F450252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 306 | 469 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_10457602|Ga0207681_104576022 |
| Length | 274 |
| Sequence | MPDLLTIERLSAGYGEAVVLNEISLALAEGQSLALLGRNGMGKTTLINSIVGVTRFIGGTIALDGRDITPLRPDQRAHAGIGWVPQERNIFKSLTVEENLTAVARPGRWTLARIYELFPRLDERRRNLGNQLSGGEQQMLAVGRALILNPRVMLLDEPLEGLAPILVEELLRALRRIIRDEGMSAILVEQNAQKVLGVTDRAAILERGAVVYQGASADLSADRAVLESYLGVTAVGPRHHPPQCLALRRVVPVLLLVRVSRMWCSPEHCGAVHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 9 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 169 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 206 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 207 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 208 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 209 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 285 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 304 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.26 |
| Nodule | 0 |
| Rhizoplane | 8.74 |
| Rhizosphere | 85.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544908 | 2209111006 | Bacteria | 36473 |
| 2 | 2214544909 | 2209111006 | Bacteria | 30927 |
| 3 | ARcpr5oldR_c000009 | 3300000041 | Bacteria | 39838 |
| 4 | ARSoilYngRDRAFT_c00030 | 3300000042 | Bacteria | 22085 |
| 5 | ARcpr5yngRDRAFT_c000008 | 3300000043 | Bacteria | 39878 |
| 6 | ARSoilOldRDRAFT_c000009 | 3300000044 | Bacteria | 45329 |
| 7 | ARCol0oldRDRAFT_c00052 | 3300000045 | Bacteria | 9238 |
| 8 | ARCol0yngRDRAFT_1000008 | 3300000652 | Bacteria | 45358 |
| 9 | Ga0065717_1001959 | 3300005276 | Bacteria | 5084 |
| 10 | Ga0065716_1001526 | 3300005277 | Bacteria | 9983 |
| 11 | Ga0065704_10090385 | 3300005289 | Bacteria | 2785 |
| 12 | Ga0065712_10072874 | 3300005290 | Bacteria | 4573 |
| 13 | Ga0065715_10102289 | 3300005293 | Bacteria | 3128 |
| 14 | Ga0065707_10098093 | 3300005295 | Bacteria | 3078 |
| 15 | Ga0070683_100414069 | 3300005329 | Bacteria | 1285 |
| 16 | Ga0070690_100057701 | 3300005330 | Bacteria | 2492 |
| 17 | Ga0070670_100005641 | 3300005331 | Bacteria | 10561 |
| 18 | Ga0070670_100457464 | 3300005331 | Bacteria | 1132 |
| 19 | Ga0070677_10041677 | 3300005333 | Bacteria | 1814 |
| 20 | Ga0068869_100038527 | 3300005334 | Bacteria | 3408 |
| 21 | Ga0068869_100134943 | 3300005334 | Bacteria | 1901 |
| 22 | Ga0070666_10229112 | 3300005335 | Bacteria | 1312 |
| 23 | Ga0070682_100059356 | 3300005337 | Bacteria | 2416 |
| 24 | Ga0068868_100014913 | 3300005338 | Bacteria | 5738 |
| 25 | Ga0070660_100016759 | 3300005339 | Bacteria | 5328 |
| 26 | Ga0070660_100116406 | 3300005339 | Bacteria | 2131 |
| 27 | Ga0070689_100033505 | 3300005340 | Bacteria | 3914 |
| 28 | Ga0070687_100304967 | 3300005343 | Bacteria | 1012 |
| 29 | Ga0070668_100433282 | 3300005347 | Bacteria | 1127 |
| 30 | Ga0070675_100397204 | 3300005354 | Bacteria | 1229 |
| 31 | Ga0070671_100318684 | 3300005355 | Bacteria | 1325 |
| 32 | Ga0070674_100323095 | 3300005356 | Bacteria | 1238 |
| 33 | Ga0070688_100021126 | 3300005365 | Bacteria | 3798 |
| 34 | Ga0070688_100108568 | 3300005365 | Bacteria | 1841 |
| 35 | Ga0070688_100170916 | 3300005365 | Bacteria | 1500 |
| 36 | Ga0070659_100137232 | 3300005366 | Bacteria | 1989 |
| 37 | Ga0070659_100347718 | 3300005366 | Bacteria | 1243 |
| 38 | Ga0070659_100360801 | 3300005366 | Bacteria | 1221 |
| 39 | Ga0070709_10005573 | 3300005434 | Bacteria | 6816 |
| 40 | Ga0070714_100007015 | 3300005435 | Bacteria | 8732 |
| 41 | Ga0070713_100045857 | 3300005436 | Bacteria | 3584 |
| 42 | Ga0070713_100086921 | 3300005436 | Bacteria | 2681 |
| 43 | Ga0070713_100108710 | 3300005436 | Bacteria | 2415 |
| 44 | Ga0070710_10079728 | 3300005437 | Bacteria | 1909 |
| 45 | Ga0070710_10219355 | 3300005437 | Bacteria | 1209 |
| 46 | Ga0070711_100012617 | 3300005439 | Bacteria | 5284 |
| 47 | Ga0070711_100101183 | 3300005439 | Bacteria | 2097 |
| 48 | Ga0070711_100198491 | 3300005439 | Bacteria | 1546 |
| 49 | Ga0070700_100435017 | 3300005441 | Bacteria | 994 |
| 50 | Ga0070694_100032721 | 3300005444 | Bacteria | 3416 |
| 51 | Ga0070708_100026951 | 3300005445 | Bacteria | 4925 |
| 52 | Ga0070663_100329987 | 3300005455 | Bacteria | 1229 |
| 53 | Ga0070662_100142836 | 3300005457 | Bacteria | 1857 |
| 54 | Ga0070662_100171012 | 3300005457 | Bacteria | 1706 |
| 55 | Ga0070681_10408111 | 3300005458 | Bacteria | 1270 |
| 56 | Ga0068867_100603058 | 3300005459 | Bacteria | 958 |
| 57 | Ga0070707_100214539 | 3300005468 | Bacteria | 1875 |
| 58 | Ga0070707_100432487 | 3300005468 | Bacteria | 1276 |
| 59 | Ga0070698_100204564 | 3300005471 | Bacteria | 1909 |
| 60 | Ga0070698_101005845 | 3300005471 | Bacteria | 781 |
| 61 | Ga0070699_100026614 | 3300005518 | Bacteria | 4987 |
| 62 | Ga0070699_100147125 | 3300005518 | Bacteria | 2082 |
| 63 | Ga0070699_100522299 | 3300005518 | Bacteria | 1079 |
| 64 | Ga0068853_100033048 | 3300005539 | Bacteria | 4386 |
| 65 | Ga0068853_100310688 | 3300005539 | Bacteria | 1459 |
| 66 | Ga0068853_100826380 | 3300005539 | Bacteria | 888 |
| 67 | Ga0070672_100018379 | 3300005543 | Bacteria | 5054 |
| 68 | Ga0070672_100163666 | 3300005543 | Bacteria | 1847 |
| 69 | Ga0070696_100050287 | 3300005546 | Bacteria | 2897 |
| 70 | Ga0070696_100073389 | 3300005546 | Bacteria | 2411 |
| 71 | Ga0070665_100083294 | 3300005548 | Bacteria | 3203 |
| 72 | Ga0070704_100133568 | 3300005549 | Bacteria | 1927 |
| 73 | Ga0070664_100053184 | 3300005564 | Bacteria | 3432 |
| 74 | Ga0068857_100372670 | 3300005577 | Bacteria | 1324 |
| 75 | Ga0068852_100059090 | 3300005616 | Bacteria | 3324 |
| 76 | Ga0068859_100198787 | 3300005617 | Bacteria | 2089 |
| 77 | Ga0068859_100237022 | 3300005617 | Bacteria | 1913 |
| 78 | Ga0068864_100087936 | 3300005618 | Bacteria | 2736 |
| 79 | Ga0068866_10121488 | 3300005718 | Bacteria | 1472 |
| 80 | Ga0068861_100094809 | 3300005719 | Bacteria | 2362 |
| 81 | Ga0068863_100529206 | 3300005841 | Bacteria | 1163 |
| 82 | Ga0068858_100597660 | 3300005842 | Bacteria | 1070 |
| 83 | Ga0068860_100040948 | 3300005843 | Bacteria | 4426 |
| 84 | Ga0068860_100058132 | 3300005843 | Bacteria | 3676 |
| 85 | Ga0068860_100316306 | 3300005843 | Bacteria | 1532 |
| 86 | Ga0068862_100070557 | 3300005844 | Bacteria | 3016 |
| 87 | Ga0081455_10014294 | 3300005937 | Bacteria | 7789 |
| 88 | Ga0081455_10048549 | 3300005937 | Bacteria | 3666 |
| 89 | Ga0081455_10085137 | 3300005937 | Bacteria | 2578 |
| 90 | Ga0081455_10305801 | 3300005937 | Bacteria | 1139 |
| 91 | Ga0081455_10371325 | 3300005937 | Bacteria | 1002 |
| 92 | Ga0081538_10000697 | 3300005981 | Bacteria | 36894 |
| 93 | Ga0081538_10014451 | 3300005981 | Bacteria | 6181 |
| 94 | Ga0081540_1001984 | 3300005983 | Bacteria | 17080 |
| 95 | Ga0081540_1012158 | 3300005983 | Bacteria | 5693 |
| 96 | Ga0081539_10002187 | 3300005985 | Bacteria | 28690 |
| 97 | Ga0081539_10089922 | 3300005985 | Bacteria | 1589 |
| 98 | Ga0081539_10132432 | 3300005985 | Bacteria | 1223 |
| 99 | Ga0070717_10005100 | 3300006028 | Bacteria | 9578 |
| 100 | Ga0070717_10214458 | 3300006028 | Bacteria | 1690 |
| 101 | Ga0075365_10007019 | 3300006038 | Bacteria | 6267 |
| 102 | Ga0075365_10287145 | 3300006038 | Bacteria | 1158 |
| 103 | Ga0075368_10016530 | 3300006042 | Bacteria | 2750 |
| 104 | Ga0075363_100058664 | 3300006048 | Bacteria | 2068 |
| 105 | Ga0075364_10005843 | 3300006051 | Bacteria | 7184 |
| 106 | Ga0075432_10034912 | 3300006058 | Bacteria | 1747 |
| 107 | Ga0070715_10000633 | 3300006163 | Bacteria | 9317 |
| 108 | Ga0070716_100262930 | 3300006173 | Bacteria | 1182 |
| 109 | Ga0070712_100002594 | 3300006175 | Bacteria | 11168 |
| 110 | Ga0070712_100188683 | 3300006175 | Bacteria | 1611 |
| 111 | Ga0075362_10002160 | 3300006177 | Bacteria | 6508 |
| 112 | Ga0075367_10102290 | 3300006178 | Bacteria | 1752 |
| 113 | Ga0075367_10207335 | 3300006178 | Bacteria | 1225 |
| 114 | Ga0097621_100608304 | 3300006237 | Bacteria | 1000 |
| 115 | Ga0075428_100001309 | 3300006844 | Bacteria | 26388 |
| 116 | Ga0075428_100042081 | 3300006844 | Bacteria | 5025 |
| 117 | Ga0075430_100012270 | 3300006846 | Bacteria | 7292 |
| 118 | Ga0075431_100000481 | 3300006847 | Bacteria | 33062 |
| 119 | Ga0075431_100004936 | 3300006847 | Bacteria | 13133 |
| 120 | Ga0075431_100787698 | 3300006847 | Bacteria | 924 |
| 121 | Ga0075433_10162597 | 3300006852 | Bacteria | 1987 |
| 122 | Ga0075433_10191217 | 3300006852 | Bacteria | 1821 |
| 123 | Ga0075429_100004654 | 3300006880 | Bacteria | 11805 |
| 124 | Ga0075429_100114444 | 3300006880 | Bacteria | 2358 |
| 125 | Ga0097620_100198788 | 3300006931 | Bacteria | 2089 |
| 126 | Ga0097620_100237019 | 3300006931 | Bacteria | 1913 |
| 127 | Ga0075435_100016071 | 3300007076 | Bacteria | 5637 |
| 128 | Ga0099794_10003747 | 3300007265 | Bacteria | 5855 |
| 129 | Ga0099795_10001476 | 3300007788 | Bacteria | 5118 |
| 130 | Ga0111539_10000242 | 3300009094 | Bacteria | 65417 |
| 131 | Ga0111539_10002444 | 3300009094 | Bacteria | 24696 |
| 132 | Ga0111539_10025408 | 3300009094 | Bacteria | 7261 |
| 133 | Ga0111539_10146701 | 3300009094 | Bacteria | 2763 |
| 134 | Ga0105245_10777946 | 3300009098 | Bacteria | 994 |
| 135 | Ga0105247_10107210 | 3300009101 | Bacteria | 1794 |
| 136 | Ga0105247_10196037 | 3300009101 | Bacteria | 1354 |
| 137 | Ga0114129_10001244 | 3300009147 | Bacteria | 33939 |
| 138 | Ga0114129_10064381 | 3300009147 | Bacteria | 5116 |
| 139 | Ga0114129_10070267 | 3300009147 | Bacteria | 4882 |
| 140 | Ga0114129_10190296 | 3300009147 | Bacteria | 2787 |
| 141 | Ga0105243_10097923 | 3300009148 | Bacteria | 2429 |
| 142 | Ga0105237_10196849 | 3300009545 | Bacteria | 2015 |
| 143 | Ga0105249_10163405 | 3300009553 | Bacteria | 2153 |
| 144 | Ga0099796_10014021 | 3300010159 | Bacteria | 2304 |
| 145 | Ga0105239_10002642 | 3300010375 | Bacteria | 22634 |
| 146 | Ga0105246_10283115 | 3300011119 | Bacteria | 1331 |
| 147 | Ga0157346_1000825 | 3300012480 | Bacteria | 1386 |
| 148 | Ga0157374_10014591 | 3300013296 | Bacteria | 6877 |
| 149 | Ga0157378_10898768 | 3300013297 | Bacteria | 916 |
| 150 | Ga0163162_10009887 | 3300013306 | Bacteria | 9276 |
| 151 | Ga0163162_10699481 | 3300013306 | Bacteria | 1135 |
| 152 | Ga0157375_11082628 | 3300013308 | Bacteria | 938 |
| 153 | Ga0163163_10110902 | 3300014325 | Bacteria | 2772 |
| 154 | Ga0157380_10261024 | 3300014326 | Bacteria | 1573 |
| 155 | Ga0157379_10228187 | 3300014968 | Bacteria | 1688 |
| 156 | Ga0157379_10271438 | 3300014968 | Bacteria | 1542 |
| 157 | Ga0163161_10169336 | 3300017792 | Bacteria | 1669 |
| 158 | Ga0163161_10327468 | 3300017792 | Bacteria | 1213 |
| 159 | Ga0207697_10174050 | 3300025315 | Bacteria | 942 |
| 160 | Ga0207656_10092532 | 3300025321 | Bacteria | 1374 |
| 161 | Ga0207682_10005559 | 3300025893 | Bacteria | 5128 |
| 162 | Ga0207692_10012337 | 3300025898 | Bacteria | 3668 |
| 163 | Ga0207692_10036947 | 3300025898 | Bacteria | 2386 |
| 164 | Ga0207692_10159733 | 3300025898 | Bacteria | 1298 |
| 165 | Ga0207710_10042722 | 3300025900 | Bacteria | 2014 |
| 166 | Ga0207688_10006266 | 3300025901 | Bacteria | 6477 |
| 167 | Ga0207688_10030339 | 3300025901 | Bacteria | 2981 |
| 168 | Ga0207680_10092452 | 3300025903 | Bacteria | 1927 |
| 169 | Ga0207680_10311255 | 3300025903 | Bacteria | 1099 |
| 170 | Ga0207647_10073459 | 3300025904 | Bacteria | 2061 |
| 171 | Ga0207685_10022334 | 3300025905 | Bacteria | 2137 |
| 172 | Ga0207699_10013192 | 3300025906 | Bacteria | 4221 |
| 173 | Ga0207645_10161226 | 3300025907 | Bacteria | 1467 |
| 174 | Ga0207684_10041436 | 3300025910 | Bacteria | 3904 |
| 175 | Ga0207707_10090512 | 3300025912 | Bacteria | 2674 |
| 176 | Ga0207707_10099523 | 3300025912 | Bacteria | 2541 |
| 177 | Ga0207693_10002389 | 3300025915 | Bacteria | 16295 |
| 178 | Ga0207693_10007507 | 3300025915 | Bacteria | 8954 |
| 179 | Ga0207663_10022050 | 3300025916 | Bacteria | 3635 |
| 180 | Ga0207663_10032534 | 3300025916 | Bacteria | 3097 |
| 181 | Ga0207662_10041293 | 3300025918 | Bacteria | 2715 |
| 182 | Ga0207657_10018426 | 3300025919 | Bacteria | 6664 |
| 183 | Ga0207649_10429137 | 3300025920 | Bacteria | 994 |
| 184 | Ga0207681_10457602 | 3300025923 | Bacteria | 1039 |
| 185 | Ga0207650_10010038 | 3300025925 | Bacteria | 6483 |
| 186 | Ga0207650_10273648 | 3300025925 | Bacteria | 1373 |
| 187 | Ga0207700_10013205 | 3300025928 | Bacteria | 5364 |
| 188 | Ga0207700_10149062 | 3300025928 | Bacteria | 1931 |
| 189 | Ga0207700_10355624 | 3300025928 | Bacteria | 1276 |
| 190 | Ga0207700_10464231 | 3300025928 | Bacteria | 1117 |
| 191 | Ga0207690_10127170 | 3300025932 | Bacteria | 1860 |
| 192 | Ga0207706_10008768 | 3300025933 | Bacteria | 9309 |
| 193 | Ga0207706_10160642 | 3300025933 | Bacteria | 1975 |
| 194 | Ga0207706_10283384 | 3300025933 | Bacteria | 1445 |
| 195 | Ga0207686_10101786 | 3300025934 | Bacteria | 1919 |
| 196 | Ga0207709_10357739 | 3300025935 | Bacteria | 1104 |
| 197 | Ga0207709_10447693 | 3300025935 | Bacteria | 997 |
| 198 | Ga0207670_10022757 | 3300025936 | Bacteria | 3889 |
| 199 | Ga0207670_10171464 | 3300025936 | Bacteria | 1627 |
| 200 | Ga0207669_10324601 | 3300025937 | Bacteria | 1179 |
| 201 | Ga0207665_10002185 | 3300025939 | Bacteria | 13223 |
| 202 | Ga0207691_10037320 | 3300025940 | Bacteria | 4500 |
| 203 | Ga0207689_10005950 | 3300025942 | Bacteria | 10794 |
| 204 | Ga0207689_10094860 | 3300025942 | Bacteria | 2450 |
| 205 | Ga0207689_10122029 | 3300025942 | Bacteria | 2143 |
| 206 | Ga0207679_10097232 | 3300025945 | Bacteria | 2293 |
| 207 | Ga0207651_10401229 | 3300025960 | Bacteria | 1166 |
| 208 | Ga0207712_10222646 | 3300025961 | Bacteria | 1509 |
| 209 | Ga0207640_10245051 | 3300025981 | Bacteria | 1387 |
| 210 | Ga0207658_10742486 | 3300025986 | Bacteria | 889 |
| 211 | Ga0207677_10007665 | 3300026023 | Bacteria | 5991 |
| 212 | Ga0207677_10237524 | 3300026023 | Bacteria | 1472 |
| 213 | Ga0207703_10782045 | 3300026035 | Bacteria | 910 |
| 214 | Ga0207678_10049460 | 3300026067 | Bacteria | 3633 |
| 215 | Ga0207708_10009747 | 3300026075 | Bacteria | 7127 |
| 216 | Ga0207641_10120532 | 3300026088 | Bacteria | 2340 |
| 217 | Ga0207641_10223252 | 3300026088 | Bacteria | 1748 |
| 218 | Ga0207648_10011634 | 3300026089 | Bacteria | 8282 |
| 219 | Ga0207648_10330018 | 3300026089 | Bacteria | 1372 |
| 220 | Ga0207676_10029108 | 3300026095 | Bacteria | 4132 |
| 221 | Ga0207676_10301779 | 3300026095 | Bacteria | 1462 |
| 222 | Ga0207674_10032353 | 3300026116 | Bacteria | 5487 |
| 223 | Ga0207674_10409248 | 3300026116 | Bacteria | 1311 |
| 224 | Ga0207675_100002492 | 3300026118 | Bacteria | 18230 |
| 225 | Ga0207683_10007445 | 3300026121 | Bacteria | 9387 |
| 226 | Ga0207683_10225305 | 3300026121 | Bacteria | 1709 |
| 227 | Ga0207698_10661933 | 3300026142 | Bacteria | 1035 |
| 228 | Ga0209588_1020961 | 3300027671 | Bacteria | 2049 |
| 229 | Ga0209813_10018411 | 3300027866 | Bacteria | 1930 |
| 230 | Ga0207428_10000666 | 3300027907 | Bacteria | 40250 |
| 231 | Ga0207428_10001178 | 3300027907 | Bacteria | 28140 |
| 232 | Ga0268266_10289901 | 3300028379 | Bacteria | 1524 |
| 233 | Ga0268264_10443078 | 3300028381 | Bacteria | 1257 |
| 234 | Ga0265330_10167269 | 3300031235 | Bacteria | 933 |
| 235 | Ga0265332_10005817 | 3300031238 | Bacteria | 5654 |
| 236 | Ga0265320_10018789 | 3300031240 | Bacteria | 3797 |
| 237 | Ga0265320_10064013 | 3300031240 | Bacteria | 1748 |
| 238 | Ga0265320_10102696 | 3300031240 | Bacteria | 1315 |
| 239 | Ga0265325_10033915 | 3300031241 | Bacteria | 2720 |
| 240 | Ga0265325_10074202 | 3300031241 | Bacteria | 1702 |
| 241 | Ga0265325_10191220 | 3300031241 | Bacteria | 948 |
| 242 | Ga0265340_10002791 | 3300031247 | Bacteria | 9938 |
| 243 | Ga0265340_10006370 | 3300031247 | Bacteria | 6505 |
| 244 | Ga0265340_10064309 | 3300031247 | Bacteria | 1749 |
| 245 | Ga0265340_10126039 | 3300031247 | Bacteria | 1176 |
| 246 | Ga0265339_10016013 | 3300031249 | Bacteria | 4479 |
| 247 | Ga0265339_10184847 | 3300031249 | Bacteria | 1036 |
| 248 | Ga0265331_10007545 | 3300031250 | Bacteria | 6284 |
| 249 | Ga0265316_10120154 | 3300031344 | Bacteria | 1985 |
| 250 | Ga0265316_10128809 | 3300031344 | Bacteria | 1907 |
| 251 | Ga0265316_10416320 | 3300031344 | Bacteria | 966 |
| 252 | Ga0307513_10031443 | 3300031456 | Bacteria | 6011 |
| 253 | Ga0307513_10173926 | 3300031456 | Bacteria | 2027 |
| 254 | Ga0265313_10013281 | 3300031595 | Bacteria | 4954 |
| 255 | Ga0265342_10013335 | 3300031712 | Bacteria | 5522 |
| 256 | Ga0373950_0015036 | 3300034818 | Bacteria | 1308 |
| 257 | Ga0373958_0000031 | 3300034819 | Bacteria | 14995 |
| 258 | Ga0373959_0000592 | 3300034820 | Bacteria | 6353 |
| 259 | Ga0373938_0000049 | 3300034957 | Bacteria | 15338 |
| 260 | Ga0373928_0000190 | 3300035084 | Bacteria | 11780 |
| 261 | Ga0373929_0000140 | 3300035085 | Bacteria | 12362 |
| 262 | Ga0373940_0000013 | 3300035088 | Bacteria | 23710 |
| 263 | Ga0373944_0007453 | 3300035089 | Bacteria | 2935 |
| 264 | Ga0373944_0087864 | 3300035089 | Bacteria | 1035 |
| 265 | Ga0373949_0000214 | 3300035090 | Bacteria | 21912 |
| 266 | Ga0373951_0001211 | 3300035091 | Bacteria | 6814 |
| 267 | Ga0373952_0000349 | 3300035092 | Bacteria | 7787 |
| 268 | Ga0373932_0000018 | 3300035112 | Bacteria | 53356 |
| 269 | Ga0373936_0032116 | 3300035113 | Bacteria | 2076 |
| 270 | Ga0373939_0006979 | 3300035114 | Bacteria | 2733 |
| 271 | Ga0373941_0000150 | 3300035115 | Bacteria | 12466 |
| 272 | Ga0373954_0026207 | 3300035118 | Bacteria | 2671 |
| 273 | Ga0373960_0000903 | 3300035121 | Bacteria | 6311 |
| 274 | Ga0373943_0033208 | 3300035170 | Bacteria | 2456 |
| 275 | Ga0373943_0050924 | 3300035170 | Bacteria | 2037 |
| 276 | Ga0373946_0015589 | 3300035171 | Bacteria | 2884 |
| 277 | Ga0373946_0038117 | 3300035171 | Bacteria | 1957 |
| 278 | Ga0373955_0002275 | 3300035172 | Bacteria | 8339 |
| 279 | Ga0373942_0000105 | 3300035207 | Bacteria | 18885 |
| 280 | Ga0373961_0000824 | 3300035241 | Bacteria | 10539 |
| 281 | Ga0373962_0000024 | 3300035242 | Bacteria | 39974 |
| 282 | Ga0373924_0012845 | 3300035410 | Bacteria | 3136 |
| 283 | Ga0373931_0004504 | 3300035691 | Bacteria | 6370 |
| 284 | Ga0373927_0043326 | 3300035695 | Bacteria | 2913 |
| 285 | Ga0373933_0003022 | 3300035724 | Bacteria | 9384 |
| 286 | Ga0373947_0431322 | 3300035725 | Bacteria | 891 |
| 287 | Ga0373947_0440215 | 3300035725 | Bacteria | 882 |
| 288 | Ga0373937_0009273 | 3300036401 | Bacteria | 8543 |
| 289 | Ga0373937_0503775 | 3300036401 | Bacteria | 1150 |
| 290 | Ga0373937_0661538 | 3300036401 | Bacteria | 990 |
| 291 | Ga0373925_0028112 | 3300037068 | Bacteria | 4119 |
| 292 | Ga0373925_0035584 | 3300037068 | Bacteria | 3675 |
| 293 | Ga0373925_0051390 | 3300037068 | Bacteria | 3077 |
| 294 | Ga0395898_0129921 | 3300037466 | Bacteria | 2413 |
| 295 | Ga0436364_0295278 | 3300037853 | Bacteria | 1090 |
| 296 | Ga0242420_017365 | 3300038996 | Bacteria | 1259 |
| 297 | Ga0436365_0329197 | 3300039437 | Bacteria | 835 |
| 298 | Ga0436365_1293704 | 3300039437 | Bacteria | 800 |
| 299 | Ga0436365_1890509 | 3300039437 | Bacteria | 10801 |
| 300 | Ga0436361_0144754 | 3300039447 | Bacteria | 3399 |
| 301 | Ga0436361_0315104 | 3300039447 | Bacteria | 1921 |
| 302 | Ga0436361_0875743 | 3300039447 | Bacteria | 16933 |
| 303 | Ga0436363_0516131 | 3300039450 | Bacteria | 1681 |
| 304 | Ga0436362_0956788 | 3300039453 | Bacteria | 920 |
| 305 | Ga0439453_0000191 | 3300041408 | Bacteria | 5892 |
| 306 | Ga0439443_000479 | 3300042003 | Bacteria | 3556 |
| 307 | Ga0439455_0093882 | 3300042012 | Bacteria | 825 |
| 308 | Ga0439435_0008768 | 3300042436 | Bacteria | 2355 |
| 309 | Ga0439464_0093266 | 3300042439 | Bacteria | 909 |
| 310 | Ga0439460_0002004 | 3300042461 | Bacteria | 4875 |
| 311 | Ga0466963_0111374 | 3300044694 | Bacteria | 1879 |
| 312 | Ga0453684_0294718 | 3300044712 | Bacteria | 1845 |
| 313 | Ga0466968_0060977 | 3300044735 | Bacteria | 1627 |
| 314 | Ga0466957_0189905 | 3300044842 | Bacteria | 1345 |
| 315 | Ga0451576_0056628 | 3300045051 | Bacteria | 4099 |
| 316 | Ga0466958_0009837 | 3300045836 | Bacteria | 5337 |
| 317 | Ga0466967_0371237 | 3300045976 | Bacteria | 1388 |
| 318 | Ga0466967_0734433 | 3300045976 | Bacteria | 979 |
| 319 | Ga0495603_0043867 | 3300046455 | Bacteria | 2669 |
| 320 | Ga0495590_0084005 | 3300046457 | Bacteria | 1123 |
| 321 | Ga0495591_030865 | 3300046458 | Bacteria | 1614 |
| 322 | Ga0495629_0022420 | 3300046459 | Bacteria | 4503 |
| 323 | Ga0495641_0053212 | 3300046461 | Bacteria | 1842 |
| 324 | Ga0495651_0121414 | 3300046462 | Bacteria | 1919 |
| 325 | Ga0495582_0008948 | 3300046473 | Bacteria | 5525 |
| 326 | Ga0495605_0036080 | 3300046474 | Bacteria | 2495 |
| 327 | Ga0495639_0006397 | 3300046475 | Bacteria | 5066 |
| 328 | Ga0495584_0101974 | 3300046491 | Bacteria | 1451 |
| 329 | Ga0495585_0235609 | 3300046492 | Bacteria | 918 |
| 330 | Ga0495608_0060995 | 3300046511 | Bacteria | 2481 |
| 331 | Ga0495620_0097718 | 3300046515 | Bacteria | 1173 |
| 332 | Ga0495630_0438894 | 3300046517 | Bacteria | 1000 |
| 333 | Ga0495652_0091711 | 3300046529 | Bacteria | 2483 |
| 334 | Ga0495640_0061115 | 3300046533 | Bacteria | 2560 |
| 335 | Ga0495598_0020028 | 3300046537 | Bacteria | 1761 |
| 336 | Ga0495621_0056299 | 3300046539 | Bacteria | 1418 |
| 337 | Ga0495667_0121991 | 3300046559 | Bacteria | 1682 |
| 338 | Ga0495634_0202186 | 3300046642 | Bacteria | 1234 |
| 339 | Ga0495661_0141414 | 3300046665 | Bacteria | 1309 |
| 340 | Ga0495657_0224189 | 3300046675 | Bacteria | 1139 |
| 341 | Ga0495623_0170830 | 3300046679 | Bacteria | 1270 |
| 342 | Ga0495613_0039689 | 3300046689 | Bacteria | 3490 |
| 343 | Ga0495613_0266820 | 3300046689 | Bacteria | 1191 |
| 344 | Ga0495670_0055863 | 3300046691 | Bacteria | 1980 |
| 345 | Ga0495671_0240567 | 3300046692 | Bacteria | 874 |
| 346 | Ga0495671_0300999 | 3300046692 | Bacteria | 771 |
| 347 | Ga0495649_0179513 | 3300046694 | Bacteria | 1105 |
| 348 | Ga0495674_0579152 | 3300047319 | Bacteria | 891 |
| 349 | Ga0495680_0048502 | 3300047322 | Bacteria | 3334 |
| 350 | Ga0495675_0052703 | 3300047444 | Bacteria | 2583 |
| 351 | Ga0495685_024316 | 3300047447 | Bacteria | 2085 |
| 352 | Ga0495684_0391426 | 3300047471 | Bacteria | 978 |
| 353 | Ga0495593_0061874 | 3300047673 | Bacteria | 1957 |
| 354 | Ga0495602_0014347 | 3300048088 | Bacteria | 8047 |
| 355 | Ga0495614_0029240 | 3300048089 | Bacteria | 2372 |
| 356 | Ga0495615_0043231 | 3300048090 | Bacteria | 1133 |
| 357 | Ga0495615_0050033 | 3300048090 | Bacteria | 1073 |
| 358 | Ga0495615_0081036 | 3300048090 | Bacteria | 890 |
| 359 | Ga0496100_0055136 | 3300048903 | Bacteria | 2596 |
| 360 | Ga0496100_0061619 | 3300048903 | Bacteria | 2472 |
| 361 | Ga0496100_0087580 | 3300048903 | Bacteria | 2117 |
| 362 | Ga0496101_0068641 | 3300048904 | Bacteria | 2592 |
| 363 | Ga0496101_0083386 | 3300048904 | Bacteria | 2366 |
| 364 | Ga0496101_0130865 | 3300048904 | Bacteria | 1905 |
| 365 | Ga0496102_0096325 | 3300048905 | Bacteria | 2743 |
| 366 | Ga0496102_0126437 | 3300048905 | Bacteria | 2390 |
| 367 | Ga0496102_0193095 | 3300048905 | Bacteria | 1919 |
| 368 | Ga0496102_0782688 | 3300048905 | Bacteria | 876 |
| 369 | Ga0496103_0002313 | 3300048906 | Bacteria | 12047 |
| 370 | Ga0496103_0049380 | 3300048906 | Bacteria | 2601 |
| 371 | Ga0496103_0252123 | 3300048906 | Bacteria | 1136 |
| 372 | Ga0496104_0002070 | 3300048907 | Bacteria | 17419 |
| 373 | Ga0496104_0003048 | 3300048907 | Bacteria | 14438 |
| 374 | Ga0496104_0053200 | 3300048907 | Bacteria | 3825 |
| 375 | Ga0496105_0005922 | 3300048908 | Bacteria | 9329 |
| 376 | Ga0496105_0011418 | 3300048908 | Bacteria | 7017 |
| 377 | Ga0496105_0097181 | 3300048908 | Bacteria | 2432 |
| 378 | Ga0496106_0016126 | 3300048909 | Bacteria | 5525 |
| 379 | Ga0496106_0185077 | 3300048909 | Bacteria | 1654 |
| 380 | Ga0496108_0000256 | 3300048911 | Bacteria | 46076 |
| 381 | Ga0496108_0016537 | 3300048911 | Bacteria | 6021 |
| 382 | Ga0496108_0265919 | 3300048911 | Bacteria | 1492 |
| 383 | Ga0496109_0049863 | 3300048912 | Bacteria | 3812 |
| 384 | Ga0496109_0134946 | 3300048912 | Bacteria | 2305 |
| 385 | Ga0496109_0287173 | 3300048912 | Bacteria | 1551 |
| 386 | Ga0496110_0019330 | 3300048913 | Bacteria | 5730 |
| 387 | Ga0496110_0037814 | 3300048913 | Bacteria | 4196 |
| 388 | Ga0496112_0002247 | 3300048915 | Bacteria | 15427 |
| 389 | Ga0496112_0216814 | 3300048915 | Bacteria | 1870 |
| 390 | Ga0496112_0248985 | 3300048915 | Bacteria | 1728 |
| 391 | Ga0496112_0328163 | 3300048915 | Bacteria | 1474 |
| 392 | Ga0496112_0331826 | 3300048915 | Bacteria | 1465 |
| 393 | Ga0496113_0000175 | 3300048916 | Bacteria | 28436 |
| 394 | Ga0496113_0110767 | 3300048916 | Bacteria | 2137 |
| 395 | Ga0496113_0232722 | 3300048916 | Bacteria | 1469 |
| 396 | Ga0496114_0416859 | 3300048917 | Bacteria | 1189 |
| 397 | Ga0496115_0040875 | 3300048918 | Bacteria | 3688 |
| 398 | Ga0496115_0105906 | 3300048918 | Bacteria | 2308 |
| 399 | Ga0496115_0160519 | 3300048918 | Bacteria | 1857 |
| 400 | Ga0501039_0395663 | 3300049575 | Bacteria | 1085 |
| 401 | Ga0501041_0272241 | 3300049577 | Bacteria | 1065 |
| 402 | Ga0501069_0070511 | 3300049585 | Bacteria | 1958 |
| 403 | Ga0501071_0264303 | 3300049587 | Bacteria | 1300 |
| 404 | Ga0501072_0029188 | 3300049588 | Bacteria | 4306 |
| 405 | Ga0501073_0086348 | 3300049589 | Bacteria | 2182 |
| 406 | Ga0501075_0088731 | 3300049591 | Bacteria | 2345 |
| 407 | Ga0501076_0228770 | 3300049592 | Bacteria | 1520 |
| 408 | Ga0501077_0073203 | 3300049593 | Bacteria | 2171 |
| 409 | Ga0501077_0083289 | 3300049593 | Bacteria | 2027 |
| 410 | Ga0501079_0270859 | 3300049741 | Bacteria | 1327 |
| 411 | Ga0501080_0081643 | 3300049742 | Bacteria | 3003 |
| 412 | Ga0501080_0141508 | 3300049742 | Bacteria | 2224 |
| 413 | Ga0501083_0038969 | 3300049744 | Bacteria | 3229 |
| 414 | Ga0501083_0076305 | 3300049744 | Bacteria | 2224 |
| 415 | Ga0501083_0206935 | 3300049744 | Bacteria | 1279 |
| 416 | Ga0501083_0261588 | 3300049744 | Bacteria | 1126 |
| 417 | Ga0501035_0241900 | 3300049822 | Bacteria | 1535 |
| 418 | Ga0501045_0253718 | 3300049824 | Bacteria | 1309 |
| 419 | nmdc:mga03683_50241_c1 | 3300050489 | Bacteria | 1738 |
| 420 | nmdc:mga0yw44_365273_c1 | 3300050492 | Bacteria | 973 |
| 421 | nmdc:mga0yw44_392405_c1 | 3300050492 | Bacteria | 938 |
| 422 | nmdc:mga0yw44_50255_c1 | 3300050492 | Bacteria | 2520 |
| 423 | nmdc:mga0k408_26331_c1 | 3300050493 | Bacteria | 3297 |
| 424 | nmdc:mga04h51_13525_c1 | 3300050495 | Bacteria | 2312 |
| 425 | nmdc:mga05p37_28962_c1 | 3300050507 | Bacteria | 6757 |
| 426 | nmdc:mga05p37_450600_c1 | 3300050507 | Bacteria | 1490 |
| 427 | nmdc:mga05p37_528_c1 | 3300050507 | Bacteria | 42336 |
| 428 | nmdc:mga09592_704_c1 | 3300050508 | Bacteria | 25621 |
| 429 | nmdc:mga09592_74550_c1 | 3300050508 | Bacteria | 2883 |
| 430 | nmdc:mga0qj67_142805_c1 | 3300050509 | Bacteria | 1941 |
| 431 | nmdc:mga0qj67_244176_c1 | 3300050509 | Bacteria | 1457 |
| 432 | nmdc:mga0qj67_26958_c1 | 3300050509 | Bacteria | 4450 |
| 433 | nmdc:mga06r32_241_c1 | 3300050510 | Bacteria | 44852 |
| 434 | nmdc:mga06r32_244045_c1 | 3300050510 | Bacteria | 1783 |
| 435 | nmdc:mga06r32_54107_c1 | 3300050510 | Bacteria | 3848 |
| 436 | nmdc:mga08y16_427_c1 | 3300050511 | Bacteria | 38825 |
| 437 | nmdc:mga08y16_643083_c1 | 3300050511 | Bacteria | 1065 |
| 438 | nmdc:mga0n895_12968_c2 | 3300050512 | Bacteria | 5030 |
| 439 | nmdc:mga0n895_22863_c1 | 3300050512 | Bacteria | 5865 |
| 440 | nmdc:mga0n895_313745_c1 | 3300050512 | Bacteria | 1589 |
| 441 | nmdc:mga0n895_41615_c1 | 3300050512 | Bacteria | 4467 |
| 442 | nmdc:mga0n895_47251_c1 | 3300050512 | Bacteria | 4208 |
| 443 | nmdc:mga0n895_541873_c1 | 3300050512 | Bacteria | 1170 |
| 444 | nmdc:mga0n895_703470_c1 | 3300050512 | Bacteria | 1006 |
| 445 | nmdc:mga0n895_7409_c1 | 3300050512 | Bacteria | 9417 |
| 446 | nmdc:mga0rr50_196108_c1 | 3300050513 | Bacteria | 1657 |
| 447 | nmdc:mga0rr50_34258_c1 | 3300050513 | Bacteria | 3635 |
| 448 | nmdc:mga0rr50_93276_c1 | 3300050513 | Bacteria | 2348 |
| 449 | nmdc:mga08x19_141621_c1 | 3300050514 | Bacteria | 1624 |
| 450 | nmdc:mga0a205_134359_c1 | 3300050515 | Bacteria | 2374 |
| 451 | nmdc:mga0a205_38262_c1 | 3300050515 | Bacteria | 4614 |
| 452 | nmdc:mga0sz30_104888_c1 | 3300050516 | Bacteria | 1236 |
| 453 | Ga0495601_0015849 | 3300053077 | Bacteria | 4561 |
| 454 | Ga0495601_0081475 | 3300053077 | Bacteria | 2077 |
| 455 | Ga0495601_0099834 | 3300053077 | Bacteria | 1874 |
| 456 | Ga0495612_0070547 | 3300053078 | Bacteria | 1456 |
| 457 | Ga0500610_0118827 | 3300053079 | Bacteria | 1353 |
| 458 | Ga0495595_0006402 | 3300053084 | Bacteria | 4801 |
| 459 | Ga0495595_0272347 | 3300053084 | Bacteria | 849 |
| 460 | Ga0495619_0002191 | 3300053085 | Bacteria | 12937 |
| 461 | Ga0495619_0029350 | 3300053085 | Bacteria | 3552 |
| 462 | Ga0495619_0153193 | 3300053085 | Bacteria | 1590 |
| 463 | Ga0500641_0068488 | 3300053096 | Bacteria | 1490 |
| 464 | Ga0500642_0221985 | 3300053130 | Bacteria | 875 |
| 465 | Ga0500611_043340 | 3300053727 | Bacteria | 999 |
| 466 | Ga0501084_0643054 | 3300054114 | Bacteria | 895 |
| 467 | Ga0501082_0000205 | 3300060353 | Bacteria | 51540 |
| 468 | Ga0501082_0720534 | 3300060353 | Bacteria | 873 |
| 469 | Ga0530510_0226076 | 3300061734 | Bacteria | 1392 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100014913 | Ga0068868_1000149135 | 201 |
| 2 | 3300025928 | Ga0207700_10149062 | Ga0207700_101490622 | 201 |
| 3 | 3300026023 | Ga0207677_10007665 | Ga0207677_100076654 | 201 |
| 4 | 3300039437 | Ga0436365_0329197 | Ga0436365_0329197_28_765 | 201 |
| 5 | 3300049742 | Ga0501080_0081643 | Ga0501080_0081643_1871_2599 | 202 |
| 6 | 3300035725 | Ga0373947_0440215 | Ga0373947_0440215_185_868 | 204 |
| 7 | 3300039453 | Ga0436362_0956788 | Ga0436362_0956788_200_883 | 205 |
| 8 | 3300039447 | Ga0436361_0144754 | Ga0436361_0144754_1229_1960 | 207 |
| 9 | 3300005937 | Ga0081455_10371325 | Ga0081455_103713251 | 211 |
| 10 | 3300025912 | Ga0207707_10090512 | Ga0207707_100905122 | 211 |
| 11 | 3300005445 | Ga0070708_100026951 | Ga0070708_1000269514 | 212 |
| 12 | 3300005518 | Ga0070699_100147125 | Ga0070699_1001471252 | 212 |
| 13 | 3300005985 | Ga0081539_10089922 | Ga0081539_100899222 | 212 |
| 14 | 3300050512 | nmdc:mga0n895_703470_c1 | nmdc:mga0n895_703470_c1_185_889 | 212 |
| 15 | 3300025986 | Ga0207658_10742486 | Ga0207658_107424861 | 213 |
| 16 | 3300005981 | Ga0081538_10014451 | Ga0081538_100144513 | 214 |
| 17 | 3300039447 | Ga0436361_0875743 | Ga0436361_0875743_765_1478 | 215 |
| 18 | 3300005436 | Ga0070713_100108710 | Ga0070713_1001087103 | 216 |
| 19 | 3300006844 | Ga0075428_100001309 | Ga0075428_10000130924 | 216 |
| 20 | 3300006846 | Ga0075430_100012270 | Ga0075430_1000122707 | 216 |
| 21 | 3300006847 | Ga0075431_100000481 | Ga0075431_10000048113 | 216 |
| 22 | 3300006880 | Ga0075429_100004654 | Ga0075429_1000046545 | 216 |
| 23 | 3300009094 | Ga0111539_10002444 | Ga0111539_1000244413 | 216 |
| 24 | 3300009147 | Ga0114129_10001244 | Ga0114129_1000124422 | 216 |
| 25 | 3300025928 | Ga0207700_10013205 | Ga0207700_100132053 | 216 |
| 26 | 3300027907 | Ga0207428_10001178 | Ga0207428_1000117830 | 216 |
| 27 | 3300035113 | Ga0373936_0032116 | Ga0373936_0032116_1173_1892 | 216 |
| 28 | 3300046539 | Ga0495621_0056299 | Ga0495621_0056299_600_1319 | 216 |
| 29 | 3300046689 | Ga0495613_0039689 | Ga0495613_0039689_2220_2939 | 216 |
| 30 | 3300046692 | Ga0495671_0300999 | Ga0495671_0300999_10_729 | 216 |
| 31 | 3300049742 | Ga0501080_0141508 | Ga0501080_0141508_633_1349 | 216 |
| 32 | 3300050507 | nmdc:mga05p37_528_c1 | nmdc:mga05p37_528_c1_34062_34808 | 216 |
| 33 | 3300050508 | nmdc:mga09592_704_c1 | nmdc:mga09592_704_c1_17558_18304 | 216 |
| 34 | 3300050509 | nmdc:mga0qj67_26958_c1 | nmdc:mga0qj67_26958_c1_331_1077 | 216 |
| 35 | 3300050510 | nmdc:mga06r32_241_c1 | nmdc:mga06r32_241_c1_36133_36879 | 216 |
| 36 | 3300050511 | nmdc:mga08y16_427_c1 | nmdc:mga08y16_427_c1_11019_11765 | 216 |
| 37 | 3300050512 | nmdc:mga0n895_47251_c1 | nmdc:mga0n895_47251_c1_739_1458 | 216 |
| 38 | 3300005334 | Ga0068869_100038527 | Ga0068869_1000385273 | 217 |
| 39 | 3300006852 | Ga0075433_10162597 | Ga0075433_101625972 | 217 |
| 40 | 3300025942 | Ga0207689_10094860 | Ga0207689_100948603 | 217 |
| 41 | 3300046694 | Ga0495649_0179513 | Ga0495649_0179513_373_1095 | 217 |
| 42 | 3300049744 | Ga0501083_0261588 | Ga0501083_0261588_111_833 | 217 |
| 43 | 3300031247 | Ga0265340_10064309 | Ga0265340_100643092 | 218 |
| 44 | 3300045976 | Ga0466967_0734433 | Ga0466967_0734433_21_755 | 219 |
| 45 | 3300049585 | Ga0501069_0070511 | Ga0501069_0070511_309_1040 | 219 |
| 46 | 3300049589 | Ga0501073_0086348 | Ga0501073_0086348_908_1636 | 219 |
| 47 | 3300049744 | Ga0501083_0076305 | Ga0501083_0076305_1182_1913 | 219 |
| 48 | 3300005434 | Ga0070709_10005573 | Ga0070709_100055733 | 220 |
| 49 | 3300005435 | Ga0070714_100007015 | Ga0070714_1000070153 | 220 |
| 50 | 3300005436 | Ga0070713_100086921 | Ga0070713_1000869212 | 220 |
| 51 | 3300005437 | Ga0070710_10219355 | Ga0070710_102193551 | 220 |
| 52 | 3300005439 | Ga0070711_100012617 | Ga0070711_1000126175 | 220 |
| 53 | 3300005468 | Ga0070707_100214539 | Ga0070707_1002145391 | 220 |
| 54 | 3300005468 | Ga0070707_100432487 | Ga0070707_1004324871 | 220 |
| 55 | 3300005471 | Ga0070698_100204564 | Ga0070698_1002045642 | 220 |
| 56 | 3300005471 | Ga0070698_101005845 | Ga0070698_1010058451 | 220 |
| 57 | 3300005518 | Ga0070699_100026614 | Ga0070699_1000266141 | 220 |
| 58 | 3300005518 | Ga0070699_100522299 | Ga0070699_1005222991 | 220 |
| 59 | 3300005546 | Ga0070696_100073389 | Ga0070696_1000733893 | 220 |
| 60 | 3300005937 | Ga0081455_10014294 | Ga0081455_100142945 | 220 |
| 61 | 3300005937 | Ga0081455_10048549 | Ga0081455_100485494 | 220 |
| 62 | 3300005937 | Ga0081455_10085137 | Ga0081455_100851372 | 220 |
| 63 | 3300005983 | Ga0081540_1001984 | Ga0081540_10019842 | 220 |
| 64 | 3300006028 | Ga0070717_10005100 | Ga0070717_100051002 | 220 |
| 65 | 3300006028 | Ga0070717_10214458 | Ga0070717_102144582 | 220 |
| 66 | 3300006038 | Ga0075365_10287145 | Ga0075365_102871451 | 220 |
| 67 | 3300006048 | Ga0075363_100058664 | Ga0075363_1000586642 | 220 |
| 68 | 3300006051 | Ga0075364_10005843 | Ga0075364_100058437 | 220 |
| 69 | 3300006163 | Ga0070715_10000633 | Ga0070715_100006338 | 220 |
| 70 | 3300006173 | Ga0070716_100262930 | Ga0070716_1002629302 | 220 |
| 71 | 3300006175 | Ga0070712_100188683 | Ga0070712_1001886832 | 220 |
| 72 | 3300006177 | Ga0075362_10002160 | Ga0075362_100021607 | 220 |
| 73 | 3300006844 | Ga0075428_100042081 | Ga0075428_1000420815 | 220 |
| 74 | 3300006847 | Ga0075431_100004936 | Ga0075431_1000049362 | 220 |
| 75 | 3300006847 | Ga0075431_100787698 | Ga0075431_1007876982 | 220 |
| 76 | 3300006852 | Ga0075433_10191217 | Ga0075433_101912171 | 220 |
| 77 | 3300009147 | Ga0114129_10064381 | Ga0114129_100643814 | 220 |
| 78 | 3300025898 | Ga0207692_10012337 | Ga0207692_100123372 | 220 |
| 79 | 3300025905 | Ga0207685_10022334 | Ga0207685_100223342 | 220 |
| 80 | 3300025906 | Ga0207699_10013192 | Ga0207699_100131923 | 220 |
| 81 | 3300025910 | Ga0207684_10041436 | Ga0207684_100414363 | 220 |
| 82 | 3300025915 | Ga0207693_10002389 | Ga0207693_100023893 | 220 |
| 83 | 3300025916 | Ga0207663_10022050 | Ga0207663_100220503 | 220 |
| 84 | 3300025928 | Ga0207700_10464231 | Ga0207700_104642312 | 220 |
| 85 | 3300025939 | Ga0207665_10002185 | Ga0207665_100021852 | 220 |
| 86 | 3300031456 | Ga0307513_10031443 | Ga0307513_100314435 | 220 |
| 87 | 3300031456 | Ga0307513_10173926 | Ga0307513_101739263 | 220 |
| 88 | 3300037068 | Ga0373925_0051390 | Ga0373925_0051390_2309_3043 | 220 |
| 89 | 3300037466 | Ga0395898_0129921 | Ga0395898_0129921_1666_2397 | 220 |
| 90 | 3300038996 | Ga0242420_017365 | Ga0242420_017365_262_993 | 220 |
| 91 | 3300039450 | Ga0436363_0516131 | Ga0436363_0516131_459_1190 | 220 |
| 92 | 3300048903 | Ga0496100_0055136 | Ga0496100_0055136_279_1010 | 220 |
| 93 | 3300048905 | Ga0496102_0126437 | Ga0496102_0126437_703_1434 | 220 |
| 94 | 3300048913 | Ga0496110_0019330 | Ga0496110_0019330_3738_4469 | 220 |
| 95 | 3300049587 | Ga0501071_0264303 | Ga0501071_0264303_283_1029 | 220 |
| 96 | 3300049591 | Ga0501075_0088731 | Ga0501075_0088731_685_1431 | 220 |
| 97 | 3300049593 | Ga0501077_0083289 | Ga0501077_0083289_550_1296 | 220 |
| 98 | 3300049741 | Ga0501079_0270859 | Ga0501079_0270859_164_910 | 220 |
| 99 | 3300049824 | Ga0501045_0253718 | Ga0501045_0253718_342_1088 | 220 |
| 100 | 3300050489 | nmdc:mga03683_50241_c1 | nmdc:mga03683_50241_c1_841_1572 | 220 |
| 101 | 3300050492 | nmdc:mga0yw44_365273_c1 | nmdc:mga0yw44_365273_c1_159_893 | 220 |
| 102 | 3300050493 | nmdc:mga0k408_26331_c1 | nmdc:mga0k408_26331_c1_2416_3147 | 220 |
| 103 | 3300050507 | nmdc:mga05p37_450600_c1 | nmdc:mga05p37_450600_c1_738_1469 | 220 |
| 104 | 3300050509 | nmdc:mga0qj67_142805_c1 | nmdc:mga0qj67_142805_c1_603_1334 | 220 |
| 105 | 3300050510 | nmdc:mga06r32_244045_c1 | nmdc:mga06r32_244045_c1_936_1667 | 220 |
| 106 | 3300050510 | nmdc:mga06r32_54107_c1 | nmdc:mga06r32_54107_c1_1232_1963 | 220 |
| 107 | 3300050511 | nmdc:mga08y16_643083_c1 | nmdc:mga08y16_643083_c1_192_923 | 220 |
| 108 | 3300050512 | nmdc:mga0n895_541873_c1 | nmdc:mga0n895_541873_c1_203_934 | 220 |
| 109 | 3300050513 | nmdc:mga0rr50_196108_c1 | nmdc:mga0rr50_196108_c1_459_1190 | 220 |
| 110 | 3300050515 | nmdc:mga0a205_134359_c1 | nmdc:mga0a205_134359_c1_1615_2346 | 220 |
| 111 | 3300053096 | Ga0500641_0068488 | Ga0500641_0068488_483_1217 | 220 |
| 112 | 3300053130 | Ga0500642_0221985 | Ga0500642_0221985_93_827 | 220 |
| 113 | 3300053727 | Ga0500611_043340 | Ga0500611_043340_203_937 | 220 |
| 114 | 3300054114 | Ga0501084_0643054 | Ga0501084_0643054_14_760 | 220 |
| 115 | 3300060353 | Ga0501082_0720534 | Ga0501082_0720534_61_807 | 220 |
| 116 | 3300061734 | Ga0530510_0226076 | Ga0530510_0226076_178_924 | 220 |
| 117 | 3300005439 | Ga0070711_100101183 | Ga0070711_1001011832 | 221 |
| 118 | 3300005983 | Ga0081540_1012158 | Ga0081540_10121582 | 221 |
| 119 | 3300006038 | Ga0075365_10007019 | Ga0075365_100070196 | 221 |
| 120 | 3300006880 | Ga0075429_100114444 | Ga0075429_1001144442 | 221 |
| 121 | 3300007788 | Ga0099795_10001476 | Ga0099795_100014765 | 221 |
| 122 | 3300009147 | Ga0114129_10070267 | Ga0114129_100702673 | 221 |
| 123 | 3300010159 | Ga0099796_10014021 | Ga0099796_100140212 | 221 |
| 124 | 3300026089 | Ga0207648_10011634 | Ga0207648_100116342 | 221 |
| 125 | 3300031240 | Ga0265320_10064013 | Ga0265320_100640132 | 221 |
| 126 | 3300031241 | Ga0265325_10074202 | Ga0265325_100742022 | 221 |
| 127 | 3300031247 | Ga0265340_10126039 | Ga0265340_101260392 | 221 |
| 128 | 3300031249 | Ga0265339_10184847 | Ga0265339_101848472 | 221 |
| 129 | 3300031344 | Ga0265316_10120154 | Ga0265316_101201543 | 221 |
| 130 | 3300035089 | Ga0373944_0007453 | Ga0373944_0007453_2035_2769 | 221 |
| 131 | 3300035089 | Ga0373944_0087864 | Ga0373944_0087864_156_887 | 221 |
| 132 | 3300035170 | Ga0373943_0033208 | Ga0373943_0033208_1454_2188 | 221 |
| 133 | 3300035171 | Ga0373946_0015589 | Ga0373946_0015589_1699_2433 | 221 |
| 134 | 3300035171 | Ga0373946_0038117 | Ga0373946_0038117_460_1194 | 221 |
| 135 | 3300035695 | Ga0373927_0043326 | Ga0373927_0043326_199_933 | 221 |
| 136 | 3300035725 | Ga0373947_0431322 | Ga0373947_0431322_148_879 | 221 |
| 137 | 3300037068 | Ga0373925_0028112 | Ga0373925_0028112_747_1478 | 221 |
| 138 | 3300037853 | Ga0436364_0295278 | Ga0436364_0295278_96_830 | 221 |
| 139 | 3300046455 | Ga0495603_0043867 | Ga0495603_0043867_103_837 | 221 |
| 140 | 3300046457 | Ga0495590_0084005 | Ga0495590_0084005_358_1092 | 221 |
| 141 | 3300046458 | Ga0495591_030865 | Ga0495591_030865_448_1182 | 221 |
| 142 | 3300046461 | Ga0495641_0053212 | Ga0495641_0053212_514_1248 | 221 |
| 143 | 3300046473 | Ga0495582_0008948 | Ga0495582_0008948_4210_4944 | 221 |
| 144 | 3300046475 | Ga0495639_0006397 | Ga0495639_0006397_88_822 | 221 |
| 145 | 3300046491 | Ga0495584_0101974 | Ga0495584_0101974_639_1373 | 221 |
| 146 | 3300046533 | Ga0495640_0061115 | Ga0495640_0061115_759_1490 | 221 |
| 147 | 3300046691 | Ga0495670_0055863 | Ga0495670_0055863_990_1724 | 221 |
| 148 | 3300048090 | Ga0495615_0050033 | Ga0495615_0050033_240_974 | 221 |
| 149 | 3300049588 | Ga0501072_0029188 | Ga0501072_0029188_2240_2980 | 221 |
| 150 | 3300049744 | Ga0501083_0206935 | Ga0501083_0206935_305_1036 | 221 |
| 151 | 3300050492 | nmdc:mga0yw44_50255_c1 | nmdc:mga0yw44_50255_c1_1016_1750 | 221 |
| 152 | 3300050507 | nmdc:mga05p37_28962_c1 | nmdc:mga05p37_28962_c1_3069_3803 | 221 |
| 153 | 3300050508 | nmdc:mga09592_74550_c1 | nmdc:mga09592_74550_c1_1411_2145 | 221 |
| 154 | 3300050512 | nmdc:mga0n895_22863_c1 | nmdc:mga0n895_22863_c1_360_1094 | 221 |
| 155 | 3300050514 | nmdc:mga08x19_141621_c1 | nmdc:mga08x19_141621_c1_671_1405 | 221 |
| 156 | 3300005329 | Ga0070683_100414069 | Ga0070683_1004140692 | 222 |
| 157 | 3300005330 | Ga0070690_100057701 | Ga0070690_1000577013 | 222 |
| 158 | 3300005331 | Ga0070670_100005641 | Ga0070670_1000056416 | 222 |
| 159 | 3300005331 | Ga0070670_100457464 | Ga0070670_1004574642 | 222 |
| 160 | 3300005333 | Ga0070677_10041677 | Ga0070677_100416772 | 222 |
| 161 | 3300005334 | Ga0068869_100134943 | Ga0068869_1001349432 | 222 |
| 162 | 3300005335 | Ga0070666_10229112 | Ga0070666_102291121 | 222 |
| 163 | 3300005339 | Ga0070660_100116406 | Ga0070660_1001164062 | 222 |
| 164 | 3300005340 | Ga0070689_100033505 | Ga0070689_1000335053 | 222 |
| 165 | 3300005343 | Ga0070687_100304967 | Ga0070687_1003049672 | 222 |
| 166 | 3300005347 | Ga0070668_100433282 | Ga0070668_1004332821 | 222 |
| 167 | 3300005354 | Ga0070675_100397204 | Ga0070675_1003972041 | 222 |
| 168 | 3300005355 | Ga0070671_100318684 | Ga0070671_1003186842 | 222 |
| 169 | 3300005356 | Ga0070674_100323095 | Ga0070674_1003230951 | 222 |
| 170 | 3300005365 | Ga0070688_100108568 | Ga0070688_1001085682 | 222 |
| 171 | 3300005365 | Ga0070688_100170916 | Ga0070688_1001709162 | 222 |
| 172 | 3300005366 | Ga0070659_100347718 | Ga0070659_1003477181 | 222 |
| 173 | 3300005366 | Ga0070659_100360801 | Ga0070659_1003608012 | 222 |
| 174 | 3300005436 | Ga0070713_100045857 | Ga0070713_1000458572 | 222 |
| 175 | 3300005437 | Ga0070710_10079728 | Ga0070710_100797283 | 222 |
| 176 | 3300005439 | Ga0070711_100198491 | Ga0070711_1001984912 | 222 |
| 177 | 3300005441 | Ga0070700_100435017 | Ga0070700_1004350171 | 222 |
| 178 | 3300005455 | Ga0070663_100329987 | Ga0070663_1003299871 | 222 |
| 179 | 3300005457 | Ga0070662_100142836 | Ga0070662_1001428361 | 222 |
| 180 | 3300005457 | Ga0070662_100171012 | Ga0070662_1001710121 | 222 |
| 181 | 3300005459 | Ga0068867_100603058 | Ga0068867_1006030582 | 222 |
| 182 | 3300005539 | Ga0068853_100033048 | Ga0068853_1000330484 | 222 |
| 183 | 3300005539 | Ga0068853_100826380 | Ga0068853_1008263801 | 222 |
| 184 | 3300005543 | Ga0070672_100018379 | Ga0070672_1000183794 | 222 |
| 185 | 3300005543 | Ga0070672_100163666 | Ga0070672_1001636662 | 222 |
| 186 | 3300005548 | Ga0070665_100083294 | Ga0070665_1000832942 | 222 |
| 187 | 3300005564 | Ga0070664_100053184 | Ga0070664_1000531843 | 222 |
| 188 | 3300005577 | Ga0068857_100372670 | Ga0068857_1003726702 | 222 |
| 189 | 3300005616 | Ga0068852_100059090 | Ga0068852_1000590903 | 222 |
| 190 | 3300005617 | Ga0068859_100237022 | Ga0068859_1002370222 | 222 |
| 191 | 3300005618 | Ga0068864_100087936 | Ga0068864_1000879363 | 222 |
| 192 | 3300005718 | Ga0068866_10121488 | Ga0068866_101214882 | 222 |
| 193 | 3300005719 | Ga0068861_100094809 | Ga0068861_1000948093 | 222 |
| 194 | 3300005841 | Ga0068863_100529206 | Ga0068863_1005292061 | 222 |
| 195 | 3300005843 | Ga0068860_100040948 | Ga0068860_1000409483 | 222 |
| 196 | 3300005843 | Ga0068860_100316306 | Ga0068860_1003163062 | 222 |
| 197 | 3300005937 | Ga0081455_10305801 | Ga0081455_103058011 | 222 |
| 198 | 3300005981 | Ga0081538_10000697 | Ga0081538_1000069722 | 222 |
| 199 | 3300005985 | Ga0081539_10002187 | Ga0081539_100021878 | 222 |
| 200 | 3300005985 | Ga0081539_10132432 | Ga0081539_101324322 | 222 |
| 201 | 3300006042 | Ga0075368_10016530 | Ga0075368_100165303 | 222 |
| 202 | 3300006175 | Ga0070712_100002594 | Ga0070712_1000025943 | 222 |
| 203 | 3300006178 | Ga0075367_10102290 | Ga0075367_101022902 | 222 |
| 204 | 3300006178 | Ga0075367_10207335 | Ga0075367_102073352 | 222 |
| 205 | 3300006237 | Ga0097621_100608304 | Ga0097621_1006083042 | 222 |
| 206 | 3300006931 | Ga0097620_100237019 | Ga0097620_1002370192 | 222 |
| 207 | 3300007076 | Ga0075435_100016071 | Ga0075435_1000160714 | 222 |
| 208 | 3300007265 | Ga0099794_10003747 | Ga0099794_100037472 | 222 |
| 209 | 3300009094 | Ga0111539_10025408 | Ga0111539_100254082 | 222 |
| 210 | 3300009094 | Ga0111539_10146701 | Ga0111539_101467012 | 222 |
| 211 | 3300009098 | Ga0105245_10777946 | Ga0105245_107779461 | 222 |
| 212 | 3300009101 | Ga0105247_10107210 | Ga0105247_101072102 | 222 |
| 213 | 3300009101 | Ga0105247_10196037 | Ga0105247_101960372 | 222 |
| 214 | 3300009147 | Ga0114129_10190296 | Ga0114129_101902962 | 222 |
| 215 | 3300009545 | Ga0105237_10196849 | Ga0105237_101968492 | 222 |
| 216 | 3300009553 | Ga0105249_10163405 | Ga0105249_101634052 | 222 |
| 217 | 3300011119 | Ga0105246_10283115 | Ga0105246_102831151 | 222 |
| 218 | 3300013296 | Ga0157374_10014591 | Ga0157374_100145914 | 222 |
| 219 | 3300013297 | Ga0157378_10898768 | Ga0157378_108987682 | 222 |
| 220 | 3300013306 | Ga0163162_10699481 | Ga0163162_106994812 | 222 |
| 221 | 3300013308 | Ga0157375_11082628 | Ga0157375_110826281 | 222 |
| 222 | 3300014325 | Ga0163163_10110902 | Ga0163163_101109022 | 222 |
| 223 | 3300014326 | Ga0157380_10261024 | Ga0157380_102610242 | 222 |
| 224 | 3300014968 | Ga0157379_10228187 | Ga0157379_102281872 | 222 |
| 225 | 3300014968 | Ga0157379_10271438 | Ga0157379_102714382 | 222 |
| 226 | 3300017792 | Ga0163161_10169336 | Ga0163161_101693362 | 222 |
| 227 | 3300017792 | Ga0163161_10327468 | Ga0163161_103274682 | 222 |
| 228 | 3300025315 | Ga0207697_10174050 | Ga0207697_101740502 | 222 |
| 229 | 3300025321 | Ga0207656_10092532 | Ga0207656_100925322 | 222 |
| 230 | 3300025893 | Ga0207682_10005559 | Ga0207682_100055595 | 222 |
| 231 | 3300025898 | Ga0207692_10036947 | Ga0207692_100369473 | 222 |
| 232 | 3300025898 | Ga0207692_10159733 | Ga0207692_101597332 | 222 |
| 233 | 3300025900 | Ga0207710_10042722 | Ga0207710_100427222 | 222 |
| 234 | 3300025901 | Ga0207688_10006266 | Ga0207688_100062666 | 222 |
| 235 | 3300025901 | Ga0207688_10030339 | Ga0207688_100303391 | 222 |
| 236 | 3300025903 | Ga0207680_10092452 | Ga0207680_100924521 | 222 |
| 237 | 3300025903 | Ga0207680_10311255 | Ga0207680_103112552 | 222 |
| 238 | 3300025904 | Ga0207647_10073459 | Ga0207647_100734592 | 222 |
| 239 | 3300025915 | Ga0207693_10007507 | Ga0207693_100075077 | 222 |
| 240 | 3300025916 | Ga0207663_10032534 | Ga0207663_100325343 | 222 |
| 241 | 3300025918 | Ga0207662_10041293 | Ga0207662_100412931 | 222 |
| 242 | 3300025920 | Ga0207649_10429137 | Ga0207649_104291371 | 222 |
| 243 | 3300025925 | Ga0207650_10010038 | Ga0207650_100100383 | 222 |
| 244 | 3300025925 | Ga0207650_10273648 | Ga0207650_102736482 | 222 |
| 245 | 3300025928 | Ga0207700_10355624 | Ga0207700_103556242 | 222 |
| 246 | 3300025933 | Ga0207706_10008768 | Ga0207706_100087687 | 222 |
| 247 | 3300025933 | Ga0207706_10160642 | Ga0207706_101606423 | 222 |
| 248 | 3300025933 | Ga0207706_10283384 | Ga0207706_102833842 | 222 |
| 249 | 3300025934 | Ga0207686_10101786 | Ga0207686_101017863 | 222 |
| 250 | 3300025935 | Ga0207709_10357739 | Ga0207709_103577391 | 222 |
| 251 | 3300025936 | Ga0207670_10022757 | Ga0207670_100227574 | 222 |
| 252 | 3300025936 | Ga0207670_10171464 | Ga0207670_101714642 | 222 |
| 253 | 3300025937 | Ga0207669_10324601 | Ga0207669_103246011 | 222 |
| 254 | 3300025940 | Ga0207691_10037320 | Ga0207691_100373204 | 222 |
| 255 | 3300025942 | Ga0207689_10005950 | Ga0207689_100059506 | 222 |
| 256 | 3300025942 | Ga0207689_10122029 | Ga0207689_101220292 | 222 |
| 257 | 3300025945 | Ga0207679_10097232 | Ga0207679_100972323 | 222 |
| 258 | 3300025960 | Ga0207651_10401229 | Ga0207651_104012292 | 222 |
| 259 | 3300025961 | Ga0207712_10222646 | Ga0207712_102226462 | 222 |
| 260 | 3300025981 | Ga0207640_10245051 | Ga0207640_102450512 | 222 |
| 261 | 3300026023 | Ga0207677_10237524 | Ga0207677_102375242 | 222 |
| 262 | 3300026067 | Ga0207678_10049460 | Ga0207678_100494601 | 222 |
| 263 | 3300026075 | Ga0207708_10009747 | Ga0207708_100097472 | 222 |
| 264 | 3300026088 | Ga0207641_10120532 | Ga0207641_101205322 | 222 |
| 265 | 3300026088 | Ga0207641_10223252 | Ga0207641_102232521 | 222 |
| 266 | 3300026089 | Ga0207648_10330018 | Ga0207648_103300181 | 222 |
| 267 | 3300026095 | Ga0207676_10029108 | Ga0207676_100291085 | 222 |
| 268 | 3300026095 | Ga0207676_10301779 | Ga0207676_103017792 | 222 |
| 269 | 3300026116 | Ga0207674_10032353 | Ga0207674_100323535 | 222 |
| 270 | 3300026116 | Ga0207674_10409248 | Ga0207674_104092481 | 222 |
| 271 | 3300026118 | Ga0207675_100002492 | Ga0207675_10000249214 | 222 |
| 272 | 3300026121 | Ga0207683_10007445 | Ga0207683_100074456 | 222 |
| 273 | 3300026121 | Ga0207683_10225305 | Ga0207683_102253051 | 222 |
| 274 | 3300026142 | Ga0207698_10661933 | Ga0207698_106619332 | 222 |
| 275 | 3300027671 | Ga0209588_1020961 | Ga0209588_10209612 | 222 |
| 276 | 3300027866 | Ga0209813_10018411 | Ga0209813_100184112 | 222 |
| 277 | 3300028379 | Ga0268266_10289901 | Ga0268266_102899011 | 222 |
| 278 | 3300028381 | Ga0268264_10443078 | Ga0268264_104430782 | 222 |
| 279 | 3300031235 | Ga0265330_10167269 | Ga0265330_101672692 | 222 |
| 280 | 3300031238 | Ga0265332_10005817 | Ga0265332_100058173 | 222 |
| 281 | 3300031240 | Ga0265320_10018789 | Ga0265320_100187892 | 222 |
| 282 | 3300031240 | Ga0265320_10102696 | Ga0265320_101026962 | 222 |
| 283 | 3300031241 | Ga0265325_10033915 | Ga0265325_100339153 | 222 |
| 284 | 3300031241 | Ga0265325_10191220 | Ga0265325_101912201 | 222 |
| 285 | 3300031247 | Ga0265340_10002791 | Ga0265340_100027918 | 222 |
| 286 | 3300031247 | Ga0265340_10006370 | Ga0265340_100063704 | 222 |
| 287 | 3300031249 | Ga0265339_10016013 | Ga0265339_100160134 | 222 |
| 288 | 3300031250 | Ga0265331_10007545 | Ga0265331_100075456 | 222 |
| 289 | 3300031344 | Ga0265316_10128809 | Ga0265316_101288093 | 222 |
| 290 | 3300031344 | Ga0265316_10416320 | Ga0265316_104163202 | 222 |
| 291 | 3300031595 | Ga0265313_10013281 | Ga0265313_100132812 | 222 |
| 292 | 3300031712 | Ga0265342_10013335 | Ga0265342_100133354 | 222 |
| 293 | 3300035170 | Ga0373943_0050924 | Ga0373943_0050924_197_934 | 222 |
| 294 | 3300037068 | Ga0373925_0035584 | Ga0373925_0035584_442_1179 | 222 |
| 295 | 3300039437 | Ga0436365_1293704 | Ga0436365_1293704_42_776 | 222 |
| 296 | 3300039437 | Ga0436365_1890509 | Ga0436365_1890509_9765_10502 | 222 |
| 297 | 3300039447 | Ga0436361_0315104 | Ga0436361_0315104_460_1194 | 222 |
| 298 | 3300041408 | Ga0439453_0000191 | Ga0439453_0000191_4818_5552 | 222 |
| 299 | 3300042003 | Ga0439443_000479 | Ga0439443_000479_2116_2850 | 222 |
| 300 | 3300042012 | Ga0439455_0093882 | Ga0439455_0093882_67_804 | 222 |
| 301 | 3300042436 | Ga0439435_0008768 | Ga0439435_0008768_1599_2333 | 222 |
| 302 | 3300042439 | Ga0439464_0093266 | Ga0439464_0093266_20_754 | 222 |
| 303 | 3300042461 | Ga0439460_0002004 | Ga0439460_0002004_745_1479 | 222 |
| 304 | 3300044694 | Ga0466963_0111374 | Ga0466963_0111374_782_1522 | 222 |
| 305 | 3300044735 | Ga0466968_0060977 | Ga0466968_0060977_587_1327 | 222 |
| 306 | 3300044842 | Ga0466957_0189905 | Ga0466957_0189905_387_1127 | 222 |
| 307 | 3300045836 | Ga0466958_0009837 | Ga0466958_0009837_3570_4310 | 222 |
| 308 | 3300045976 | Ga0466967_0371237 | Ga0466967_0371237_336_1073 | 222 |
| 309 | 3300046459 | Ga0495629_0022420 | Ga0495629_0022420_1546_2283 | 222 |
| 310 | 3300046474 | Ga0495605_0036080 | Ga0495605_0036080_753_1490 | 222 |
| 311 | 3300046492 | Ga0495585_0235609 | Ga0495585_0235609_67_804 | 222 |
| 312 | 3300046515 | Ga0495620_0097718 | Ga0495620_0097718_393_1130 | 222 |
| 313 | 3300046517 | Ga0495630_0438894 | Ga0495630_0438894_147_884 | 222 |
| 314 | 3300046537 | Ga0495598_0020028 | Ga0495598_0020028_179_925 | 222 |
| 315 | 3300046642 | Ga0495634_0202186 | Ga0495634_0202186_301_1038 | 222 |
| 316 | 3300046665 | Ga0495661_0141414 | Ga0495661_0141414_21_758 | 222 |
| 317 | 3300046689 | Ga0495613_0266820 | Ga0495613_0266820_426_1163 | 222 |
| 318 | 3300046692 | Ga0495671_0240567 | Ga0495671_0240567_52_789 | 222 |
| 319 | 3300047319 | Ga0495674_0579152 | Ga0495674_0579152_134_871 | 222 |
| 320 | 3300047447 | Ga0495685_024316 | Ga0495685_024316_504_1241 | 222 |
| 321 | 3300047471 | Ga0495684_0391426 | Ga0495684_0391426_61_798 | 222 |
| 322 | 3300047673 | Ga0495593_0061874 | Ga0495593_0061874_1072_1809 | 222 |
| 323 | 3300048089 | Ga0495614_0029240 | Ga0495614_0029240_304_1041 | 222 |
| 324 | 3300048090 | Ga0495615_0043231 | Ga0495615_0043231_351_1097 | 222 |
| 325 | 3300048090 | Ga0495615_0081036 | Ga0495615_0081036_43_780 | 222 |
| 326 | 3300048903 | Ga0496100_0061619 | Ga0496100_0061619_669_1406 | 222 |
| 327 | 3300048903 | Ga0496100_0087580 | Ga0496100_0087580_831_1568 | 222 |
| 328 | 3300048904 | Ga0496101_0068641 | Ga0496101_0068641_1503_2240 | 222 |
| 329 | 3300048904 | Ga0496101_0083386 | Ga0496101_0083386_188_925 | 222 |
| 330 | 3300048904 | Ga0496101_0130865 | Ga0496101_0130865_390_1127 | 222 |
| 331 | 3300048905 | Ga0496102_0096325 | Ga0496102_0096325_1978_2715 | 222 |
| 332 | 3300048905 | Ga0496102_0193095 | Ga0496102_0193095_288_1025 | 222 |
| 333 | 3300048905 | Ga0496102_0782688 | Ga0496102_0782688_65_802 | 222 |
| 334 | 3300048906 | Ga0496103_0002313 | Ga0496103_0002313_2240_2977 | 222 |
| 335 | 3300048906 | Ga0496103_0049380 | Ga0496103_0049380_645_1382 | 222 |
| 336 | 3300048906 | Ga0496103_0252123 | Ga0496103_0252123_124_861 | 222 |
| 337 | 3300048907 | Ga0496104_0002070 | Ga0496104_0002070_5680_6417 | 222 |
| 338 | 3300048907 | Ga0496104_0003048 | Ga0496104_0003048_1615_2352 | 222 |
| 339 | 3300048907 | Ga0496104_0053200 | Ga0496104_0053200_2211_2948 | 222 |
| 340 | 3300048908 | Ga0496105_0005922 | Ga0496105_0005922_1813_2550 | 222 |
| 341 | 3300048908 | Ga0496105_0011418 | Ga0496105_0011418_1956_2693 | 222 |
| 342 | 3300048908 | Ga0496105_0097181 | Ga0496105_0097181_1642_2379 | 222 |
| 343 | 3300048909 | Ga0496106_0016126 | Ga0496106_0016126_1720_2457 | 222 |
| 344 | 3300048909 | Ga0496106_0185077 | Ga0496106_0185077_521_1258 | 222 |
| 345 | 3300048911 | Ga0496108_0000256 | Ga0496108_0000256_4546_5283 | 222 |
| 346 | 3300048911 | Ga0496108_0016537 | Ga0496108_0016537_417_1154 | 222 |
| 347 | 3300048911 | Ga0496108_0265919 | Ga0496108_0265919_359_1096 | 222 |
| 348 | 3300048912 | Ga0496109_0049863 | Ga0496109_0049863_2775_3512 | 222 |
| 349 | 3300048912 | Ga0496109_0134946 | Ga0496109_0134946_413_1150 | 222 |
| 350 | 3300048912 | Ga0496109_0287173 | Ga0496109_0287173_338_1075 | 222 |
| 351 | 3300048913 | Ga0496110_0037814 | Ga0496110_0037814_3285_4022 | 222 |
| 352 | 3300048915 | Ga0496112_0002247 | Ga0496112_0002247_3687_4424 | 222 |
| 353 | 3300048915 | Ga0496112_0216814 | Ga0496112_0216814_1104_1841 | 222 |
| 354 | 3300048915 | Ga0496112_0248985 | Ga0496112_0248985_320_1057 | 222 |
| 355 | 3300048915 | Ga0496112_0328163 | Ga0496112_0328163_64_801 | 222 |
| 356 | 3300048915 | Ga0496112_0331826 | Ga0496112_0331826_645_1382 | 222 |
| 357 | 3300048916 | Ga0496113_0000175 | Ga0496113_0000175_13132_13869 | 222 |
| 358 | 3300048916 | Ga0496113_0110767 | Ga0496113_0110767_573_1310 | 222 |
| 359 | 3300048916 | Ga0496113_0232722 | Ga0496113_0232722_649_1386 | 222 |
| 360 | 3300048917 | Ga0496114_0416859 | Ga0496114_0416859_172_909 | 222 |
| 361 | 3300048918 | Ga0496115_0040875 | Ga0496115_0040875_1913_2650 | 222 |
| 362 | 3300048918 | Ga0496115_0105906 | Ga0496115_0105906_1361_2098 | 222 |
| 363 | 3300048918 | Ga0496115_0160519 | Ga0496115_0160519_785_1522 | 222 |
| 364 | 3300049575 | Ga0501039_0395663 | Ga0501039_0395663_335_1072 | 222 |
| 365 | 3300049577 | Ga0501041_0272241 | Ga0501041_0272241_67_804 | 222 |
| 366 | 3300049592 | Ga0501076_0228770 | Ga0501076_0228770_116_853 | 222 |
| 367 | 3300049593 | Ga0501077_0073203 | Ga0501077_0073203_930_1667 | 222 |
| 368 | 3300049744 | Ga0501083_0038969 | Ga0501083_0038969_1709_2446 | 222 |
| 369 | 3300049822 | Ga0501035_0241900 | Ga0501035_0241900_623_1360 | 222 |
| 370 | 3300050492 | nmdc:mga0yw44_392405_c1 | nmdc:mga0yw44_392405_c1_59_796 | 222 |
| 371 | 3300050495 | nmdc:mga04h51_13525_c1 | nmdc:mga04h51_13525_c1_597_1334 | 222 |
| 372 | 3300050509 | nmdc:mga0qj67_244176_c1 | nmdc:mga0qj67_244176_c1_495_1232 | 222 |
| 373 | 3300050512 | nmdc:mga0n895_12968_c2 | nmdc:mga0n895_12968_c2_812_1549 | 222 |
| 374 | 3300050512 | nmdc:mga0n895_313745_c1 | nmdc:mga0n895_313745_c1_666_1403 | 222 |
| 375 | 3300050512 | nmdc:mga0n895_41615_c1 | nmdc:mga0n895_41615_c1_2026_2763 | 222 |
| 376 | 3300050512 | nmdc:mga0n895_7409_c1 | nmdc:mga0n895_7409_c1_4465_5208 | 222 |
| 377 | 3300050513 | nmdc:mga0rr50_34258_c1 | nmdc:mga0rr50_34258_c1_2730_3467 | 222 |
| 378 | 3300050513 | nmdc:mga0rr50_93276_c1 | nmdc:mga0rr50_93276_c1_378_1121 | 222 |
| 379 | 3300050515 | nmdc:mga0a205_38262_c1 | nmdc:mga0a205_38262_c1_3288_4025 | 222 |
| 380 | 3300050516 | nmdc:mga0sz30_104888_c1 | nmdc:mga0sz30_104888_c1_154_891 | 222 |
| 381 | 3300053077 | Ga0495601_0081475 | Ga0495601_0081475_1250_1987 | 222 |
| 382 | 3300053077 | Ga0495601_0099834 | Ga0495601_0099834_982_1719 | 222 |
| 383 | 3300053079 | Ga0500610_0118827 | Ga0500610_0118827_98_832 | 222 |
| 384 | 3300053084 | Ga0495595_0272347 | Ga0495595_0272347_31_768 | 222 |
| 385 | 3300053085 | Ga0495619_0029350 | Ga0495619_0029350_666_1403 | 222 |
| 386 | 3300060353 | Ga0501082_0000205 | Ga0501082_0000205_20201_20938 | 222 |
| 387 | 2209111006 | 2214544908 | 2213593111 | 228 |
| 388 | 2209111006 | 2214544909 | 2213593141 | 228 |
| 389 | 3300000041 | ARcpr5oldR_c000009 | ARcpr5oldR_00000934 | 228 |
| 390 | 3300000042 | ARSoilYngRDRAFT_c00030 | ARSoilYngRDRAFT_000307 | 228 |
| 391 | 3300000043 | ARcpr5yngRDRAFT_c000008 | ARcpr5yngRDRAFT_0000087 | 228 |
| 392 | 3300000044 | ARSoilOldRDRAFT_c000009 | ARSoilOldRDRAFT_0000098 | 228 |
| 393 | 3300000045 | ARCol0oldRDRAFT_c00052 | ARCol0oldRDRAFT_000526 | 228 |
| 394 | 3300000652 | ARCol0yngRDRAFT_1000008 | ARCol0yngRDRAFT_100000840 | 228 |
| 395 | 3300005276 | Ga0065717_1001959 | Ga0065717_10019592 | 228 |
| 396 | 3300005277 | Ga0065716_1001526 | Ga0065716_10015262 | 228 |
| 397 | 3300005289 | Ga0065704_10090385 | Ga0065704_100903853 | 228 |
| 398 | 3300005290 | Ga0065712_10072874 | Ga0065712_100728743 | 228 |
| 399 | 3300005293 | Ga0065715_10102289 | Ga0065715_101022894 | 228 |
| 400 | 3300005295 | Ga0065707_10098093 | Ga0065707_100980933 | 228 |
| 401 | 3300005337 | Ga0070682_100059356 | Ga0070682_1000593562 | 228 |
| 402 | 3300005339 | Ga0070660_100016759 | Ga0070660_1000167592 | 228 |
| 403 | 3300005365 | Ga0070688_100021126 | Ga0070688_1000211263 | 228 |
| 404 | 3300005366 | Ga0070659_100137232 | Ga0070659_1001372322 | 228 |
| 405 | 3300005444 | Ga0070694_100032721 | Ga0070694_1000327214 | 228 |
| 406 | 3300005458 | Ga0070681_10408111 | Ga0070681_104081112 | 228 |
| 407 | 3300005539 | Ga0068853_100310688 | Ga0068853_1003106882 | 228 |
| 408 | 3300005546 | Ga0070696_100050287 | Ga0070696_1000502872 | 228 |
| 409 | 3300005549 | Ga0070704_100133568 | Ga0070704_1001335682 | 228 |
| 410 | 3300005617 | Ga0068859_100198787 | Ga0068859_1001987872 | 228 |
| 411 | 3300005842 | Ga0068858_100597660 | Ga0068858_1005976602 | 228 |
| 412 | 3300005843 | Ga0068860_100058132 | Ga0068860_1000581322 | 228 |
| 413 | 3300005844 | Ga0068862_100070557 | Ga0068862_1000705573 | 228 |
| 414 | 3300006058 | Ga0075432_10034912 | Ga0075432_100349122 | 228 |
| 415 | 3300006931 | Ga0097620_100198788 | Ga0097620_1001987882 | 228 |
| 416 | 3300009094 | Ga0111539_10000242 | Ga0111539_1000024237 | 228 |
| 417 | 3300009148 | Ga0105243_10097923 | Ga0105243_100979233 | 228 |
| 418 | 3300010375 | Ga0105239_10002642 | Ga0105239_1000264217 | 228 |
| 419 | 3300012480 | Ga0157346_1000825 | Ga0157346_10008252 | 228 |
| 420 | 3300013306 | Ga0163162_10009887 | Ga0163162_100098871 | 228 |
| 421 | 3300025907 | Ga0207645_10161226 | Ga0207645_101612262 | 228 |
| 422 | 3300025912 | Ga0207707_10099523 | Ga0207707_100995233 | 228 |
| 423 | 3300025919 | Ga0207657_10018426 | Ga0207657_100184262 | 228 |
| 424 | 3300025923 | Ga0207681_10457602 | Ga0207681_104576022 | 228 |
| 425 | 3300025932 | Ga0207690_10127170 | Ga0207690_101271702 | 228 |
| 426 | 3300025935 | Ga0207709_10447693 | Ga0207709_104476932 | 228 |
| 427 | 3300026035 | Ga0207703_10782045 | Ga0207703_107820452 | 228 |
| 428 | 3300027907 | Ga0207428_10000666 | Ga0207428_1000066626 | 228 |
| 429 | 3300034818 | Ga0373950_0015036 | Ga0373950_0015036_124_876 | 228 |
| 430 | 3300034819 | Ga0373958_0000031 | Ga0373958_0000031_3612_4364 | 228 |
| 431 | 3300034820 | Ga0373959_0000592 | Ga0373959_0000592_1203_1955 | 228 |
| 432 | 3300034957 | Ga0373938_0000049 | Ga0373938_0000049_14237_14989 | 228 |
| 433 | 3300035084 | Ga0373928_0000190 | Ga0373928_0000190_9213_9965 | 228 |
| 434 | 3300035085 | Ga0373929_0000140 | Ga0373929_0000140_9253_10005 | 228 |
| 435 | 3300035088 | Ga0373940_0000013 | Ga0373940_0000013_18455_19207 | 228 |
| 436 | 3300035090 | Ga0373949_0000214 | Ga0373949_0000214_2786_3538 | 228 |
| 437 | 3300035091 | Ga0373951_0001211 | Ga0373951_0001211_3487_4239 | 228 |
| 438 | 3300035092 | Ga0373952_0000349 | Ga0373952_0000349_1916_2668 | 228 |
| 439 | 3300035112 | Ga0373932_0000018 | Ga0373932_0000018_17868_18620 | 228 |
| 440 | 3300035114 | Ga0373939_0006979 | Ga0373939_0006979_38_790 | 228 |
| 441 | 3300035115 | Ga0373941_0000150 | Ga0373941_0000150_7195_7947 | 228 |
| 442 | 3300035118 | Ga0373954_0026207 | Ga0373954_0026207_1809_2618 | 228 |
| 443 | 3300035121 | Ga0373960_0000903 | Ga0373960_0000903_3072_3824 | 228 |
| 444 | 3300035172 | Ga0373955_0002275 | Ga0373955_0002275_4755_5525 | 228 |
| 445 | 3300035207 | Ga0373942_0000105 | Ga0373942_0000105_17290_18042 | 228 |
| 446 | 3300035241 | Ga0373961_0000824 | Ga0373961_0000824_7245_7997 | 228 |
| 447 | 3300035242 | Ga0373962_0000024 | Ga0373962_0000024_11467_12219 | 228 |
| 448 | 3300035410 | Ga0373924_0012845 | Ga0373924_0012845_956_1726 | 228 |
| 449 | 3300035691 | Ga0373931_0004504 | Ga0373931_0004504_2787_3539 | 228 |
| 450 | 3300035724 | Ga0373933_0003022 | Ga0373933_0003022_6621_7391 | 228 |
| 451 | 3300036401 | Ga0373937_0009273 | Ga0373937_0009273_597_1367 | 228 |
| 452 | 3300036401 | Ga0373937_0503775 | Ga0373937_0503775_234_1010 | 228 |
| 453 | 3300036401 | Ga0373937_0661538 | Ga0373937_0661538_115_879 | 228 |
| 454 | 3300044712 | Ga0453684_0294718 | Ga0453684_0294718_1028_1780 | 228 |
| 455 | 3300045051 | Ga0451576_0056628 | Ga0451576_0056628_757_1509 | 228 |
| 456 | 3300046462 | Ga0495651_0121414 | Ga0495651_0121414_640_1410 | 228 |
| 457 | 3300046511 | Ga0495608_0060995 | Ga0495608_0060995_1219_1989 | 228 |
| 458 | 3300046529 | Ga0495652_0091711 | Ga0495652_0091711_468_1238 | 228 |
| 459 | 3300046559 | Ga0495667_0121991 | Ga0495667_0121991_117_887 | 228 |
| 460 | 3300046675 | Ga0495657_0224189 | Ga0495657_0224189_201_965 | 228 |
| 461 | 3300046679 | Ga0495623_0170830 | Ga0495623_0170830_110_880 | 228 |
| 462 | 3300047322 | Ga0495680_0048502 | Ga0495680_0048502_672_1442 | 228 |
| 463 | 3300047444 | Ga0495675_0052703 | Ga0495675_0052703_1709_2479 | 228 |
| 464 | 3300048088 | Ga0495602_0014347 | Ga0495602_0014347_4527_5297 | 228 |
| 465 | 3300053077 | Ga0495601_0015849 | Ga0495601_0015849_816_1586 | 228 |
| 466 | 3300053078 | Ga0495612_0070547 | Ga0495612_0070547_322_1092 | 228 |
| 467 | 3300053084 | Ga0495595_0006402 | Ga0495595_0006402_1585_2355 | 228 |
| 468 | 3300053085 | Ga0495619_0002191 | Ga0495619_0002191_43_813 | 228 |
| 469 | 3300053085 | Ga0495619_0153193 | Ga0495619_0153193_92_856 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.8789 | 1 | 211 |
| 2r6g-assembly1.cif.gz_A | the crystal structure of the e. coli maltose transporter | 0.8665 | 5 | 197 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.8467 | 5 | 207 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.8459 | 5 | 200 |
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.8438 | 5 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8985 | 5 | 74 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8919 | 3 | 209 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8828 | 5 | 211 | 3.40.50.300 |
| af_Q60350_5_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8636 | 4 | 205 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8569 | 2 | 68 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y6BQL7-F1-model_v4 | Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family | 0.9382 | 5 | 210 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A367PN30-F1-model_v4 | ABC transporter ATP-binding protein | 0.936 | 3 | 210 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A7C2J2Y6-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9349 | 2 | 210 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A4Q7NHZ9-F1-model_v4 | Amino acid/amide ABC transporter ATP-binding protein 2 (HAAT family) | 0.9325 | 1 | 212 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A366H0G6-F1-model_v4 | Amino acid/amide ABC transporter ATP-binding protein 2 (HAAT family) | 0.9324 | 1 | 211 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar