240_10017144 3300009093 Bacteria 9776
90 Ga0105240_10017741 3300009093 Bacteria 9582
91 Ga0105240_10034212 3300009093 Bacteria 6557
92 Ga0105240_10061613 3300009093 Bacteria 4675
93 Ga0105240_10116525 3300009093 Bacteria 3223
94 Ga0111539_10664407 3300009094 Bacteria 1213
95 Ga0105245_10009282 3300009098 Bacteria 8577
96 Ga0105247_10002418 3300009101 Bacteria 12698
97 Ga0105243_10052967 3300009148 Bacteria 3217
98 Ga0105241_10005864 3300009174 Bacteria 9071
99 Ga0105242_10008539 3300009176 Bacteria 7866
100 Ga0105248_10001877 3300009177 Bacteria 23303
101 Ga0105248_10104877 3300009177 Bacteria 3187
102 Ga0105237_10140924 3300009545 Bacteria 2405
103 Ga0105238_10060365 3300009551 Bacteria 3796
104 Ga0105238_10087123 3300009551 Bacteria 3110
105 Ga0105238_10282924 3300009551 Bacteria 1640
106 Ga0105249_10111147 3300009553 Bacteria 2591
107 Ga0105239_10157409 3300010375 Bacteria 2538
108 Ga0157373_10007242 3300013100 Bacteria 8274
109 Ga0157373_10053494 3300013100 Bacteria 2870
110 Ga0157371_10066850 3300013102 Bacteria 2545
111 Ga0157371_10080372 3300013102 Bacteria 2309
112 Ga0157370_10107253 3300013104 Bacteria 2613
113 Ga0157369_10005727 3300013105 Bacteria 14436
114 Ga0157369_10136539 3300013105 Bacteria 2596
115 Ga0157369_10144902 3300013105 Bacteria 2512
116 Ga0157378_10061759 3300013297 Bacteria 3345
117 Ga0163162_10295612 3300013306 Bacteria 1751
118 Ga0157372_10015874 3300013307 Bacteria 8079
119 Ga0157372_10231283 3300013307 Bacteria 2143
120 Ga0157375_10271487 3300013308 Bacteria 1858
121 Ga0163163_10004180 3300014325 Bacteria 12300
122 Ga0157380_10594010 3300014326 Unclassified 1094
123 Ga0157377_10008339 3300014745 Bacteria 5051
124 Ga0157379_10106967 3300014968 Bacteria 2511
125 Ga0157376_10042345 3300014969 Bacteria 3732
126 Ga0209676_1004734 3300025292 Bacteria 7442
127 Ga0209758_1000441 3300025297 Bacteria 69800
128 Ga0209758_1005667 3300025297 Bacteria 9449
129 Ga0209051_1000435 3300025303 Bacteria 56550
130 Ga0209257_1000598 3300025304 Bacteria 59869
131 Ga0207697_10002954 3300025315 Bacteria 8584
132 Ga0207656_10011251 3300025321 Bacteria 3377
133 Ga0207682_10003600 3300025893 Bacteria 6695
134 Ga0207688_10000653 3300025901 Bacteria 17088
135 Ga0207680_10196472 3300025903 Bacteria 1372
136 Ga0207647_10024446 3300025904 Bacteria 3983
137 Ga0207645_10000101 3300025907 Bacteria 63405
138 Ga0207645_10188466 3300025907 Bacteria 1355
139 Ga0207643_10005916 3300025908 Bacteria 6532
140 Ga0207705_10083017 3300025909 Bacteria 2337
141 Ga0207705_10184792 3300025909 Bacteria 1574
142 Ga0207654_10056687 3300025911 Bacteria 2274
143 Ga0207707_10020449 3300025912 Bacteria 5781
144 Ga0207695_10019548 3300025913 Bacteria 7793
145 Ga0207695_10064613 3300025913 Bacteria 3766
146 Ga0207695_10090251 3300025913 Bacteria 3080
147 Ga0207695_10108838 3300025913 Bacteria 2755
148 Ga0207695_10208933 3300025913 Bacteria 1864
149 Ga0207671_10197605 3300025914 Bacteria 1570
150 Ga0207671_10256195 3300025914 Bacteria 1376
151 Ga0207660_10103853 3300025917 Bacteria 2127
152 Ga0207662_10000405 3300025918 Bacteria 19125
153 Ga0207657_10004536 3300025919 Bacteria 14675
154 Ga0207649_10014363 3300025920 Bacteria 4432
155 Ga0207652_10045183 3300025921 Bacteria 3754
156 Ga0207681_10394487 3300025923 Unclassified 1116
157 Ga0207694_10092513 3300025924 Bacteria 2387
158 Ga0207650_10011578 3300025925 Bacteria 6074
159 Ga0207659_10283911 3300025926 Bacteria 1354
160 Ga0207687_10223531 3300025927 Bacteria 1484
161 Ga0207644_10028225 3300025931 Bacteria 3883
162 Ga0207644_10108848 3300025931 Bacteria 2092
163 Ga0207690_10005349 3300025932 Bacteria 7566
164 Ga0207690_10257646 3300025932 Bacteria 1350
165 Ga0207706_10008018 3300025933 Bacteria 9745
166 Ga0207709_10200765 3300025935 Bacteria 1424
167 Ga0207670_10312454 3300025936 Bacteria 1234
168 Ga0207669_10190636 3300025937 Bacteria 1478
169 Ga0207691_10000033 3300025940 Bacteria 115126
170 Ga0207711_10002697 3300025941 Bacteria 15687
171 Ga0207711_10195987 3300025941 Bacteria 1842
172 Ga0207689_10009207 3300025942 Bacteria 8540
173 Ga0207661_10390715 3300025944 Bacteria 1260
174 Ga0207667_10025316 3300025949 Bacteria 6497
175 Ga0207667_10064258 3300025949 Bacteria 3832
176 Ga0207667_10107629 3300025949 Bacteria 2876
177 Ga0207667_10234124 3300025949 Bacteria 1880
178 Ga0207667_10302509 3300025949 Bacteria 1634
179 Ga0207651_10143918 3300025960 Bacteria 1845
180 Ga0207712_10149486 3300025961 Bacteria 1803
181 Ga0207668_10192461 3300025972 Bacteria 1617
182 Ga0207640_10001594 3300025981 Bacteria 12188
183 Ga0207640_10116462 3300025981 Bacteria 1905
184 Ga0207658_10303814 3300025986 Bacteria 1375
185 Ga0207677_10087323 3300026023 Bacteria 2257
186 Ga0207703_10263979 3300026035 Bacteria 1557
187 Ga0207639_10239917 3300026041 Bacteria 1575
188 Ga0207678_10063025 3300026067 Bacteria 3186
189 Ga0207678_10076640 3300026067 Bacteria 2864
190 Ga0207702_10054567 3300026078 Bacteria 3387
191 Ga0207702_10331196 3300026078 Bacteria 1452
192 Ga0207641_10228206 3300026088 Bacteria 1729
193 Ga0207648_10000189 3300026089 Bacteria 64801
194 Ga0207676_10191339 3300026095 Bacteria 1800
195 Ga0207674_10000224 3300026116 Bacteria 70660
196 Ga0207675_100001594 3300026118 Bacteria 22724
197 Ga0207683_10046162 3300026121 Bacteria 3811
198 Ga0207698_10029189 3300026142 Bacteria 3945
199 Ga0207698_10454425 3300026142 Bacteria 1237
200 Ga0268266_10063175 3300028379 Bacteria 3196
201 Ga0268265_10286908 3300028380 Bacteria 1475
202 Ga0268264_10400889 3300028381 Bacteria 1318
203 Ga0265330_10025734 3300031235 Bacteria 2666
204 Ga0265340_10000501 3300031247 Bacteria 21465
205 Ga0265340_10038472 3300031247 Bacteria 2365
206 Ga0265339_10044290 3300031249 Bacteria 2455
207 Ga0307412_10339491 3300031911 Bacteria 1202
208 Ga0307416_100349829 3300032002 Bacteria 1495
209 Ga0307414_10541492 3300032004 Bacteria 1036
210 Ga0307510_10030206 3300033180 Bacteria 6147
211 Ga0373930_0002676 3300034816 Bacteria 2777
212 Ga0373958_0025816 3300034819 Bacteria 1121
213 Ga0373928_0007394 3300035084 Bacteria 2119
214 Ga0373929_0013492 3300035085 Bacteria 1566
215 Ga0373923_0173005 3300035111 Bacteria 990
216 Ga0373946_0063641 3300035171 Bacteria 1576
217 Ga0373961_0056359 3300035241 Bacteria 1180
218 Ga0373931_0023628 3300035691 Bacteria 3105
219 Ga0373935_0104159 3300035692 Bacteria 1875
220 Ga0373947_0181482 3300035725 Bacteria 1370
221 Ga0373925_0280335 3300037068 Bacteria 1342
222 Ga0395899_0246814 3300037312 Bacteria 1227
223 Ga0395898_0037072 3300037466 Bacteria 4838
224 Ga0395898_0088984 3300037466 Bacteria 2972
225 Ga0395898_0149648 3300037466 Bacteria 2234
226 Ga0395901_0376528 3300038443 Bacteria 1462
227 Ga0395901_0378692 3300038443 Bacteria 1457
228 Ga0436361_0898454 3300039447 Bacteria 4187
229 Ga0466966_0061811 3300044684 Bacteria 2362
230 Ga0466963_0010646 3300044694 Bacteria 5577
231 Ga0466967_0012429 3300045976 Bacteria 6511
232 Ga0495603_0049436 3300046455 Bacteria 2503
233 Ga0495638_0091663 3300046460 Bacteria 1830
234 Ga0495662_0028185 3300046476 Bacteria 2712
235 Ga0495585_0011225 3300046492 Bacteria 5307
236 Ga0495607_0000038 3300046501 Bacteria 134124
237 Ga0495607_0197772 3300046501 Bacteria 997
238 Ga0495583_0000804 3300046506 Bacteria 38732
239 Ga0495630_0150936 3300046517 Bacteria 1768
240 Ga0495625_0000337 3300046660 Bacteria 71532
241 Ga0495625_0176816 3300046660 Bacteria 1422
242 Ga0495660_0061799 3300046810 Bacteria 2009
243 Ga0495676_0228085 3300047321 Bacteria 1280
244 Ga0496101_0042903 3300048904 Bacteria 3230
245 Ga0496102_0028133 3300048905 Bacteria 5023
246 Ga0496102_0212388 3300048905 Bacteria 1824
247 Ga0496106_0118784 3300048909 Bacteria 2065
248 Ga0496110_0073550 3300048913 Bacteria 3033
249 Ga0496111_0000651 3300048914 Bacteria 18264
250 Ga0496111_0221089 3300048914 Bacteria 1407
251 Ga0496112_0276737 3300048915 Bacteria 1626
252 Ga0496114_0109874 3300048917 Bacteria 2361
253 Ga0496115_0004163 3300048918 Bacteria 10445
254 Ga0496120_0112134 3300048923 Bacteria 1423
255 Ga0496121_0050573 3300048924 Bacteria 3509
256 Ga0496121_0114344 3300048924 Bacteria 2051
257 Ga0496125_0001098 3300048928 Bacteria 41637
258 Ga0496126_0085702 3300048929 Bacteria 2777
259 Ga0496126_0160150 3300048929 Bacteria 1924
260 Ga0501032_0058358 3300049569 Bacteria 2591
261 Ga0501032_0169708 3300049569 Bacteria 1431
262 Ga0501034_0000109 3300049571 Bacteria 151550
263 Ga0501034_0130208 3300049571 Bacteria 2499
264 Ga0501034_0409935 3300049571 Bacteria 1277
265 Ga0501036_0478584 3300049572 Bacteria 1037
266 Ga0501037_0027066 3300049573 Bacteria 4236
267 Ga0501037_0056656 3300049573 Bacteria 2862
268 Ga0501038_0075326 3300049574 Bacteria 2852
269 Ga0501038_0097086 3300049574 Bacteria 2458
270 Ga0501039_0069269 3300049575 Bacteria 2739
271 Ga0501040_0158455 3300049576 Bacteria 1599
272 Ga0501042_0050185 3300049578 Bacteria 2976
273 Ga0501043_0142920 3300049579 Bacteria 1873
274 Ga0501043_0153663 3300049579 Bacteria 1800
275 Ga0501043_0204590 3300049579 Bacteria 1531
276 Ga0501046_0018256 3300049580 Bacteria 5840
277 Ga0501046_0022106 3300049580 Bacteria 5241
278 Ga0501047_0103710 3300049581 Bacteria 2724
279 Ga0501048_0016644 3300049582 Bacteria 5421
280 Ga0501048_0396556 3300049582 Bacteria 986
281 Ga0501067_0077960 3300049583 Bacteria 1836
282 Ga0501068_0053385 3300049584 Bacteria 2446
283 Ga0501069_0002366 3300049585 Bacteria 9561
284 Ga0501069_0104521 3300049585 Bacteria 1609
285 Ga0501070_0057868 3300049586 Bacteria 3214
286 Ga0501071_0045425 3300049587 Bacteria 3153
287 Ga0501072_0218261 3300049588 Bacteria 1520
288 Ga0501073_0036517 3300049589 Bacteria 3491
289 Ga0501073_0085519 3300049589 Bacteria 2194
290 Ga0501074_0069760 3300049590 Bacteria 2527
291 Ga0501080_0034886 3300049742 Bacteria 4698
292 Ga0501080_0153388 3300049742 Bacteria 2128
293 Ga0501035_0011571 3300049822 Bacteria 8179
294 Ga0501044_0020041 3300049823 Bacteria 7141
295 Ga0501044_0026300 3300049823 Bacteria 6162
296 Ga0501044_0187001 3300049823 Bacteria 2035
297 nmdc:mga03n38_181480_c1 3300050490 Bacteria 1079
298 nmdc:mga0yw44_21756_c1 3300050492 Bacteria 3584
299 nmdc:mga08y16_664918_c1 3300050511 Bacteria 1044
300 Ga0500644_0001826 3300053088 Bacteria 5503
301 Ga0500572_002008 3300053111 Bacteria 5072
302 Ga0500595_000458 3300053119 Bacteria 25358
303 Ga0500618_000855 3300053125 Bacteria 16375
304 Ga0500618_011084 3300053125 Bacteria 2400
305 Ga0500559_0035910 3300053136 Bacteria 2142
306 Ga0500590_001048 3300053148 Bacteria 10801
307 Ga0500616_0000510 3300053153 Bacteria 49274
308 Ga0500634_0000003 3300053161 Bacteria 245536
309 Ga0500645_000360 3300053730 Bacteria 32459
310 Ga0500645_042410 3300053730 Bacteria 1342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2597489875 2597814446 259
2 3300046501 Ga0495607_0197772 Ga0495607_0197772_25_843 267
3 3300050511 nmdc:mga08y16_664918_c1 nmdc:mga08y16_664918_c1_18_827 267
4 3300005563 Ga0068855_100098376 Ga0068855_1000983764 271
5 3300025949 Ga0207667_10064258 Ga0207667_100642582 271
6 3300025907 Ga0207645_10188466 Ga0207645_101884662 272
7 3300035171 Ga0373946_0063641 Ga0373946_0063641_98_1006 272
8 3300035692 Ga0373935_0104159 Ga0373935_0104159_526_1434 272
9 3300035725 Ga0373947_0181482 Ga0373947_0181482_313_1221 272
10 3300037068 Ga0373925_0280335 Ga0373925_0280335_249_1157 272
11 3300046455 Ga0495603_0049436 Ga0495603_0049436_772_1680 272
12 3300046476 Ga0495662_0028185 Ga0495662_0028185_1486_2394 272
13 3300046492 Ga0495585_0011225 Ga0495585_0011225_3748_4656 272
14 3300046517 Ga0495630_0150936 Ga0495630_0150936_231_1139 272
15 3300047321 Ga0495676_0228085 Ga0495676_0228085_193_1101 272
16 3300048923 Ga0496120_0112134 Ga0496120_0112134_101_1009 273
17 3300044684 Ga0466966_0061811 Ga0466966_0061811_498_1379 275
18 3300053119 Ga0500595_000458 Ga0500595_000458_19594_20499 275
19 3300053111 Ga0500572_002008 Ga0500572_002008_3700_4614 276
20 3300031235 Ga0265330_10025734 Ga0265330_100257343 277
21 3300031249 Ga0265339_10044290 Ga0265339_100442901 277
22 3300031247 Ga0265340_10000501 Ga0265340_1000050117 278
23 3300049572 Ga0501036_0478584 Ga0501036_0478584_47_946 278
24 3300053088 Ga0500644_0001826 Ga0500644_0001826_2063_2968 278
25 3300053730 Ga0500645_042410 Ga0500645_042410_174_1079 278
26 3300048929 Ga0496126_0085702 Ga0496126_0085702_1689_2591 279
27 3300049579 Ga0501043_0153663 Ga0501043_0153663_126_1088 279
28 3300005329 Ga0070683_100143098 Ga0070683_1001430983 280
29 3300005336 Ga0070680_100314781 Ga0070680_1003147812 280
30 3300005530 Ga0070679_100197988 Ga0070679_1001979882 280
31 3300005535 Ga0070684_100044131 Ga0070684_1000441312 280
32 3300005577 Ga0068857_100032292 Ga0068857_1000322922 280
33 3300009551 Ga0105238_10282924 Ga0105238_102829242 280
34 3300025921 Ga0207652_10045183 Ga0207652_100451832 280
35 3300025944 Ga0207661_10390715 Ga0207661_103907151 280
36 3300049571 Ga0501034_0000109 Ga0501034_0000109_128394_129293 280
37 3300049586 Ga0501070_0057868 Ga0501070_0057868_970_1869 280
38 3300049823 Ga0501044_0020041 Ga0501044_0020041_5254_6153 280
39 3300049571 Ga0501034_0130208 Ga0501034_0130208_853_1773 282
40 3300049574 Ga0501038_0075326 Ga0501038_0075326_853_1773 282
41 3300049575 Ga0501039_0069269 Ga0501039_0069269_313_1233 282
42 3300049576 Ga0501040_0158455 Ga0501040_0158455_668_1588 282
43 3300049578 Ga0501042_0050185 Ga0501042_0050185_117_1037 282
44 3300049579 Ga0501043_0142920 Ga0501043_0142920_853_1773 282
45 3300049580 Ga0501046_0022106 Ga0501046_0022106_1570_2490 282
46 3300049581 Ga0501047_0103710 Ga0501047_0103710_1379_2299 282
47 3300049582 Ga0501048_0016644 Ga0501048_0016644_4122_5042 282
48 3300049583 Ga0501067_0077960 Ga0501067_0077960_253_1173 282
49 3300049584 Ga0501068_0053385 Ga0501068_0053385_998_1918 282
50 3300049585 Ga0501069_0104521 Ga0501069_0104521_660_1580 282
51 3300049587 Ga0501071_0045425 Ga0501071_0045425_1709_2629 282
52 3300049588 Ga0501072_0218261 Ga0501072_0218261_554_1474 282
53 3300049589 Ga0501073_0036517 Ga0501073_0036517_1415_2335 282
54 3300049742 Ga0501080_0153388 Ga0501080_0153388_269_1189 282
55 3300049823 Ga0501044_0187001 Ga0501044_0187001_598_1518 282
56 iso_pu_bacteria 3005594810 3005597928 283
57 3300005616 Ga0068852_100065317 Ga0068852_1000653172 284
58 3300046660 Ga0495625_0000337 Ga0495625_0000337_11203_12129 284
59 3300013306 Ga0163162_10295612 Ga0163162_102956122 285
60 3300053125 Ga0500618_000855 Ga0500618_000855_10455_11375 286
61 3300009093 Ga0105240_10034212 Ga0105240_100342124 287
62 3300025913 Ga0207695_10019548 Ga0207695_100195482 287
63 3300025914 Ga0207671_10256195 Ga0207671_102561951 287
64 3300009177 Ga0105248_10001877 Ga0105248_1000187711 288
65 3300025931 Ga0207644_10028225 Ga0207644_100282255 288
66 3300025941 Ga0207711_10002697 Ga0207711_100026975 288
67 3300034816 Ga0373930_0002676 Ga0373930_0002676_377_1285 288
68 3300034819 Ga0373958_0025816 Ga0373958_0025816_129_1037 288
69 3300035084 Ga0373928_0007394 Ga0373928_0007394_870_1778 288
70 3300035085 Ga0373929_0013492 Ga0373929_0013492_204_1112 288
71 3300035241 Ga0373961_0056359 Ga0373961_0056359_39_947 288
72 3300035691 Ga0373931_0023628 Ga0373931_0023628_289_1197 288
73 3300048904 Ga0496101_0042903 Ga0496101_0042903_2183_3091 288
74 3300048905 Ga0496102_0212388 Ga0496102_0212388_824_1732 288
75 3300048914 Ga0496111_0221089 Ga0496111_0221089_320_1228 288
76 3300048917 Ga0496114_0109874 Ga0496114_0109874_1277_2185 288
77 3300048918 Ga0496115_0004163 Ga0496115_0004163_1149_2057 288
78 3300005336 Ga0070680_100132823 Ga0070680_1001328232 290
79 3300005458 Ga0070681_10118628 Ga0070681_101186282 290
80 3300005563 Ga0068855_100098413 Ga0068855_1000984132 290
81 3300009093 Ga0105240_10061613 Ga0105240_100616133 290
82 3300025912 Ga0207707_10020449 Ga0207707_100204495 290
83 3300025913 Ga0207695_10064613 Ga0207695_100646133 290
84 3300025917 Ga0207660_10103853 Ga0207660_101038532 290
85 3300025949 Ga0207667_10107629 Ga0207667_101076293 290
86 3300031911 Ga0307412_10339491 Ga0307412_103394911 291
87 3300032002 Ga0307416_100349829 Ga0307416_1003498292 291
88 3300032004 Ga0307414_10541492 Ga0307414_105414921 291
89 iso_pu_bacteria 2874123672 2874126164 293
90 iso_pu_bacteria 2937822353 2937823589 293
91 3300049569 Ga0501032_0169708 Ga0501032_0169708_262_1164 294
92 3300049573 Ga0501037_0027066 Ga0501037_0027066_3317_4219 294
93 3300049574 Ga0501038_0097086 Ga0501038_0097086_1032_1934 294
94 3300049579 Ga0501043_0204590 Ga0501043_0204590_580_1482 294
95 3300049585 Ga0501069_0002366 Ga0501069_0002366_2427_3329 294
96 3300049589 Ga0501073_0085519 Ga0501073_0085519_963_1865 294
97 3300049590 Ga0501074_0069760 Ga0501074_0069760_871_1773 294
98 3300049742 Ga0501080_0034886 Ga0501080_0034886_396_1298 294
99 3300049822 Ga0501035_0011571 Ga0501035_0011571_3791_4693 294
100 3300049823 Ga0501044_0026300 Ga0501044_0026300_1657_2559 294
101 iso_pu_bacteria 2884811622 2884812468 294
102 iso_pu_bacteria 2884836552 2884839456 294
103 iso_pu_bacteria 2884852848 2884856734 294
104 iso_pu_bacteria 2896154374 2896158080 294
105 iso_pu_bacteria 2945972063 2945972408 294
106 3300048924 Ga0496121_0050573 Ga0496121_0050573_2315_3262 295
107 iso_pu_bacteria 2933016740 2933022090 295
108 iso_pu_bacteria 2977864932 2977866702 295
109 3300006178 Ga0075367_10206677 Ga0075367_102066771 296
110 iso_pu_bacteria 2508501127 2509145240 296
111 iso_pu_bacteria 2510917026 2511169673 296
112 iso_pu_bacteria 2582581283 2585165257 296
113 iso_pu_bacteria 2599185301 2599937573 296
114 iso_pu_bacteria 2600254933 2600373613 296
115 iso_pu_bacteria 2617270735 2617346500 296
116 iso_pu_bacteria 2643221607 2644046889 296
117 iso_pu_bacteria 2643221636 2644202581 296
118 iso_pu_bacteria 2643221686 2644479678 296
119 iso_pu_bacteria 2757320392 2757570177 296
120 iso_pu_bacteria 2824696289 2824702953 296
121 iso_pu_bacteria 2841941048 2841944755 296
122 iso_pu_bacteria 2841949485 2841955954 296
123 iso_pu_bacteria 2841966195 2841969909 296
124 iso_pu_bacteria 2841974524 2841978660 296
125 iso_pu_bacteria 2842698319 2842698999 296
126 iso_pu_bacteria 2856342000 2856349277 296
127 iso_pu_bacteria 2871474448 2871478709 296
128 iso_pu_bacteria 2919171160 2919172196 296
129 iso_pu_bacteria 2924754689 2924756887 296
130 iso_pu_bacteria 2937836603 2937836919 296
131 iso_pu_bacteria 2970524798 2970531498 296
132 iso_pu_bacteria 2996310559 2996312952 296
133 iso_pu_bacteria 8004395343 8004402279 296
134 iso_pu_bacteria 8004633249 8004640057 296
135 iso_pu_bacteria 8055617313 8055622296 296
136 3300001904 JGI24736J21556_1002639 JGI24736J21556_10026393 297
137 3300005344 Ga0070661_100096339 Ga0070661_1000963392 297
138 3300005366 Ga0070659_100010096 Ga0070659_1000100964 297
139 3300005455 Ga0070663_100053536 Ga0070663_1000535362 297
140 3300005539 Ga0068853_100388942 Ga0068853_1003889422 297
141 3300005563 Ga0068855_100181482 Ga0068855_1001814823 297
142 3300005578 Ga0068854_100010605 Ga0068854_1000106053 297
143 3300005614 Ga0068856_100052360 Ga0068856_1000523605 297
144 3300005616 Ga0068852_100141330 Ga0068852_1001413303 297
145 3300006353 Ga0075370_10228262 Ga0075370_102282621 297
146 3300009093 Ga0105240_10116525 Ga0105240_101165254 297
147 3300013100 Ga0157373_10053494 Ga0157373_100534943 297
148 3300013102 Ga0157371_10066850 Ga0157371_100668503 297
149 3300013104 Ga0157370_10107253 Ga0157370_101072532 297
150 3300013105 Ga0157369_10144902 Ga0157369_101449022 297
151 3300013307 Ga0157372_10231283 Ga0157372_102312831 297
152 3300025904 Ga0207647_10024446 Ga0207647_100244463 297
153 3300025909 Ga0207705_10083017 Ga0207705_100830172 297
154 3300025913 Ga0207695_10108838 Ga0207695_101088383 297
155 3300025932 Ga0207690_10005349 Ga0207690_100053496 297
156 3300025949 Ga0207667_10234124 Ga0207667_102341243 297
157 3300025981 Ga0207640_10001594 Ga0207640_100015948 297
158 3300026067 Ga0207678_10063025 Ga0207678_100630253 297
159 3300026078 Ga0207702_10054567 Ga0207702_100545673 297
160 3300026142 Ga0207698_10029189 Ga0207698_100291895 297
161 3300037312 Ga0395899_0246814 Ga0395899_0246814_163_1068 297
162 3300037466 Ga0395898_0149648 Ga0395898_0149648_179_1084 297
163 3300038443 Ga0395901_0376528 Ga0395901_0376528_388_1293 297
164 3300044694 Ga0466963_0010646 Ga0466963_0010646_4358_5263 297
165 3300046460 Ga0495638_0091663 Ga0495638_0091663_732_1631 297
166 3300046810 Ga0495660_0061799 Ga0495660_0061799_1001_1900 297
167 3300050490 nmdc:mga03n38_181480_c1 nmdc:mga03n38_181480_c1_26_925 297
168 3300045976 Ga0466967_0012429 Ga0466967_0012429_2693_3598 298
169 3300048924 Ga0496121_0114344 Ga0496121_0114344_273_1169 298
170 3300005435 Ga0070714_100477825 Ga0070714_1004778251 299
171 3300005445 Ga0070708_100408720 Ga0070708_1004087201 299
172 3300005563 Ga0068855_100174018 Ga0068855_1001740183 299
173 3300009093 Ga0105240_10017741 Ga0105240_100177419 299
174 3300013105 Ga0157369_10005727 Ga0157369_1000572711 299
175 3300025913 Ga0207695_10090251 Ga0207695_100902513 299
176 3300025949 Ga0207667_10025316 Ga0207667_100253166 299
177 3300037466 Ga0395898_0037072 Ga0395898_0037072_3427_4380 299
178 3300049569 Ga0501032_0058358 Ga0501032_0058358_1198_2109 299
179 3300049571 Ga0501034_0409935 Ga0501034_0409935_194_1093 299
180 3300049573 Ga0501037_0056656 Ga0501037_0056656_138_1049 299
181 3300049580 Ga0501046_0018256 Ga0501046_0018256_3766_4665 299
182 3300049582 Ga0501048_0396556 Ga0501048_0396556_17_928 299
183 3300053161 Ga0500634_0000003 Ga0500634_0000003_235752_236651 299
184 iso_pu_bacteria 2510065057 2510307872 299
185 iso_pu_bacteria 2511231052 2511499702 299
186 iso_pu_bacteria 2513237086 2513587499 299
187 iso_pu_bacteria 2513237091 2513620065 299
188 iso_pu_bacteria 2513237140 2513882994 299
189 iso_pu_bacteria 2513237143 2513903051 299
190 iso_pu_bacteria 2516653046 2516897256 299
191 iso_pu_bacteria 2551306084 2551679663 299
192 iso_pu_bacteria 2551306085 2551689890 299
193 iso_pu_bacteria 2551306086 2551691855 299
194 iso_pu_bacteria 2551306087 2551704763 299
195 iso_pu_bacteria 2551306089 2551713478 299
196 iso_pu_bacteria 2551306090 2551724198 299
197 iso_pu_bacteria 2551306091 2551729620 299
198 iso_pu_bacteria 2551306092 2551734037 299
199 iso_pu_bacteria 2551306093 2551742718 299
200 iso_pu_bacteria 2855825444 2855830881 299
201 iso_pu_bacteria 2855839649 2855845389 299
202 iso_pu_bacteria 2858800743 2858805075 299
203 iso_pu_bacteria 2915986958 2915988557 299
204 iso_pu_bacteria 2915993759 2915999998 299
205 iso_pu_bacteria 2916000859 2916007124 299
206 iso_pu_bacteria 2916007675 2916010664 299
207 iso_pu_bacteria 2916014648 2916017482 299
208 iso_pu_bacteria 2916021584 2916024142 299
209 iso_pu_bacteria 2916028427 2916032452 299
210 iso_pu_bacteria 2916035215 2916040688 299
211 iso_pu_bacteria 2916041962 2916046730 299
212 iso_pu_bacteria 2916048683 2916053292 299
213 iso_pu_bacteria 2916055098 2916059367 299
214 iso_pu_bacteria 2916068649 2916073383 299
215 iso_pu_bacteria 2916076590 2916080400 299
216 iso_pu_bacteria 2921208531 2921210769 299
217 iso_pu_bacteria 2921237296 2921241922 299
218 iso_pu_bacteria 2921257292 2921261649 299
219 iso_pu_bacteria 2921263974 2921268301 299
220 iso_pu_bacteria 2921289301 2921292240 299
221 iso_pu_bacteria 2921296804 2921304248 299
222 iso_pu_bacteria 2924165586 2924166927 299
223 iso_pu_bacteria 2924172951 2924176645 299
224 iso_pu_bacteria 2924179722 2924185420 299
225 iso_pu_bacteria 2924186466 2924188593 299
226 iso_pu_bacteria 2924207177 2924208690 299
227 iso_pu_bacteria 2924214083 2924214858 299
228 iso_pu_bacteria 2924221636 2924222136 299
229 iso_pu_bacteria 2924228884 2924229759 299
230 iso_pu_bacteria 2937002841 2937005175 299
231 iso_pu_bacteria 2937009748 2937011352 299
232 iso_pu_bacteria 2937016420 2937017142 299
233 iso_pu_bacteria 2937023124 2937027558 299
234 iso_pu_bacteria 2937042894 2937046621 299
235 iso_pu_bacteria 2937049772 2937050807 299
236 iso_pu_bacteria 2937063883 2937070240 299
237 iso_pu_bacteria 2937071275 2937074463 299
238 iso_pu_bacteria 2937091812 2937093585 299
239 iso_pu_bacteria 2937113482 2937118434 299
240 iso_pu_bacteria 2937119839 2937120718 299
241 iso_pu_bacteria 2937126314 2937130622 299
242 iso_pu_bacteria 2957382221 2957386964 299
243 iso_pu_bacteria 2957395598 2957399784 299
244 iso_pu_bacteria 2957402308 2957407316 299
245 iso_pu_bacteria 2957408893 2957413111 299
246 iso_pu_bacteria 2957422303 2957426393 299
247 iso_pu_bacteria 2957450854 2957452924 299
248 iso_pu_bacteria 2957457609 2957461405 299
249 iso_pu_bacteria 2957471148 2957476351 299
250 iso_pu_bacteria 2957478035 2957482213 299
251 iso_pu_bacteria 2957484790 2957488583 299
252 iso_pu_bacteria 2957491536 2957498093 299
253 iso_pu_bacteria 2957498199 2957501274 299
254 iso_pu_bacteria 2957505466 2957512559 299
255 iso_pu_bacteria 2960584000 2960586727 299
256 iso_pu_bacteria 2960597568 2960600555 299
257 iso_pu_bacteria 2960603979 2960607636 299
258 iso_pu_bacteria 2960610863 2960612879 299
259 iso_pu_bacteria 2960624210 2960630189 299
260 iso_pu_bacteria 2960637947 2960644457 299
261 iso_pu_bacteria 2960645483 2960650871 299
262 iso_pu_bacteria 2960652885 2960654954 299
263 iso_pu_bacteria 2960667422 2960670656 299
264 iso_pu_bacteria 2960687367 2960691746 299
265 iso_pu_bacteria 2964615318 2964620020 299
266 iso_pu_bacteria 2964636051 2964642581 299
267 iso_pu_bacteria 2964643177 2964649935 299
268 iso_pu_bacteria 2964656573 2964657263 299
269 iso_pu_bacteria 2964663802 2964664742 299
270 iso_pu_bacteria 2964670856 2964675271 299
271 iso_pu_bacteria 2964678106 2964679916 299
272 iso_pu_bacteria 2964691889 2964696764 299
273 iso_pu_bacteria 2964705432 2964709106 299
274 iso_pu_bacteria 2964712639 2964713057 299
275 iso_pu_bacteria 2964719344 2964725548 299
276 iso_pu_bacteria 2967693043 2967698757 299
277 iso_pu_bacteria 2967699805 2967704515 299
278 iso_pu_bacteria 2967706974 2967707616 299
279 iso_pu_bacteria 2967735183 2967741159 299
280 iso_pu_bacteria 2967742019 2967744648 299
281 iso_pu_bacteria 2967748971 2967751656 299
282 iso_pu_bacteria 2967755722 2967760107 299
283 iso_pu_bacteria 2967762386 2967767929 299
284 iso_pu_bacteria 2967775926 2967781847 299
285 iso_pu_bacteria 2970033650 2970040054 299
286 iso_pu_bacteria 2970040964 2970046370 299
287 iso_pu_bacteria 2970054988 2970061443 299
288 iso_pu_bacteria 2970068827 2970074776 299
289 iso_pu_bacteria 2970076120 2970082305 299
290 iso_pu_bacteria 2970095765 2970101643 299
291 iso_pu_bacteria 2970102677 2970106585 299
292 iso_pu_bacteria 2970109326 2970113487 299
293 iso_pu_bacteria 2970116247 2970122640 299
294 iso_pu_bacteria 2970129317 2970134981 299
295 iso_pu_bacteria 2970136068 2970142600 299
296 iso_pu_bacteria 2970149975 2970155799 299
297 iso_pu_bacteria 2970156795 2970162316 299
298 iso_pu_bacteria 2970164137 2970165093 299
299 iso_pu_bacteria 2970170962 2970177142 299
300 iso_pu_bacteria 2970177841 2970178764 299
301 iso_pu_bacteria 2970184632 2970186085 299
302 iso_pu_bacteria 2970191845 2970194527 299
303 iso_pu_bacteria 2977516862 2977521955 299
304 iso_pu_bacteria 2977572785 2977578192 299
305 iso_pu_bacteria 2977579622 2977586051 299
306 iso_pu_bacteria 648276728 648738048 299
307 iso_pu_bacteria 8003992118 8003998048 299
308 2162886012 MBSR1b_contig_3036483 MBSR1b_0061.00003810 300
309 3300003781 Ga0055536_1007815 Ga0055536_10078153 300
310 3300003792 Ga0055540_1001511 Ga0055540_10015113 300
311 3300003794 Ga0055531_10000698 Ga0055531_1000069813 300
312 3300005327 Ga0070658_10060378 Ga0070658_100603782 300
313 3300005328 Ga0070676_10016254 Ga0070676_100162542 300
314 3300005329 Ga0070683_100031336 Ga0070683_1000313364 300
315 3300005330 Ga0070690_100007713 Ga0070690_1000077134 300
316 3300005331 Ga0070670_100341501 Ga0070670_1003415011 300
317 3300005333 Ga0070677_10037834 Ga0070677_100378342 300
318 3300005335 Ga0070666_10194088 Ga0070666_101940882 300
319 3300005337 Ga0070682_100115267 Ga0070682_1001152672 300
320 3300005338 Ga0068868_100087102 Ga0068868_1000871022 300
321 3300005339 Ga0070660_100057831 Ga0070660_1000578312 300
322 3300005340 Ga0070689_100391822 Ga0070689_1003918221 300
323 3300005343 Ga0070687_100047310 Ga0070687_1000473102 300
324 3300005344 Ga0070661_100036825 Ga0070661_1000368252 300
325 3300005347 Ga0070668_100035306 Ga0070668_1000353062 300
326 3300005353 Ga0070669_100307639 Ga0070669_1003076391 300
327 3300005354 Ga0070675_100091970 Ga0070675_1000919702 300
328 3300005355 Ga0070671_100064242 Ga0070671_1000642422 300
329 3300005356 Ga0070674_100049571 Ga0070674_1000495712 300
330 3300005364 Ga0070673_100007788 Ga0070673_1000077882 300
331 3300005365 Ga0070688_100001159 Ga0070688_10000115912 300
332 3300005366 Ga0070659_100088920 Ga0070659_1000889202 300
333 3300005367 Ga0070667_100259181 Ga0070667_1002591812 300
334 3300005438 Ga0070701_10044741 Ga0070701_100447412 300
335 3300005440 Ga0070705_100023621 Ga0070705_1000236212 300
336 3300005444 Ga0070694_100192528 Ga0070694_1001925282 300
337 3300005455 Ga0070663_100111363 Ga0070663_1001113632 300
338 3300005456 Ga0070678_100070119 Ga0070678_1000701192 300
339 3300005457 Ga0070662_100422890 Ga0070662_1004228901 300
340 3300005459 Ga0068867_100059926 Ga0068867_1000599262 300
341 3300005466 Ga0070685_10048627 Ga0070685_100486271 300
342 3300005535 Ga0070684_100161302 Ga0070684_1001613022 300
343 3300005539 Ga0068853_100041900 Ga0068853_1000419004 300
344 3300005543 Ga0070672_100269498 Ga0070672_1002694982 300
345 3300005544 Ga0070686_100003665 Ga0070686_1000036657 300
346 3300005545 Ga0070695_100234877 Ga0070695_1002348771 300
347 3300005546 Ga0070696_100112032 Ga0070696_1001120322 300
348 3300005547 Ga0070693_100049588 Ga0070693_1000495882 300
349 3300005549 Ga0070704_100513210 Ga0070704_1005132101 300
350 3300005563 Ga0068855_100270227 Ga0068855_1002702271 300
351 3300005564 Ga0070664_100179828 Ga0070664_1001798282 300
352 3300005577 Ga0068857_100063699 Ga0068857_1000636992 300
353 3300005578 Ga0068854_100182753 Ga0068854_1001827531 300
354 3300005614 Ga0068856_100049723 Ga0068856_1000497233 300
355 3300005615 Ga0070702_100042932 Ga0070702_1000429322 300
356 3300005616 Ga0068852_100368593 Ga0068852_1003685932 300
357 3300005617 Ga0068859_100500329 Ga0068859_1005003292 300
358 3300005618 Ga0068864_100073589 Ga0068864_1000735892 300
359 3300005718 Ga0068866_10012789 Ga0068866_100127892 300
360 3300005719 Ga0068861_100019909 Ga0068861_1000199092 300
361 3300005834 Ga0068851_10000346 Ga0068851_1000034618 300
362 3300005840 Ga0068870_10000581 Ga0068870_1000058112 300
363 3300005841 Ga0068863_100189633 Ga0068863_1001896332 300
364 3300005842 Ga0068858_100079199 Ga0068858_1000791992 300
365 3300005843 Ga0068860_100301225 Ga0068860_1003012252 300
366 3300005844 Ga0068862_100016741 Ga0068862_1000167413 300
367 3300006237 Ga0097621_100065670 Ga0097621_1000656702 300
368 3300006353 Ga0075370_10155410 Ga0075370_101554102 300
369 3300006358 Ga0068871_100045998 Ga0068871_1000459982 300
370 3300006881 Ga0068865_100049668 Ga0068865_1000496682 300
371 3300006931 Ga0097620_100500307 Ga0097620_1005003072 300
372 3300009093 Ga0105240_10017144 Ga0105240_100171447 300
373 3300009094 Ga0111539_10664407 Ga0111539_106644072 300
374 3300009098 Ga0105245_10009282 Ga0105245_100092827 300
375 3300009101 Ga0105247_10002418 Ga0105247_1000241811 300
376 3300009148 Ga0105243_10052967 Ga0105243_100529672 300
377 3300009174 Ga0105241_10005864 Ga0105241_100058642 300
378 3300009176 Ga0105242_10008539 Ga0105242_100085392 300
379 3300009177 Ga0105248_10104877 Ga0105248_101048772 300
380 3300009545 Ga0105237_10140924 Ga0105237_101409242 300
381 3300009551 Ga0105238_10060365 Ga0105238_100603652 300
382 3300009551 Ga0105238_10087123 Ga0105238_100871232 300
383 3300009553 Ga0105249_10111147 Ga0105249_101111472 300
384 3300010375 Ga0105239_10157409 Ga0105239_101574092 300
385 3300013100 Ga0157373_10007242 Ga0157373_100072424 300
386 3300013102 Ga0157371_10080372 Ga0157371_100803722 300
387 3300013105 Ga0157369_10136539 Ga0157369_101365392 300
388 3300013297 Ga0157378_10061759 Ga0157378_100617593 300
389 3300013307 Ga0157372_10015874 Ga0157372_100158743 300
390 3300013308 Ga0157375_10271487 Ga0157375_102714872 300
391 3300014325 Ga0163163_10004180 Ga0163163_100041801 300
392 3300014326 Ga0157380_10594010 Ga0157380_105940101 300
393 3300014745 Ga0157377_10008339 Ga0157377_100083396 300
394 3300014968 Ga0157379_10106967 Ga0157379_101069672 300
395 3300014969 Ga0157376_10042345 Ga0157376_100423452 300
396 3300025292 Ga0209676_1004734 Ga0209676_10047343 300
397 3300025297 Ga0209758_1000441 Ga0209758_100044143 300
398 3300025297 Ga0209758_1005667 Ga0209758_10056679 300
399 3300025303 Ga0209051_1000435 Ga0209051_100043553 300
400 3300025304 Ga0209257_1000598 Ga0209257_100059857 300
401 3300025315 Ga0207697_10002954 Ga0207697_100029547 300
402 3300025321 Ga0207656_10011251 Ga0207656_100112512 300
403 3300025893 Ga0207682_10003600 Ga0207682_100036002 300
404 3300025901 Ga0207688_10000653 Ga0207688_100006533 300
405 3300025903 Ga0207680_10196472 Ga0207680_101964722 300
406 3300025907 Ga0207645_10000101 Ga0207645_100001013 300
407 3300025908 Ga0207643_10005916 Ga0207643_100059163 300
408 3300025909 Ga0207705_10184792 Ga0207705_101847921 300
409 3300025911 Ga0207654_10056687 Ga0207654_100566871 300
410 3300025913 Ga0207695_10208933 Ga0207695_102089332 300
411 3300025914 Ga0207671_10197605 Ga0207671_101976052 300
412 3300025918 Ga0207662_10000405 Ga0207662_1000040515 300
413 3300025919 Ga0207657_10004536 Ga0207657_100045363 300
414 3300025920 Ga0207649_10014363 Ga0207649_100143632 300
415 3300025923 Ga0207681_10394487 Ga0207681_103944871 300
416 3300025924 Ga0207694_10092513 Ga0207694_100925132 300
417 3300025925 Ga0207650_10011578 Ga0207650_100115782 300
418 3300025926 Ga0207659_10283911 Ga0207659_102839111 300
419 3300025927 Ga0207687_10223531 Ga0207687_102235311 300
420 3300025931 Ga0207644_10108848 Ga0207644_101088482 300
421 3300025932 Ga0207690_10257646 Ga0207690_102576462 300
422 3300025933 Ga0207706_10008018 Ga0207706_100080183 300
423 3300025935 Ga0207709_10200765 Ga0207709_102007652 300
424 3300025936 Ga0207670_10312454 Ga0207670_103124541 300
425 3300025937 Ga0207669_10190636 Ga0207669_101906362 300
426 3300025940 Ga0207691_10000033 Ga0207691_10000033108 300
427 3300025941 Ga0207711_10195987 Ga0207711_101959872 300
428 3300025942 Ga0207689_10009207 Ga0207689_100092072 300
429 3300025949 Ga0207667_10302509 Ga0207667_103025092 300
430 3300025960 Ga0207651_10143918 Ga0207651_101439182 300
431 3300025961 Ga0207712_10149486 Ga0207712_101494862 300
432 3300025972 Ga0207668_10192461 Ga0207668_101924611 300
433 3300025981 Ga0207640_10116462 Ga0207640_101164622 300
434 3300025986 Ga0207658_10303814 Ga0207658_103038142 300
435 3300026023 Ga0207677_10087323 Ga0207677_100873232 300
436 3300026035 Ga0207703_10263979 Ga0207703_102639792 300
437 3300026041 Ga0207639_10239917 Ga0207639_102399172 300
438 3300026067 Ga0207678_10076640 Ga0207678_100766402 300
439 3300026078 Ga0207702_10331196 Ga0207702_103311962 300
440 3300026088 Ga0207641_10228206 Ga0207641_102282062 300
441 3300026089 Ga0207648_10000189 Ga0207648_1000018956 300
442 3300026095 Ga0207676_10191339 Ga0207676_101913392 300
443 3300026116 Ga0207674_10000224 Ga0207674_100002242 300
444 3300026118 Ga0207675_100001594 Ga0207675_1000015942 300
445 3300026121 Ga0207683_10046162 Ga0207683_100461622 300
446 3300026142 Ga0207698_10454425 Ga0207698_104544251 300
447 3300028379 Ga0268266_10063175 Ga0268266_100631753 300
448 3300028380 Ga0268265_10286908 Ga0268265_102869082 300
449 3300028381 Ga0268264_10400889 Ga0268264_104008892 300
450 3300031247 Ga0265340_10038472 Ga0265340_100384723 300
451 3300033180 Ga0307510_10030206 Ga0307510_100302064 300
452 3300035111 Ga0373923_0173005 Ga0373923_0173005_30_938 300
453 3300037466 Ga0395898_0088984 Ga0395898_0088984_1162_2130 300
454 3300038443 Ga0395901_0378692 Ga0395901_0378692_87_995 300
455 3300039447 Ga0436361_0898454 Ga0436361_0898454_460_1371 300
456 3300046501 Ga0495607_0000038 Ga0495607_0000038_60884_61789 300
457 3300046506 Ga0495583_0000804 Ga0495583_0000804_4239_5201 300
458 3300046660 Ga0495625_0176816 Ga0495625_0176816_315_1277 300
459 3300048905 Ga0496102_0028133 Ga0496102_0028133_4080_4982 300
460 3300048909 Ga0496106_0118784 Ga0496106_0118784_600_1502 300
461 3300048913 Ga0496110_0073550 Ga0496110_0073550_587_1501 300
462 3300048914 Ga0496111_0000651 Ga0496111_0000651_2432_3346 300
463 3300048915 Ga0496112_0276737 Ga0496112_0276737_268_1170 300
464 3300048928 Ga0496125_0001098 Ga0496125_0001098_38835_39740 300
465 3300048929 Ga0496126_0160150 Ga0496126_0160150_801_1709 300
466 3300050492 nmdc:mga0yw44_21756_c1 nmdc:mga0yw44_21756_c1_1596_2504 300
467 3300053125 Ga0500618_011084 Ga0500618_011084_1268_2185 300
468 3300053136 Ga0500559_0035910 Ga0500559_0035910_570_1493 300
469 3300053148 Ga0500590_001048 Ga0500590_001048_7333_8250 300
470 3300053153 Ga0500616_0000510 Ga0500616_0000510_7253_8161 300
471 3300053730 Ga0500645_000360 Ga0500645_000360_8258_9166 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

5

64

0.97

PF03466

LysR_substrate

LysR substrate binding domain

88

299

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9077 4 86
5fhk-assembly1.cif.gz_B regulatory domain of aphb in vibrio vulnificus 0.8893 93 298
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.8886 3 71
5x0n-assembly3.cif.gz_E regulatory domain of variant c227s aphb from vibrio vulnificus 0.8861 92 297
5fhk-assembly1.cif.gz_A regulatory domain of aphb in vibrio vulnificus 0.8851 92 297
ID Description Score Start End Superfamily
3t1bB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9392 3 86 1.10.10.10
af_P52044_6_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9268 7 85 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.926 3 83 1.10.10.10
af_P75836_90_290_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9254 91 296 3.40.190.290
af_P77333_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9232 4 90 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4U6BBZ3-F1-model_v4 LysR family transcriptional regulator 0.931 150 299 GO:0003700
GO:0006351
GO:0043565
AF-A0A4U6BBZ3-F1-model_v4 LysR family transcriptional regulator 0.925 150 299 GO:0003700
GO:0006351
GO:0043565
AF-A0A530MND2-F1-model_v4 deleted 0.9249 174 299
AF-A0A530MND2-F1-model_v4 deleted 0.8846 174 299
AF-A0A503JNB7-F1-model_v4 deleted 0.8714 1 297

Feature Viewer

pLDDT pTM Quality
85.08 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map