F450252

General Info

Members Datasets Scaffolds Average Seq Length
469 306 469 238

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10457602|Ga0207681_104576022
Length 274
Sequence MPDLLTIERLSAGYGEAVVLNEISLALAEGQSLALLGRNGMGKTTLINSIVGVTRFIGGTIALDGRDITPLRPDQRAHAGIGWVPQERNIFKSLTVEENLTAVARPGRWTLARIYELFPRLDERRRNLGNQLSGGEQQMLAVGRALILNPRVMLLDEPLEGLAPILVEELLRALRRIIRDEGMSAILVEQNAQKVLGVTDRAAILERGAVVYQGASADLSADRAVLESYLGVTAVGPRHHPPQCLALRRVVPVLLLVRVSRMWCSPEHCGAVHR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
9 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
206 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 8.74
Rhizosphere 85.5
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544908 2209111006 Bacteria 36473
2 2214544909 2209111006 Bacteria 30927
3 ARcpr5oldR_c000009 3300000041 Bacteria 39838
4 ARSoilYngRDRAFT_c00030 3300000042 Bacteria 22085
5 ARcpr5yngRDRAFT_c000008 3300000043 Bacteria 39878
6 ARSoilOldRDRAFT_c000009 3300000044 Bacteria 45329
7 ARCol0oldRDRAFT_c00052 3300000045 Bacteria 9238
8 ARCol0yngRDRAFT_1000008 3300000652 Bacteria 45358
9 Ga0065717_1001959 3300005276 Bacteria 5084
10 Ga0065716_1001526 3300005277 Bacteria 9983
11 Ga0065704_10090385 3300005289 Bacteria 2785
12 Ga0065712_10072874 3300005290 Bacteria 4573
13 Ga0065715_10102289 3300005293 Bacteria 3128
14 Ga0065707_10098093 3300005295 Bacteria 3078
15 Ga0070683_100414069 3300005329 Bacteria 1285
16 Ga0070690_100057701 3300005330 Bacteria 2492
17 Ga0070670_100005641 3300005331 Bacteria 10561
18 Ga0070670_100457464 3300005331 Bacteria 1132
19 Ga0070677_10041677 3300005333 Bacteria 1814
20 Ga0068869_100038527 3300005334 Bacteria 3408
21 Ga0068869_100134943 3300005334 Bacteria 1901
22 Ga0070666_10229112 3300005335 Bacteria 1312
23 Ga0070682_100059356 3300005337 Bacteria 2416
24 Ga0068868_100014913 3300005338 Bacteria 5738
25 Ga0070660_100016759 3300005339 Bacteria 5328
26 Ga0070660_100116406 3300005339 Bacteria 2131
27 Ga0070689_100033505 3300005340 Bacteria 3914
28 Ga0070687_100304967 3300005343 Bacteria 1012
29 Ga0070668_100433282 3300005347 Bacteria 1127
30 Ga0070675_100397204 3300005354 Bacteria 1229
31 Ga0070671_100318684 3300005355 Bacteria 1325
32 Ga0070674_100323095 3300005356 Bacteria 1238
33 Ga0070688_100021126 3300005365 Bacteria 3798
34 Ga0070688_100108568 3300005365 Bacteria 1841
35 Ga0070688_100170916 3300005365 Bacteria 1500
36 Ga0070659_100137232 3300005366 Bacteria 1989
37 Ga0070659_100347718 3300005366 Bacteria 1243
38 Ga0070659_100360801 3300005366 Bacteria 1221
39 Ga0070709_10005573 3300005434 Bacteria 6816
40 Ga0070714_100007015 3300005435 Bacteria 8732
41 Ga0070713_100045857 3300005436 Bacteria 3584
42 Ga0070713_100086921 3300005436 Bacteria 2681
43 Ga0070713_100108710 3300005436 Bacteria 2415
44 Ga0070710_10079728 3300005437 Bacteria 1909
45 Ga0070710_10219355 3300005437 Bacteria 1209
46 Ga0070711_100012617 3300005439 Bacteria 5284
47 Ga0070711_100101183 3300005439 Bacteria 2097
48 Ga0070711_100198491 3300005439 Bacteria 1546
49 Ga0070700_100435017 3300005441 Bacteria 994
50 Ga0070694_100032721 3300005444 Bacteria 3416
51 Ga0070708_100026951 3300005445 Bacteria 4925
52 Ga0070663_100329987 3300005455 Bacteria 1229
53 Ga0070662_100142836 3300005457 Bacteria 1857
54 Ga0070662_100171012 3300005457 Bacteria 1706
55 Ga0070681_10408111 3300005458 Bacteria 1270
56 Ga0068867_100603058 3300005459 Bacteria 958
57 Ga0070707_100214539 3300005468 Bacteria 1875
58 Ga0070707_100432487 3300005468 Bacteria 1276
59 Ga0070698_100204564 3300005471 Bacteria 1909
60 Ga0070698_101005845 3300005471 Bacteria 781
61 Ga0070699_100026614 3300005518 Bacteria 4987
62 Ga0070699_100147125 3300005518 Bacteria 2082
63 Ga0070699_100522299 3300005518 Bacteria 1079
64 Ga0068853_100033048 3300005539 Bacteria 4386
65 Ga0068853_100310688 3300005539 Bacteria 1459
66 Ga0068853_100826380 3300005539 Bacteria 888
67 Ga0070672_100018379 3300005543 Bacteria 5054
68 Ga0070672_100163666 3300005543 Bacteria 1847
69 Ga0070696_100050287 3300005546 Bacteria 2897
70 Ga0070696_100073389 3300005546 Bacteria 2411
71 Ga0070665_100083294 3300005548 Bacteria 3203
72 Ga0070704_100133568 3300005549 Bacteria 1927
73 Ga0070664_100053184 3300005564 Bacteria 3432
74 Ga0068857_100372670 3300005577 Bacteria 1324
75 Ga0068852_100059090 3300005616 Bacteria 3324
76 Ga0068859_100198787 3300005617 Bacteria 2089
77 Ga0068859_100237022 3300005617 Bacteria 1913
78 Ga0068864_100087936 3300005618 Bacteria 2736
79 Ga0068866_10121488 3300005718 Bacteria 1472
80 Ga0068861_100094809 3300005719 Bacteria 2362
81 Ga0068863_100529206 3300005841 Bacteria 1163
82 Ga0068858_100597660 3300005842 Bacteria 1070
83 Ga0068860_100040948 3300005843 Bacteria 4426
84 Ga0068860_100058132 3300005843 Bacteria 3676
85 Ga0068860_100316306 3300005843 Bacteria 1532
86 Ga0068862_100070557 3300005844 Bacteria 3016
87 Ga0081455_10014294 3300005937 Bacteria 7789
88 Ga0081455_10048549 3300005937 Bacteria 3666
89 Ga0081455_10085137 3300005937 Bacteria 2578
90 Ga0081455_10305801 3300005937 Bacteria 1139
91 Ga0081455_10371325 3300005937 Bacteria 1002
92 Ga0081538_10000697 3300005981 Bacteria 36894
93 Ga0081538_10014451 3300005981 Bacteria 6181
94 Ga0081540_1001984 3300005983 Bacteria 17080
95 Ga0081540_1012158 3300005983 Bacteria 5693
96 Ga0081539_10002187 3300005985 Bacteria 28690
97 Ga0081539_10089922 3300005985 Bacteria 1589
98 Ga0081539_10132432 3300005985 Bacteria 1223
99 Ga0070717_10005100 3300006028 Bacteria 9578
100 Ga0070717_10214458 3300006028 Bacteria 1690
101 Ga0075365_10007019 3300006038 Bacteria 6267
102 Ga0075365_10287145 3300006038 Bacteria 1158
103 Ga0075368_10016530 3300006042 Bacteria 2750
104 Ga0075363_100058664 3300006048 Bacteria 2068
105 Ga0075364_10005843 3300006051 Bacteria 7184
106 Ga0075432_10034912 3300006058 Bacteria 1747
107 Ga0070715_10000633 3300006163 Bacteria 9317
108 Ga0070716_100262930 3300006173 Bacteria 1182
109 Ga0070712_100002594 3300006175 Bacteria 11168
110 Ga0070712_100188683 3300006175 Bacteria 1611
111 Ga0075362_10002160 3300006177 Bacteria 6508
112 Ga0075367_10102290 3300006178 Bacteria 1752
113 Ga0075367_10207335 3300006178 Bacteria 1225
114 Ga0097621_100608304 3300006237 Bacteria 1000
115 Ga0075428_100001309 3300006844 Bacteria 26388
116 Ga0075428_100042081 3300006844 Bacteria 5025
117 Ga0075430_100012270 3300006846 Bacteria 7292
118 Ga0075431_100000481 3300006847 Bacteria 33062
119 Ga0075431_100004936 3300006847 Bacteria 13133
120 Ga0075431_100787698 3300006847 Bacteria 924
121 Ga0075433_10162597 3300006852 Bacteria 1987
122 Ga0075433_10191217 3300006852 Bacteria 1821
123 Ga0075429_100004654 3300006880 Bacteria 11805
124 Ga0075429_100114444 3300006880 Bacteria 2358
125 Ga0097620_100198788 3300006931 Bacteria 2089
126 Ga0097620_100237019 3300006931 Bacteria 1913
127 Ga0075435_100016071 3300007076 Bacteria 5637
128 Ga0099794_10003747 3300007265 Bacteria 5855
129 Ga0099795_10001476 3300007788 Bacteria 5118
130 Ga0111539_10000242 3300009094 Bacteria 65417
131 Ga0111539_10002444 3300009094 Bacteria 24696
132 Ga0111539_10025408 3300009094 Bacteria 7261
133 Ga0111539_10146701 3300009094 Bacteria 2763
134 Ga0105245_10777946 3300009098 Bacteria 994
135 Ga0105247_10107210 3300009101 Bacteria 1794
136 Ga0105247_10196037 3300009101 Bacteria 1354
137 Ga0114129_10001244 3300009147 Bacteria 33939
138 Ga0114129_10064381 3300009147 Bacteria 5116
139 Ga0114129_10070267 3300009147 Bacteria 4882
140 Ga0114129_10190296 3300009147 Bacteria 2787
141 Ga0105243_10097923 3300009148 Bacteria 2429
142 Ga0105237_10196849 3300009545 Bacteria 2015
143 Ga0105249_10163405 3300009553 Bacteria 2153
144 Ga0099796_10014021 3300010159 Bacteria 2304
145 Ga0105239_10002642 3300010375 Bacteria 22634
146 Ga0105246_10283115 3300011119 Bacteria 1331
147 Ga0157346_1000825 3300012480 Bacteria 1386
148 Ga0157374_10014591 3300013296 Bacteria 6877
149 Ga0157378_10898768 3300013297 Bacteria 916
150 Ga0163162_10009887 3300013306 Bacteria 9276
151 Ga0163162_10699481 3300013306 Bacteria 1135
152 Ga0157375_11082628 3300013308 Bacteria 938
153 Ga0163163_10110902 3300014325 Bacteria 2772
154 Ga0157380_10261024 3300014326 Bacteria 1573
155 Ga0157379_10228187 3300014968 Bacteria 1688
156 Ga0157379_10271438 3300014968 Bacteria 1542
157 Ga0163161_10169336 3300017792 Bacteria 1669
158 Ga0163161_10327468 3300017792 Bacteria 1213
159 Ga0207697_10174050 3300025315 Bacteria 942
160 Ga0207656_10092532 3300025321 Bacteria 1374
161 Ga0207682_10005559 3300025893 Bacteria 5128
162 Ga0207692_10012337 3300025898 Bacteria 3668
163 Ga0207692_10036947 3300025898 Bacteria 2386
164 Ga0207692_10159733 3300025898 Bacteria 1298
165 Ga0207710_10042722 3300025900 Bacteria 2014
166 Ga0207688_10006266 3300025901 Bacteria 6477
167 Ga0207688_10030339 3300025901 Bacteria 2981
168 Ga0207680_10092452 3300025903 Bacteria 1927
169 Ga0207680_10311255 3300025903 Bacteria 1099
170 Ga0207647_10073459 3300025904 Bacteria 2061
171 Ga0207685_10022334 3300025905 Bacteria 2137
172 Ga0207699_10013192 3300025906 Bacteria 4221
173 Ga0207645_10161226 3300025907 Bacteria 1467
174 Ga0207684_10041436 3300025910 Bacteria 3904
175 Ga0207707_10090512 3300025912 Bacteria 2674
176 Ga0207707_10099523 3300025912 Bacteria 2541
177 Ga0207693_10002389 3300025915 Bacteria 16295
178 Ga0207693_10007507 3300025915 Bacteria 8954
179 Ga0207663_10022050 3300025916 Bacteria 3635
180 Ga0207663_10032534 3300025916 Bacteria 3097
181 Ga0207662_10041293 3300025918 Bacteria 2715
182 Ga0207657_10018426 3300025919 Bacteria 6664
183 Ga0207649_10429137 3300025920 Bacteria 994
184 Ga0207681_10457602 3300025923 Bacteria 1039
185 Ga0207650_10010038 3300025925 Bacteria 6483
186 Ga0207650_10273648 3300025925 Bacteria 1373
187 Ga0207700_10013205 3300025928 Bacteria 5364
188 Ga0207700_10149062 3300025928 Bacteria 1931
189 Ga0207700_10355624 3300025928 Bacteria 1276
190 Ga0207700_10464231 3300025928 Bacteria 1117
191 Ga0207690_10127170 3300025932 Bacteria 1860
192 Ga0207706_10008768 3300025933 Bacteria 9309
193 Ga0207706_10160642 3300025933 Bacteria 1975
194 Ga0207706_10283384 3300025933 Bacteria 1445
195 Ga0207686_10101786 3300025934 Bacteria 1919
196 Ga0207709_10357739 3300025935 Bacteria 1104
197 Ga0207709_10447693 3300025935 Bacteria 997
198 Ga0207670_10022757 3300025936 Bacteria 3889
199 Ga0207670_10171464 3300025936 Bacteria 1627
200 Ga0207669_10324601 3300025937 Bacteria 1179
201 Ga0207665_10002185 3300025939 Bacteria 13223
202 Ga0207691_10037320 3300025940 Bacteria 4500
203 Ga0207689_10005950 3300025942 Bacteria 10794
204 Ga0207689_10094860 3300025942 Bacteria 2450
205 Ga0207689_10122029 3300025942 Bacteria 2143
206 Ga0207679_10097232 3300025945 Bacteria 2293
207 Ga0207651_10401229 3300025960 Bacteria 1166
208 Ga0207712_10222646 3300025961 Bacteria 1509
209 Ga0207640_10245051 3300025981 Bacteria 1387
210 Ga0207658_10742486 3300025986 Bacteria 889
211 Ga0207677_10007665 3300026023 Bacteria 5991
212 Ga0207677_10237524 3300026023 Bacteria 1472
213 Ga0207703_10782045 3300026035 Bacteria 910
214 Ga0207678_10049460 3300026067 Bacteria 3633
215 Ga0207708_10009747 3300026075 Bacteria 7127
216 Ga0207641_10120532 3300026088 Bacteria 2340
217 Ga0207641_10223252 3300026088 Bacteria 1748
218 Ga0207648_10011634 3300026089 Bacteria 8282
219 Ga0207648_10330018 3300026089 Bacteria 1372
220 Ga0207676_10029108 3300026095 Bacteria 4132
221 Ga0207676_10301779 3300026095 Bacteria 1462
222 Ga0207674_10032353 3300026116 Bacteria 5487
223 Ga0207674_10409248 3300026116 Bacteria 1311
224 Ga0207675_100002492 3300026118 Bacteria 18230
225 Ga0207683_10007445 3300026121 Bacteria 9387
226 Ga0207683_10225305 3300026121 Bacteria 1709
227 Ga0207698_10661933 3300026142 Bacteria 1035
228 Ga0209588_1020961 3300027671 Bacteria 2049
229 Ga0209813_10018411 3300027866 Bacteria 1930
230 Ga0207428_10000666 3300027907 Bacteria 40250
231 Ga0207428_10001178 3300027907 Bacteria 28140
232 Ga0268266_10289901 3300028379 Bacteria 1524
233 Ga0268264_10443078 3300028381 Bacteria 1257
234 Ga0265330_10167269 3300031235 Bacteria 933
235 Ga0265332_10005817 3300031238 Bacteria 5654
236 Ga0265320_10018789 3300031240 Bacteria 3797
237 Ga0265320_10064013 3300031240 Bacteria 1748
238 Ga0265320_10102696 3300031240 Bacteria 1315
239 Ga0265325_10033915 3300031241 Bacteria 2720
240 Ga0265325_10074202 3300031241 Bacteria 1702
241 Ga0265325_10191220 3300031241 Bacteria 948
242 Ga0265340_10002791 3300031247 Bacteria 9938
243 Ga0265340_10006370 3300031247 Bacteria 6505
244 Ga0265340_10064309 3300031247 Bacteria 1749
245 Ga0265340_10126039 3300031247 Bacteria 1176
246 Ga0265339_10016013 3300031249 Bacteria 4479
247 Ga0265339_10184847 3300031249 Bacteria 1036
248 Ga0265331_10007545 3300031250 Bacteria 6284
249 Ga0265316_10120154 3300031344 Bacteria 1985
250 Ga0265316_10128809 3300031344 Bacteria 1907
251 Ga0265316_10416320 3300031344 Bacteria 966
252 Ga0307513_10031443 3300031456 Bacteria 6011
253 Ga0307513_10173926 3300031456 Bacteria 2027
254 Ga0265313_10013281 3300031595 Bacteria 4954
255 Ga0265342_10013335 3300031712 Bacteria 5522
256 Ga0373950_0015036 3300034818 Bacteria 1308
257 Ga0373958_0000031 3300034819 Bacteria 14995
258 Ga0373959_0000592 3300034820 Bacteria 6353
259 Ga0373938_0000049 3300034957 Bacteria 15338
260 Ga0373928_0000190 3300035084 Bacteria 11780
261 Ga0373929_0000140 3300035085 Bacteria 12362
262 Ga0373940_0000013 3300035088 Bacteria 23710
263 Ga0373944_0007453 3300035089 Bacteria 2935
264 Ga0373944_0087864 3300035089 Bacteria 1035
265 Ga0373949_0000214 3300035090 Bacteria 21912
266 Ga0373951_0001211 3300035091 Bacteria 6814
267 Ga0373952_0000349 3300035092 Bacteria 7787
268 Ga0373932_0000018 3300035112 Bacteria 53356
269 Ga0373936_0032116 3300035113 Bacteria 2076
270 Ga0373939_0006979 3300035114 Bacteria 2733
271 Ga0373941_0000150 3300035115 Bacteria 12466
272 Ga0373954_0026207 3300035118 Bacteria 2671
273 Ga0373960_0000903 3300035121 Bacteria 6311
274 Ga0373943_0033208 3300035170 Bacteria 2456
275 Ga0373943_0050924 3300035170 Bacteria 2037
276 Ga0373946_0015589 3300035171 Bacteria 2884
277 Ga0373946_0038117 3300035171 Bacteria 1957
278 Ga0373955_0002275 3300035172 Bacteria 8339
279 Ga0373942_0000105 3300035207 Bacteria 18885
280 Ga0373961_0000824 3300035241 Bacteria 10539
281 Ga0373962_0000024 3300035242 Bacteria 39974
282 Ga0373924_0012845 3300035410 Bacteria 3136
283 Ga0373931_0004504 3300035691 Bacteria 6370
284 Ga0373927_0043326 3300035695 Bacteria 2913
285 Ga0373933_0003022 3300035724 Bacteria 9384
286 Ga0373947_0431322 3300035725 Bacteria 891
287 Ga0373947_0440215 3300035725 Bacteria 882
288 Ga0373937_0009273 3300036401 Bacteria 8543
289 Ga0373937_0503775 3300036401 Bacteria 1150
290 Ga0373937_0661538 3300036401 Bacteria 990
291 Ga0373925_0028112 3300037068 Bacteria 4119
292 Ga0373925_0035584 3300037068 Bacteria 3675
293 Ga0373925_0051390 3300037068 Bacteria 3077
294 Ga0395898_0129921 3300037466 Bacteria 2413
295 Ga0436364_0295278 3300037853 Bacteria 1090
296 Ga0242420_017365 3300038996 Bacteria 1259
297 Ga0436365_0329197 3300039437 Bacteria 835
298 Ga0436365_1293704 3300039437 Bacteria 800
299 Ga0436365_1890509 3300039437 Bacteria 10801
300 Ga0436361_0144754 3300039447 Bacteria 3399
301 Ga0436361_0315104 3300039447 Bacteria 1921
302 Ga0436361_0875743 3300039447 Bacteria 16933
303 Ga0436363_0516131 3300039450 Bacteria 1681
304 Ga0436362_0956788 3300039453 Bacteria 920
305 Ga0439453_0000191 3300041408 Bacteria 5892
306 Ga0439443_000479 3300042003 Bacteria 3556
307 Ga0439455_0093882 3300042012 Bacteria 825
308 Ga0439435_0008768 3300042436 Bacteria 2355
309 Ga0439464_0093266 3300042439 Bacteria 909
310 Ga0439460_0002004 3300042461 Bacteria 4875
311 Ga0466963_0111374 3300044694 Bacteria 1879
312 Ga0453684_0294718 3300044712 Bacteria 1845
313 Ga0466968_0060977 3300044735 Bacteria 1627
314 Ga0466957_0189905 3300044842 Bacteria 1345
315 Ga0451576_0056628 3300045051 Bacteria 4099
316 Ga0466958_0009837 3300045836 Bacteria 5337
317 Ga0466967_0371237 3300045976 Bacteria 1388
318 Ga0466967_0734433 3300045976 Bacteria 979
319 Ga0495603_0043867 3300046455 Bacteria 2669
320 Ga0495590_0084005 3300046457 Bacteria 1123
321 Ga0495591_030865 3300046458 Bacteria 1614
322 Ga0495629_0022420 3300046459 Bacteria 4503
323 Ga0495641_0053212 3300046461 Bacteria 1842
324 Ga0495651_0121414 3300046462 Bacteria 1919
325 Ga0495582_0008948 3300046473 Bacteria 5525
326 Ga0495605_0036080 3300046474 Bacteria 2495
327 Ga0495639_0006397 3300046475 Bacteria 5066
328 Ga0495584_0101974 3300046491 Bacteria 1451
329 Ga0495585_0235609 3300046492 Bacteria 918
330 Ga0495608_0060995 3300046511 Bacteria 2481
331 Ga0495620_0097718 3300046515 Bacteria 1173
332 Ga0495630_0438894 3300046517 Bacteria 1000
333 Ga0495652_0091711 3300046529 Bacteria 2483
334 Ga0495640_0061115 3300046533 Bacteria 2560
335 Ga0495598_0020028 3300046537 Bacteria 1761
336 Ga0495621_0056299 3300046539 Bacteria 1418
337 Ga0495667_0121991 3300046559 Bacteria 1682
338 Ga0495634_0202186 3300046642 Bacteria 1234
339 Ga0495661_0141414 3300046665 Bacteria 1309
340 Ga0495657_0224189 3300046675 Bacteria 1139
341 Ga0495623_0170830 3300046679 Bacteria 1270
342 Ga0495613_0039689 3300046689 Bacteria 3490
343 Ga0495613_0266820 3300046689 Bacteria 1191
344 Ga0495670_0055863 3300046691 Bacteria 1980
345 Ga0495671_0240567 3300046692 Bacteria 874
346 Ga0495671_0300999 3300046692 Bacteria 771
347 Ga0495649_0179513 3300046694 Bacteria 1105
348 Ga0495674_0579152 3300047319 Bacteria 891
349 Ga0495680_0048502 3300047322 Bacteria 3334
350 Ga0495675_0052703 3300047444 Bacteria 2583
351 Ga0495685_024316 3300047447 Bacteria 2085
352 Ga0495684_0391426 3300047471 Bacteria 978
353 Ga0495593_0061874 3300047673 Bacteria 1957
354 Ga0495602_0014347 3300048088 Bacteria 8047
355 Ga0495614_0029240 3300048089 Bacteria 2372
356 Ga0495615_0043231 3300048090 Bacteria 1133
357 Ga0495615_0050033 3300048090 Bacteria 1073
358 Ga0495615_0081036 3300048090 Bacteria 890
359 Ga0496100_0055136 3300048903 Bacteria 2596
360 Ga0496100_0061619 3300048903 Bacteria 2472
361 Ga0496100_0087580 3300048903 Bacteria 2117
362 Ga0496101_0068641 3300048904 Bacteria 2592
363 Ga0496101_0083386 3300048904 Bacteria 2366
364 Ga0496101_0130865 3300048904 Bacteria 1905
365 Ga0496102_0096325 3300048905 Bacteria 2743
366 Ga0496102_0126437 3300048905 Bacteria 2390
367 Ga0496102_0193095 3300048905 Bacteria 1919
368 Ga0496102_0782688 3300048905 Bacteria 876
369 Ga0496103_0002313 3300048906 Bacteria 12047
370 Ga0496103_0049380 3300048906 Bacteria 2601
371 Ga0496103_0252123 3300048906 Bacteria 1136
372 Ga0496104_0002070 3300048907 Bacteria 17419
373 Ga0496104_0003048 3300048907 Bacteria 14438
374 Ga0496104_0053200 3300048907 Bacteria 3825
375 Ga0496105_0005922 3300048908 Bacteria 9329
376 Ga0496105_0011418 3300048908 Bacteria 7017
377 Ga0496105_0097181 3300048908 Bacteria 2432
378 Ga0496106_0016126 3300048909 Bacteria 5525
379 Ga0496106_0185077 3300048909 Bacteria 1654
380 Ga0496108_0000256 3300048911 Bacteria 46076
381 Ga0496108_0016537 3300048911 Bacteria 6021
382 Ga0496108_0265919 3300048911 Bacteria 1492
383 Ga0496109_0049863 3300048912 Bacteria 3812
384 Ga0496109_0134946 3300048912 Bacteria 2305
385 Ga0496109_0287173 3300048912 Bacteria 1551
386 Ga0496110_0019330 3300048913 Bacteria 5730
387 Ga0496110_0037814 3300048913 Bacteria 4196
388 Ga0496112_0002247 3300048915 Bacteria 15427
389 Ga0496112_0216814 3300048915 Bacteria 1870
390 Ga0496112_0248985 3300048915 Bacteria 1728
391 Ga0496112_0328163 3300048915 Bacteria 1474
392 Ga0496112_0331826 3300048915 Bacteria 1465
393 Ga0496113_0000175 3300048916 Bacteria 28436
394 Ga0496113_0110767 3300048916 Bacteria 2137
395 Ga0496113_0232722 3300048916 Bacteria 1469
396 Ga0496114_0416859 3300048917 Bacteria 1189
397 Ga0496115_0040875 3300048918 Bacteria 3688
398 Ga0496115_0105906 3300048918 Bacteria 2308
399 Ga0496115_0160519 3300048918 Bacteria 1857
400 Ga0501039_0395663 3300049575 Bacteria 1085
401 Ga0501041_0272241 3300049577 Bacteria 1065
402 Ga0501069_0070511 3300049585 Bacteria 1958
403 Ga0501071_0264303 3300049587 Bacteria 1300
404 Ga0501072_0029188 3300049588 Bacteria 4306
405 Ga0501073_0086348 3300049589 Bacteria 2182
406 Ga0501075_0088731 3300049591 Bacteria 2345
407 Ga0501076_0228770 3300049592 Bacteria 1520
408 Ga0501077_0073203 3300049593 Bacteria 2171
409 Ga0501077_0083289 3300049593 Bacteria 2027
410 Ga0501079_0270859 3300049741 Bacteria 1327
411 Ga0501080_0081643 3300049742 Bacteria 3003
412 Ga0501080_0141508 3300049742 Bacteria 2224
413 Ga0501083_0038969 3300049744 Bacteria 3229
414 Ga0501083_0076305 3300049744 Bacteria 2224
415 Ga0501083_0206935 3300049744 Bacteria 1279
416 Ga0501083_0261588 3300049744 Bacteria 1126
417 Ga0501035_0241900 3300049822 Bacteria 1535
418 Ga0501045_0253718 3300049824 Bacteria 1309
419 nmdc:mga03683_50241_c1 3300050489 Bacteria 1738
420 nmdc:mga0yw44_365273_c1 3300050492 Bacteria 973
421 nmdc:mga0yw44_392405_c1 3300050492 Bacteria 938
422 nmdc:mga0yw44_50255_c1 3300050492 Bacteria 2520
423 nmdc:mga0k408_26331_c1 3300050493 Bacteria 3297
424 nmdc:mga04h51_13525_c1 3300050495 Bacteria 2312
425 nmdc:mga05p37_28962_c1 3300050507 Bacteria 6757
426 nmdc:mga05p37_450600_c1 3300050507 Bacteria 1490
427 nmdc:mga05p37_528_c1 3300050507 Bacteria 42336
428 nmdc:mga09592_704_c1 3300050508 Bacteria 25621
429 nmdc:mga09592_74550_c1 3300050508 Bacteria 2883
430 nmdc:mga0qj67_142805_c1 3300050509 Bacteria 1941
431 nmdc:mga0qj67_244176_c1 3300050509 Bacteria 1457
432 nmdc:mga0qj67_26958_c1 3300050509 Bacteria 4450
433 nmdc:mga06r32_241_c1 3300050510 Bacteria 44852
434 nmdc:mga06r32_244045_c1 3300050510 Bacteria 1783
435 nmdc:mga06r32_54107_c1 3300050510 Bacteria 3848
436 nmdc:mga08y16_427_c1 3300050511 Bacteria 38825
437 nmdc:mga08y16_643083_c1 3300050511 Bacteria 1065
438 nmdc:mga0n895_12968_c2 3300050512 Bacteria 5030
439 nmdc:mga0n895_22863_c1 3300050512 Bacteria 5865
440 nmdc:mga0n895_313745_c1 3300050512 Bacteria 1589
441 nmdc:mga0n895_41615_c1 3300050512 Bacteria 4467
442 nmdc:mga0n895_47251_c1 3300050512 Bacteria 4208
443 nmdc:mga0n895_541873_c1 3300050512 Bacteria 1170
444 nmdc:mga0n895_703470_c1 3300050512 Bacteria 1006
445 nmdc:mga0n895_7409_c1 3300050512 Bacteria 9417
446 nmdc:mga0rr50_196108_c1 3300050513 Bacteria 1657
447 nmdc:mga0rr50_34258_c1 3300050513 Bacteria 3635
448 nmdc:mga0rr50_93276_c1 3300050513 Bacteria 2348
449 nmdc:mga08x19_141621_c1 3300050514 Bacteria 1624
450 nmdc:mga0a205_134359_c1 3300050515 Bacteria 2374
451 nmdc:mga0a205_38262_c1 3300050515 Bacteria 4614
452 nmdc:mga0sz30_104888_c1 3300050516 Bacteria 1236
453 Ga0495601_0015849 3300053077 Bacteria 4561
454 Ga0495601_0081475 3300053077 Bacteria 2077
455 Ga0495601_0099834 3300053077 Bacteria 1874
456 Ga0495612_0070547 3300053078 Bacteria 1456
457 Ga0500610_0118827 3300053079 Bacteria 1353
458 Ga0495595_0006402 3300053084 Bacteria 4801
459 Ga0495595_0272347 3300053084 Bacteria 849
460 Ga0495619_0002191 3300053085 Bacteria 12937
461 Ga0495619_0029350 3300053085 Bacteria 3552
462 Ga0495619_0153193 3300053085 Bacteria 1590
463 Ga0500641_0068488 3300053096 Bacteria 1490
464 Ga0500642_0221985 3300053130 Bacteria 875
465 Ga0500611_043340 3300053727 Bacteria 999
466 Ga0501084_0643054 3300054114 Bacteria 895
467 Ga0501082_0000205 3300060353 Bacteria 51540
468 Ga0501082_0720534 3300060353 Bacteria 873
469 Ga0530510_0226076 3300061734 Bacteria 1392

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100014913 Ga0068868_1000149135 201
2 3300025928 Ga0207700_10149062 Ga0207700_101490622 201
3 3300026023 Ga0207677_10007665 Ga0207677_100076654 201
4 3300039437 Ga0436365_0329197 Ga0436365_0329197_28_765 201
5 3300049742 Ga0501080_0081643 Ga0501080_0081643_1871_2599 202
6 3300035725 Ga0373947_0440215 Ga0373947_0440215_185_868 204
7 3300039453 Ga0436362_0956788 Ga0436362_0956788_200_883 205
8 3300039447 Ga0436361_0144754 Ga0436361_0144754_1229_1960 207
9 3300005937 Ga0081455_10371325 Ga0081455_103713251 211
10 3300025912 Ga0207707_10090512 Ga0207707_100905122 211
11 3300005445 Ga0070708_100026951 Ga0070708_1000269514 212
12 3300005518 Ga0070699_100147125 Ga0070699_1001471252 212
13 3300005985 Ga0081539_10089922 Ga0081539_100899222 212
14 3300050512 nmdc:mga0n895_703470_c1 nmdc:mga0n895_703470_c1_185_889 212
15 3300025986 Ga0207658_10742486 Ga0207658_107424861 213
16 3300005981 Ga0081538_10014451 Ga0081538_100144513 214
17 3300039447 Ga0436361_0875743 Ga0436361_0875743_765_1478 215
18 3300005436 Ga0070713_100108710 Ga0070713_1001087103 216
19 3300006844 Ga0075428_100001309 Ga0075428_10000130924 216
20 3300006846 Ga0075430_100012270 Ga0075430_1000122707 216
21 3300006847 Ga0075431_100000481 Ga0075431_10000048113 216
22 3300006880 Ga0075429_100004654 Ga0075429_1000046545 216
23 3300009094 Ga0111539_10002444 Ga0111539_1000244413 216
24 3300009147 Ga0114129_10001244 Ga0114129_1000124422 216
25 3300025928 Ga0207700_10013205 Ga0207700_100132053 216
26 3300027907 Ga0207428_10001178 Ga0207428_1000117830 216
27 3300035113 Ga0373936_0032116 Ga0373936_0032116_1173_1892 216
28 3300046539 Ga0495621_0056299 Ga0495621_0056299_600_1319 216
29 3300046689 Ga0495613_0039689 Ga0495613_0039689_2220_2939 216
30 3300046692 Ga0495671_0300999 Ga0495671_0300999_10_729 216
31 3300049742 Ga0501080_0141508 Ga0501080_0141508_633_1349 216
32 3300050507 nmdc:mga05p37_528_c1 nmdc:mga05p37_528_c1_34062_34808 216
33 3300050508 nmdc:mga09592_704_c1 nmdc:mga09592_704_c1_17558_18304 216
34 3300050509 nmdc:mga0qj67_26958_c1 nmdc:mga0qj67_26958_c1_331_1077 216
35 3300050510 nmdc:mga06r32_241_c1 nmdc:mga06r32_241_c1_36133_36879 216
36 3300050511 nmdc:mga08y16_427_c1 nmdc:mga08y16_427_c1_11019_11765 216
37 3300050512 nmdc:mga0n895_47251_c1 nmdc:mga0n895_47251_c1_739_1458 216
38 3300005334 Ga0068869_100038527 Ga0068869_1000385273 217
39 3300006852 Ga0075433_10162597 Ga0075433_101625972 217
40 3300025942 Ga0207689_10094860 Ga0207689_100948603 217
41 3300046694 Ga0495649_0179513 Ga0495649_0179513_373_1095 217
42 3300049744 Ga0501083_0261588 Ga0501083_0261588_111_833 217
43 3300031247 Ga0265340_10064309 Ga0265340_100643092 218
44 3300045976 Ga0466967_0734433 Ga0466967_0734433_21_755 219
45 3300049585 Ga0501069_0070511 Ga0501069_0070511_309_1040 219
46 3300049589 Ga0501073_0086348 Ga0501073_0086348_908_1636 219
47 3300049744 Ga0501083_0076305 Ga0501083_0076305_1182_1913 219
48 3300005434 Ga0070709_10005573 Ga0070709_100055733 220
49 3300005435 Ga0070714_100007015 Ga0070714_1000070153 220
50 3300005436 Ga0070713_100086921 Ga0070713_1000869212 220
51 3300005437 Ga0070710_10219355 Ga0070710_102193551 220
52 3300005439 Ga0070711_100012617 Ga0070711_1000126175 220
53 3300005468 Ga0070707_100214539 Ga0070707_1002145391 220
54 3300005468 Ga0070707_100432487 Ga0070707_1004324871 220
55 3300005471 Ga0070698_100204564 Ga0070698_1002045642 220
56 3300005471 Ga0070698_101005845 Ga0070698_1010058451 220
57 3300005518 Ga0070699_100026614 Ga0070699_1000266141 220
58 3300005518 Ga0070699_100522299 Ga0070699_1005222991 220
59 3300005546 Ga0070696_100073389 Ga0070696_1000733893 220
60 3300005937 Ga0081455_10014294 Ga0081455_100142945 220
61 3300005937 Ga0081455_10048549 Ga0081455_100485494 220
62 3300005937 Ga0081455_10085137 Ga0081455_100851372 220
63 3300005983 Ga0081540_1001984 Ga0081540_10019842 220
64 3300006028 Ga0070717_10005100 Ga0070717_100051002 220
65 3300006028 Ga0070717_10214458 Ga0070717_102144582 220
66 3300006038 Ga0075365_10287145 Ga0075365_102871451 220
67 3300006048 Ga0075363_100058664 Ga0075363_1000586642 220
68 3300006051 Ga0075364_10005843 Ga0075364_100058437 220
69 3300006163 Ga0070715_10000633 Ga0070715_100006338 220
70 3300006173 Ga0070716_100262930 Ga0070716_1002629302 220
71 3300006175 Ga0070712_100188683 Ga0070712_1001886832 220
72 3300006177 Ga0075362_10002160 Ga0075362_100021607 220
73 3300006844 Ga0075428_100042081 Ga0075428_1000420815 220
74 3300006847 Ga0075431_100004936 Ga0075431_1000049362 220
75 3300006847 Ga0075431_100787698 Ga0075431_1007876982 220
76 3300006852 Ga0075433_10191217 Ga0075433_101912171 220
77 3300009147 Ga0114129_10064381 Ga0114129_100643814 220
78 3300025898 Ga0207692_10012337 Ga0207692_100123372 220
79 3300025905 Ga0207685_10022334 Ga0207685_100223342 220
80 3300025906 Ga0207699_10013192 Ga0207699_100131923 220
81 3300025910 Ga0207684_10041436 Ga0207684_100414363 220
82 3300025915 Ga0207693_10002389 Ga0207693_100023893 220
83 3300025916 Ga0207663_10022050 Ga0207663_100220503 220
84 3300025928 Ga0207700_10464231 Ga0207700_104642312 220
85 3300025939 Ga0207665_10002185 Ga0207665_100021852 220
86 3300031456 Ga0307513_10031443 Ga0307513_100314435 220
87 3300031456 Ga0307513_10173926 Ga0307513_101739263 220
88 3300037068 Ga0373925_0051390 Ga0373925_0051390_2309_3043 220
89 3300037466 Ga0395898_0129921 Ga0395898_0129921_1666_2397 220
90 3300038996 Ga0242420_017365 Ga0242420_017365_262_993 220
91 3300039450 Ga0436363_0516131 Ga0436363_0516131_459_1190 220
92 3300048903 Ga0496100_0055136 Ga0496100_0055136_279_1010 220
93 3300048905 Ga0496102_0126437 Ga0496102_0126437_703_1434 220
94 3300048913 Ga0496110_0019330 Ga0496110_0019330_3738_4469 220
95 3300049587 Ga0501071_0264303 Ga0501071_0264303_283_1029 220
96 3300049591 Ga0501075_0088731 Ga0501075_0088731_685_1431 220
97 3300049593 Ga0501077_0083289 Ga0501077_0083289_550_1296 220
98 3300049741 Ga0501079_0270859 Ga0501079_0270859_164_910 220
99 3300049824 Ga0501045_0253718 Ga0501045_0253718_342_1088 220
100 3300050489 nmdc:mga03683_50241_c1 nmdc:mga03683_50241_c1_841_1572 220
101 3300050492 nmdc:mga0yw44_365273_c1 nmdc:mga0yw44_365273_c1_159_893 220
102 3300050493 nmdc:mga0k408_26331_c1 nmdc:mga0k408_26331_c1_2416_3147 220
103 3300050507 nmdc:mga05p37_450600_c1 nmdc:mga05p37_450600_c1_738_1469 220
104 3300050509 nmdc:mga0qj67_142805_c1 nmdc:mga0qj67_142805_c1_603_1334 220
105 3300050510 nmdc:mga06r32_244045_c1 nmdc:mga06r32_244045_c1_936_1667 220
106 3300050510 nmdc:mga06r32_54107_c1 nmdc:mga06r32_54107_c1_1232_1963 220
107 3300050511 nmdc:mga08y16_643083_c1 nmdc:mga08y16_643083_c1_192_923 220
108 3300050512 nmdc:mga0n895_541873_c1 nmdc:mga0n895_541873_c1_203_934 220
109 3300050513 nmdc:mga0rr50_196108_c1 nmdc:mga0rr50_196108_c1_459_1190 220
110 3300050515 nmdc:mga0a205_134359_c1 nmdc:mga0a205_134359_c1_1615_2346 220
111 3300053096 Ga0500641_0068488 Ga0500641_0068488_483_1217 220
112 3300053130 Ga0500642_0221985 Ga0500642_0221985_93_827 220
113 3300053727 Ga0500611_043340 Ga0500611_043340_203_937 220
114 3300054114 Ga0501084_0643054 Ga0501084_0643054_14_760 220
115 3300060353 Ga0501082_0720534 Ga0501082_0720534_61_807 220
116 3300061734 Ga0530510_0226076 Ga0530510_0226076_178_924 220
117 3300005439 Ga0070711_100101183 Ga0070711_1001011832 221
118 3300005983 Ga0081540_1012158 Ga0081540_10121582 221
119 3300006038 Ga0075365_10007019 Ga0075365_100070196 221
120 3300006880 Ga0075429_100114444 Ga0075429_1001144442 221
121 3300007788 Ga0099795_10001476 Ga0099795_100014765 221
122 3300009147 Ga0114129_10070267 Ga0114129_100702673 221
123 3300010159 Ga0099796_10014021 Ga0099796_100140212 221
124 3300026089 Ga0207648_10011634 Ga0207648_100116342 221
125 3300031240 Ga0265320_10064013 Ga0265320_100640132 221
126 3300031241 Ga0265325_10074202 Ga0265325_100742022 221
127 3300031247 Ga0265340_10126039 Ga0265340_101260392 221
128 3300031249 Ga0265339_10184847 Ga0265339_101848472 221
129 3300031344 Ga0265316_10120154 Ga0265316_101201543 221
130 3300035089 Ga0373944_0007453 Ga0373944_0007453_2035_2769 221
131 3300035089 Ga0373944_0087864 Ga0373944_0087864_156_887 221
132 3300035170 Ga0373943_0033208 Ga0373943_0033208_1454_2188 221
133 3300035171 Ga0373946_0015589 Ga0373946_0015589_1699_2433 221
134 3300035171 Ga0373946_0038117 Ga0373946_0038117_460_1194 221
135 3300035695 Ga0373927_0043326 Ga0373927_0043326_199_933 221
136 3300035725 Ga0373947_0431322 Ga0373947_0431322_148_879 221
137 3300037068 Ga0373925_0028112 Ga0373925_0028112_747_1478 221
138 3300037853 Ga0436364_0295278 Ga0436364_0295278_96_830 221
139 3300046455 Ga0495603_0043867 Ga0495603_0043867_103_837 221
140 3300046457 Ga0495590_0084005 Ga0495590_0084005_358_1092 221
141 3300046458 Ga0495591_030865 Ga0495591_030865_448_1182 221
142 3300046461 Ga0495641_0053212 Ga0495641_0053212_514_1248 221
143 3300046473 Ga0495582_0008948 Ga0495582_0008948_4210_4944 221
144 3300046475 Ga0495639_0006397 Ga0495639_0006397_88_822 221
145 3300046491 Ga0495584_0101974 Ga0495584_0101974_639_1373 221
146 3300046533 Ga0495640_0061115 Ga0495640_0061115_759_1490 221
147 3300046691 Ga0495670_0055863 Ga0495670_0055863_990_1724 221
148 3300048090 Ga0495615_0050033 Ga0495615_0050033_240_974 221
149 3300049588 Ga0501072_0029188 Ga0501072_0029188_2240_2980 221
150 3300049744 Ga0501083_0206935 Ga0501083_0206935_305_1036 221
151 3300050492 nmdc:mga0yw44_50255_c1 nmdc:mga0yw44_50255_c1_1016_1750 221
152 3300050507 nmdc:mga05p37_28962_c1 nmdc:mga05p37_28962_c1_3069_3803 221
153 3300050508 nmdc:mga09592_74550_c1 nmdc:mga09592_74550_c1_1411_2145 221
154 3300050512 nmdc:mga0n895_22863_c1 nmdc:mga0n895_22863_c1_360_1094 221
155 3300050514 nmdc:mga08x19_141621_c1 nmdc:mga08x19_141621_c1_671_1405 221
156 3300005329 Ga0070683_100414069 Ga0070683_1004140692 222
157 3300005330 Ga0070690_100057701 Ga0070690_1000577013 222
158 3300005331 Ga0070670_100005641 Ga0070670_1000056416 222
159 3300005331 Ga0070670_100457464 Ga0070670_1004574642 222
160 3300005333 Ga0070677_10041677 Ga0070677_100416772 222
161 3300005334 Ga0068869_100134943 Ga0068869_1001349432 222
162 3300005335 Ga0070666_10229112 Ga0070666_102291121 222
163 3300005339 Ga0070660_100116406 Ga0070660_1001164062 222
164 3300005340 Ga0070689_100033505 Ga0070689_1000335053 222
165 3300005343 Ga0070687_100304967 Ga0070687_1003049672 222
166 3300005347 Ga0070668_100433282 Ga0070668_1004332821 222
167 3300005354 Ga0070675_100397204 Ga0070675_1003972041 222
168 3300005355 Ga0070671_100318684 Ga0070671_1003186842 222
169 3300005356 Ga0070674_100323095 Ga0070674_1003230951 222
170 3300005365 Ga0070688_100108568 Ga0070688_1001085682 222
171 3300005365 Ga0070688_100170916 Ga0070688_1001709162 222
172 3300005366 Ga0070659_100347718 Ga0070659_1003477181 222
173 3300005366 Ga0070659_100360801 Ga0070659_1003608012 222
174 3300005436 Ga0070713_100045857 Ga0070713_1000458572 222
175 3300005437 Ga0070710_10079728 Ga0070710_100797283 222
176 3300005439 Ga0070711_100198491 Ga0070711_1001984912 222
177 3300005441 Ga0070700_100435017 Ga0070700_1004350171 222
178 3300005455 Ga0070663_100329987 Ga0070663_1003299871 222
179 3300005457 Ga0070662_100142836 Ga0070662_1001428361 222
180 3300005457 Ga0070662_100171012 Ga0070662_1001710121 222
181 3300005459 Ga0068867_100603058 Ga0068867_1006030582 222
182 3300005539 Ga0068853_100033048 Ga0068853_1000330484 222
183 3300005539 Ga0068853_100826380 Ga0068853_1008263801 222
184 3300005543 Ga0070672_100018379 Ga0070672_1000183794 222
185 3300005543 Ga0070672_100163666 Ga0070672_1001636662 222
186 3300005548 Ga0070665_100083294 Ga0070665_1000832942 222
187 3300005564 Ga0070664_100053184 Ga0070664_1000531843 222
188 3300005577 Ga0068857_100372670 Ga0068857_1003726702 222
189 3300005616 Ga0068852_100059090 Ga0068852_1000590903 222
190 3300005617 Ga0068859_100237022 Ga0068859_1002370222 222
191 3300005618 Ga0068864_100087936 Ga0068864_1000879363 222
192 3300005718 Ga0068866_10121488 Ga0068866_101214882 222
193 3300005719 Ga0068861_100094809 Ga0068861_1000948093 222
194 3300005841 Ga0068863_100529206 Ga0068863_1005292061 222
195 3300005843 Ga0068860_100040948 Ga0068860_1000409483 222
196 3300005843 Ga0068860_100316306 Ga0068860_1003163062 222
197 3300005937 Ga0081455_10305801 Ga0081455_103058011 222
198 3300005981 Ga0081538_10000697 Ga0081538_1000069722 222
199 3300005985 Ga0081539_10002187 Ga0081539_100021878 222
200 3300005985 Ga0081539_10132432 Ga0081539_101324322 222
201 3300006042 Ga0075368_10016530 Ga0075368_100165303 222
202 3300006175 Ga0070712_100002594 Ga0070712_1000025943 222
203 3300006178 Ga0075367_10102290 Ga0075367_101022902 222
204 3300006178 Ga0075367_10207335 Ga0075367_102073352 222
205 3300006237 Ga0097621_100608304 Ga0097621_1006083042 222
206 3300006931 Ga0097620_100237019 Ga0097620_1002370192 222
207 3300007076 Ga0075435_100016071 Ga0075435_1000160714 222
208 3300007265 Ga0099794_10003747 Ga0099794_100037472 222
209 3300009094 Ga0111539_10025408 Ga0111539_100254082 222
210 3300009094 Ga0111539_10146701 Ga0111539_101467012 222
211 3300009098 Ga0105245_10777946 Ga0105245_107779461 222
212 3300009101 Ga0105247_10107210 Ga0105247_101072102 222
213 3300009101 Ga0105247_10196037 Ga0105247_101960372 222
214 3300009147 Ga0114129_10190296 Ga0114129_101902962 222
215 3300009545 Ga0105237_10196849 Ga0105237_101968492 222
216 3300009553 Ga0105249_10163405 Ga0105249_101634052 222
217 3300011119 Ga0105246_10283115 Ga0105246_102831151 222
218 3300013296 Ga0157374_10014591 Ga0157374_100145914 222
219 3300013297 Ga0157378_10898768 Ga0157378_108987682 222
220 3300013306 Ga0163162_10699481 Ga0163162_106994812 222
221 3300013308 Ga0157375_11082628 Ga0157375_110826281 222
222 3300014325 Ga0163163_10110902 Ga0163163_101109022 222
223 3300014326 Ga0157380_10261024 Ga0157380_102610242 222
224 3300014968 Ga0157379_10228187 Ga0157379_102281872 222
225 3300014968 Ga0157379_10271438 Ga0157379_102714382 222
226 3300017792 Ga0163161_10169336 Ga0163161_101693362 222
227 3300017792 Ga0163161_10327468 Ga0163161_103274682 222
228 3300025315 Ga0207697_10174050 Ga0207697_101740502 222
229 3300025321 Ga0207656_10092532 Ga0207656_100925322 222
230 3300025893 Ga0207682_10005559 Ga0207682_100055595 222
231 3300025898 Ga0207692_10036947 Ga0207692_100369473 222
232 3300025898 Ga0207692_10159733 Ga0207692_101597332 222
233 3300025900 Ga0207710_10042722 Ga0207710_100427222 222
234 3300025901 Ga0207688_10006266 Ga0207688_100062666 222
235 3300025901 Ga0207688_10030339 Ga0207688_100303391 222
236 3300025903 Ga0207680_10092452 Ga0207680_100924521 222
237 3300025903 Ga0207680_10311255 Ga0207680_103112552 222
238 3300025904 Ga0207647_10073459 Ga0207647_100734592 222
239 3300025915 Ga0207693_10007507 Ga0207693_100075077 222
240 3300025916 Ga0207663_10032534 Ga0207663_100325343 222
241 3300025918 Ga0207662_10041293 Ga0207662_100412931 222
242 3300025920 Ga0207649_10429137 Ga0207649_104291371 222
243 3300025925 Ga0207650_10010038 Ga0207650_100100383 222
244 3300025925 Ga0207650_10273648 Ga0207650_102736482 222
245 3300025928 Ga0207700_10355624 Ga0207700_103556242 222
246 3300025933 Ga0207706_10008768 Ga0207706_100087687 222
247 3300025933 Ga0207706_10160642 Ga0207706_101606423 222
248 3300025933 Ga0207706_10283384 Ga0207706_102833842 222
249 3300025934 Ga0207686_10101786 Ga0207686_101017863 222
250 3300025935 Ga0207709_10357739 Ga0207709_103577391 222
251 3300025936 Ga0207670_10022757 Ga0207670_100227574 222
252 3300025936 Ga0207670_10171464 Ga0207670_101714642 222
253 3300025937 Ga0207669_10324601 Ga0207669_103246011 222
254 3300025940 Ga0207691_10037320 Ga0207691_100373204 222
255 3300025942 Ga0207689_10005950 Ga0207689_100059506 222
256 3300025942 Ga0207689_10122029 Ga0207689_101220292 222
257 3300025945 Ga0207679_10097232 Ga0207679_100972323 222
258 3300025960 Ga0207651_10401229 Ga0207651_104012292 222
259 3300025961 Ga0207712_10222646 Ga0207712_102226462 222
260 3300025981 Ga0207640_10245051 Ga0207640_102450512 222
261 3300026023 Ga0207677_10237524 Ga0207677_102375242 222
262 3300026067 Ga0207678_10049460 Ga0207678_100494601 222
263 3300026075 Ga0207708_10009747 Ga0207708_100097472 222
264 3300026088 Ga0207641_10120532 Ga0207641_101205322 222
265 3300026088 Ga0207641_10223252 Ga0207641_102232521 222
266 3300026089 Ga0207648_10330018 Ga0207648_103300181 222
267 3300026095 Ga0207676_10029108 Ga0207676_100291085 222
268 3300026095 Ga0207676_10301779 Ga0207676_103017792 222
269 3300026116 Ga0207674_10032353 Ga0207674_100323535 222
270 3300026116 Ga0207674_10409248 Ga0207674_104092481 222
271 3300026118 Ga0207675_100002492 Ga0207675_10000249214 222
272 3300026121 Ga0207683_10007445 Ga0207683_100074456 222
273 3300026121 Ga0207683_10225305 Ga0207683_102253051 222
274 3300026142 Ga0207698_10661933 Ga0207698_106619332 222
275 3300027671 Ga0209588_1020961 Ga0209588_10209612 222
276 3300027866 Ga0209813_10018411 Ga0209813_100184112 222
277 3300028379 Ga0268266_10289901 Ga0268266_102899011 222
278 3300028381 Ga0268264_10443078 Ga0268264_104430782 222
279 3300031235 Ga0265330_10167269 Ga0265330_101672692 222
280 3300031238 Ga0265332_10005817 Ga0265332_100058173 222
281 3300031240 Ga0265320_10018789 Ga0265320_100187892 222
282 3300031240 Ga0265320_10102696 Ga0265320_101026962 222
283 3300031241 Ga0265325_10033915 Ga0265325_100339153 222
284 3300031241 Ga0265325_10191220 Ga0265325_101912201 222
285 3300031247 Ga0265340_10002791 Ga0265340_100027918 222
286 3300031247 Ga0265340_10006370 Ga0265340_100063704 222
287 3300031249 Ga0265339_10016013 Ga0265339_100160134 222
288 3300031250 Ga0265331_10007545 Ga0265331_100075456 222
289 3300031344 Ga0265316_10128809 Ga0265316_101288093 222
290 3300031344 Ga0265316_10416320 Ga0265316_104163202 222
291 3300031595 Ga0265313_10013281 Ga0265313_100132812 222
292 3300031712 Ga0265342_10013335 Ga0265342_100133354 222
293 3300035170 Ga0373943_0050924 Ga0373943_0050924_197_934 222
294 3300037068 Ga0373925_0035584 Ga0373925_0035584_442_1179 222
295 3300039437 Ga0436365_1293704 Ga0436365_1293704_42_776 222
296 3300039437 Ga0436365_1890509 Ga0436365_1890509_9765_10502 222
297 3300039447 Ga0436361_0315104 Ga0436361_0315104_460_1194 222
298 3300041408 Ga0439453_0000191 Ga0439453_0000191_4818_5552 222
299 3300042003 Ga0439443_000479 Ga0439443_000479_2116_2850 222
300 3300042012 Ga0439455_0093882 Ga0439455_0093882_67_804 222
301 3300042436 Ga0439435_0008768 Ga0439435_0008768_1599_2333 222
302 3300042439 Ga0439464_0093266 Ga0439464_0093266_20_754 222
303 3300042461 Ga0439460_0002004 Ga0439460_0002004_745_1479 222
304 3300044694 Ga0466963_0111374 Ga0466963_0111374_782_1522 222
305 3300044735 Ga0466968_0060977 Ga0466968_0060977_587_1327 222
306 3300044842 Ga0466957_0189905 Ga0466957_0189905_387_1127 222
307 3300045836 Ga0466958_0009837 Ga0466958_0009837_3570_4310 222
308 3300045976 Ga0466967_0371237 Ga0466967_0371237_336_1073 222
309 3300046459 Ga0495629_0022420 Ga0495629_0022420_1546_2283 222
310 3300046474 Ga0495605_0036080 Ga0495605_0036080_753_1490 222
311 3300046492 Ga0495585_0235609 Ga0495585_0235609_67_804 222
312 3300046515 Ga0495620_0097718 Ga0495620_0097718_393_1130 222
313 3300046517 Ga0495630_0438894 Ga0495630_0438894_147_884 222
314 3300046537 Ga0495598_0020028 Ga0495598_0020028_179_925 222
315 3300046642 Ga0495634_0202186 Ga0495634_0202186_301_1038 222
316 3300046665 Ga0495661_0141414 Ga0495661_0141414_21_758 222
317 3300046689 Ga0495613_0266820 Ga0495613_0266820_426_1163 222
318 3300046692 Ga0495671_0240567 Ga0495671_0240567_52_789 222
319 3300047319 Ga0495674_0579152 Ga0495674_0579152_134_871 222
320 3300047447 Ga0495685_024316 Ga0495685_024316_504_1241 222
321 3300047471 Ga0495684_0391426 Ga0495684_0391426_61_798 222
322 3300047673 Ga0495593_0061874 Ga0495593_0061874_1072_1809 222
323 3300048089 Ga0495614_0029240 Ga0495614_0029240_304_1041 222
324 3300048090 Ga0495615_0043231 Ga0495615_0043231_351_1097 222
325 3300048090 Ga0495615_0081036 Ga0495615_0081036_43_780 222
326 3300048903 Ga0496100_0061619 Ga0496100_0061619_669_1406 222
327 3300048903 Ga0496100_0087580 Ga0496100_0087580_831_1568 222
328 3300048904 Ga0496101_0068641 Ga0496101_0068641_1503_2240 222
329 3300048904 Ga0496101_0083386 Ga0496101_0083386_188_925 222
330 3300048904 Ga0496101_0130865 Ga0496101_0130865_390_1127 222
331 3300048905 Ga0496102_0096325 Ga0496102_0096325_1978_2715 222
332 3300048905 Ga0496102_0193095 Ga0496102_0193095_288_1025 222
333 3300048905 Ga0496102_0782688 Ga0496102_0782688_65_802 222
334 3300048906 Ga0496103_0002313 Ga0496103_0002313_2240_2977 222
335 3300048906 Ga0496103_0049380 Ga0496103_0049380_645_1382 222
336 3300048906 Ga0496103_0252123 Ga0496103_0252123_124_861 222
337 3300048907 Ga0496104_0002070 Ga0496104_0002070_5680_6417 222
338 3300048907 Ga0496104_0003048 Ga0496104_0003048_1615_2352 222
339 3300048907 Ga0496104_0053200 Ga0496104_0053200_2211_2948 222
340 3300048908 Ga0496105_0005922 Ga0496105_0005922_1813_2550 222
341 3300048908 Ga0496105_0011418 Ga0496105_0011418_1956_2693 222
342 3300048908 Ga0496105_0097181 Ga0496105_0097181_1642_2379 222
343 3300048909 Ga0496106_0016126 Ga0496106_0016126_1720_2457 222
344 3300048909 Ga0496106_0185077 Ga0496106_0185077_521_1258 222
345 3300048911 Ga0496108_0000256 Ga0496108_0000256_4546_5283 222
346 3300048911 Ga0496108_0016537 Ga0496108_0016537_417_1154 222
347 3300048911 Ga0496108_0265919 Ga0496108_0265919_359_1096 222
348 3300048912 Ga0496109_0049863 Ga0496109_0049863_2775_3512 222
349 3300048912 Ga0496109_0134946 Ga0496109_0134946_413_1150 222
350 3300048912 Ga0496109_0287173 Ga0496109_0287173_338_1075 222
351 3300048913 Ga0496110_0037814 Ga0496110_0037814_3285_4022 222
352 3300048915 Ga0496112_0002247 Ga0496112_0002247_3687_4424 222
353 3300048915 Ga0496112_0216814 Ga0496112_0216814_1104_1841 222
354 3300048915 Ga0496112_0248985 Ga0496112_0248985_320_1057 222
355 3300048915 Ga0496112_0328163 Ga0496112_0328163_64_801 222
356 3300048915 Ga0496112_0331826 Ga0496112_0331826_645_1382 222
357 3300048916 Ga0496113_0000175 Ga0496113_0000175_13132_13869 222
358 3300048916 Ga0496113_0110767 Ga0496113_0110767_573_1310 222
359 3300048916 Ga0496113_0232722 Ga0496113_0232722_649_1386 222
360 3300048917 Ga0496114_0416859 Ga0496114_0416859_172_909 222
361 3300048918 Ga0496115_0040875 Ga0496115_0040875_1913_2650 222
362 3300048918 Ga0496115_0105906 Ga0496115_0105906_1361_2098 222
363 3300048918 Ga0496115_0160519 Ga0496115_0160519_785_1522 222
364 3300049575 Ga0501039_0395663 Ga0501039_0395663_335_1072 222
365 3300049577 Ga0501041_0272241 Ga0501041_0272241_67_804 222
366 3300049592 Ga0501076_0228770 Ga0501076_0228770_116_853 222
367 3300049593 Ga0501077_0073203 Ga0501077_0073203_930_1667 222
368 3300049744 Ga0501083_0038969 Ga0501083_0038969_1709_2446 222
369 3300049822 Ga0501035_0241900 Ga0501035_0241900_623_1360 222
370 3300050492 nmdc:mga0yw44_392405_c1 nmdc:mga0yw44_392405_c1_59_796 222
371 3300050495 nmdc:mga04h51_13525_c1 nmdc:mga04h51_13525_c1_597_1334 222
372 3300050509 nmdc:mga0qj67_244176_c1 nmdc:mga0qj67_244176_c1_495_1232 222
373 3300050512 nmdc:mga0n895_12968_c2 nmdc:mga0n895_12968_c2_812_1549 222
374 3300050512 nmdc:mga0n895_313745_c1 nmdc:mga0n895_313745_c1_666_1403 222
375 3300050512 nmdc:mga0n895_41615_c1 nmdc:mga0n895_41615_c1_2026_2763 222
376 3300050512 nmdc:mga0n895_7409_c1 nmdc:mga0n895_7409_c1_4465_5208 222
377 3300050513 nmdc:mga0rr50_34258_c1 nmdc:mga0rr50_34258_c1_2730_3467 222
378 3300050513 nmdc:mga0rr50_93276_c1 nmdc:mga0rr50_93276_c1_378_1121 222
379 3300050515 nmdc:mga0a205_38262_c1 nmdc:mga0a205_38262_c1_3288_4025 222
380 3300050516 nmdc:mga0sz30_104888_c1 nmdc:mga0sz30_104888_c1_154_891 222
381 3300053077 Ga0495601_0081475 Ga0495601_0081475_1250_1987 222
382 3300053077 Ga0495601_0099834 Ga0495601_0099834_982_1719 222
383 3300053079 Ga0500610_0118827 Ga0500610_0118827_98_832 222
384 3300053084 Ga0495595_0272347 Ga0495595_0272347_31_768 222
385 3300053085 Ga0495619_0029350 Ga0495619_0029350_666_1403 222
386 3300060353 Ga0501082_0000205 Ga0501082_0000205_20201_20938 222
387 2209111006 2214544908 2213593111 228
388 2209111006 2214544909 2213593141 228
389 3300000041 ARcpr5oldR_c000009 ARcpr5oldR_00000934 228
390 3300000042 ARSoilYngRDRAFT_c00030 ARSoilYngRDRAFT_000307 228
391 3300000043 ARcpr5yngRDRAFT_c000008 ARcpr5yngRDRAFT_0000087 228
392 3300000044 ARSoilOldRDRAFT_c000009 ARSoilOldRDRAFT_0000098 228
393 3300000045 ARCol0oldRDRAFT_c00052 ARCol0oldRDRAFT_000526 228
394 3300000652 ARCol0yngRDRAFT_1000008 ARCol0yngRDRAFT_100000840 228
395 3300005276 Ga0065717_1001959 Ga0065717_10019592 228
396 3300005277 Ga0065716_1001526 Ga0065716_10015262 228
397 3300005289 Ga0065704_10090385 Ga0065704_100903853 228
398 3300005290 Ga0065712_10072874 Ga0065712_100728743 228
399 3300005293 Ga0065715_10102289 Ga0065715_101022894 228
400 3300005295 Ga0065707_10098093 Ga0065707_100980933 228
401 3300005337 Ga0070682_100059356 Ga0070682_1000593562 228
402 3300005339 Ga0070660_100016759 Ga0070660_1000167592 228
403 3300005365 Ga0070688_100021126 Ga0070688_1000211263 228
404 3300005366 Ga0070659_100137232 Ga0070659_1001372322 228
405 3300005444 Ga0070694_100032721 Ga0070694_1000327214 228
406 3300005458 Ga0070681_10408111 Ga0070681_104081112 228
407 3300005539 Ga0068853_100310688 Ga0068853_1003106882 228
408 3300005546 Ga0070696_100050287 Ga0070696_1000502872 228
409 3300005549 Ga0070704_100133568 Ga0070704_1001335682 228
410 3300005617 Ga0068859_100198787 Ga0068859_1001987872 228
411 3300005842 Ga0068858_100597660 Ga0068858_1005976602 228
412 3300005843 Ga0068860_100058132 Ga0068860_1000581322 228
413 3300005844 Ga0068862_100070557 Ga0068862_1000705573 228
414 3300006058 Ga0075432_10034912 Ga0075432_100349122 228
415 3300006931 Ga0097620_100198788 Ga0097620_1001987882 228
416 3300009094 Ga0111539_10000242 Ga0111539_1000024237 228
417 3300009148 Ga0105243_10097923 Ga0105243_100979233 228
418 3300010375 Ga0105239_10002642 Ga0105239_1000264217 228
419 3300012480 Ga0157346_1000825 Ga0157346_10008252 228
420 3300013306 Ga0163162_10009887 Ga0163162_100098871 228
421 3300025907 Ga0207645_10161226 Ga0207645_101612262 228
422 3300025912 Ga0207707_10099523 Ga0207707_100995233 228
423 3300025919 Ga0207657_10018426 Ga0207657_100184262 228
424 3300025923 Ga0207681_10457602 Ga0207681_104576022 228
425 3300025932 Ga0207690_10127170 Ga0207690_101271702 228
426 3300025935 Ga0207709_10447693 Ga0207709_104476932 228
427 3300026035 Ga0207703_10782045 Ga0207703_107820452 228
428 3300027907 Ga0207428_10000666 Ga0207428_1000066626 228
429 3300034818 Ga0373950_0015036 Ga0373950_0015036_124_876 228
430 3300034819 Ga0373958_0000031 Ga0373958_0000031_3612_4364 228
431 3300034820 Ga0373959_0000592 Ga0373959_0000592_1203_1955 228
432 3300034957 Ga0373938_0000049 Ga0373938_0000049_14237_14989 228
433 3300035084 Ga0373928_0000190 Ga0373928_0000190_9213_9965 228
434 3300035085 Ga0373929_0000140 Ga0373929_0000140_9253_10005 228
435 3300035088 Ga0373940_0000013 Ga0373940_0000013_18455_19207 228
436 3300035090 Ga0373949_0000214 Ga0373949_0000214_2786_3538 228
437 3300035091 Ga0373951_0001211 Ga0373951_0001211_3487_4239 228
438 3300035092 Ga0373952_0000349 Ga0373952_0000349_1916_2668 228
439 3300035112 Ga0373932_0000018 Ga0373932_0000018_17868_18620 228
440 3300035114 Ga0373939_0006979 Ga0373939_0006979_38_790 228
441 3300035115 Ga0373941_0000150 Ga0373941_0000150_7195_7947 228
442 3300035118 Ga0373954_0026207 Ga0373954_0026207_1809_2618 228
443 3300035121 Ga0373960_0000903 Ga0373960_0000903_3072_3824 228
444 3300035172 Ga0373955_0002275 Ga0373955_0002275_4755_5525 228
445 3300035207 Ga0373942_0000105 Ga0373942_0000105_17290_18042 228
446 3300035241 Ga0373961_0000824 Ga0373961_0000824_7245_7997 228
447 3300035242 Ga0373962_0000024 Ga0373962_0000024_11467_12219 228
448 3300035410 Ga0373924_0012845 Ga0373924_0012845_956_1726 228
449 3300035691 Ga0373931_0004504 Ga0373931_0004504_2787_3539 228
450 3300035724 Ga0373933_0003022 Ga0373933_0003022_6621_7391 228
451 3300036401 Ga0373937_0009273 Ga0373937_0009273_597_1367 228
452 3300036401 Ga0373937_0503775 Ga0373937_0503775_234_1010 228
453 3300036401 Ga0373937_0661538 Ga0373937_0661538_115_879 228
454 3300044712 Ga0453684_0294718 Ga0453684_0294718_1028_1780 228
455 3300045051 Ga0451576_0056628 Ga0451576_0056628_757_1509 228
456 3300046462 Ga0495651_0121414 Ga0495651_0121414_640_1410 228
457 3300046511 Ga0495608_0060995 Ga0495608_0060995_1219_1989 228
458 3300046529 Ga0495652_0091711 Ga0495652_0091711_468_1238 228
459 3300046559 Ga0495667_0121991 Ga0495667_0121991_117_887 228
460 3300046675 Ga0495657_0224189 Ga0495657_0224189_201_965 228
461 3300046679 Ga0495623_0170830 Ga0495623_0170830_110_880 228
462 3300047322 Ga0495680_0048502 Ga0495680_0048502_672_1442 228
463 3300047444 Ga0495675_0052703 Ga0495675_0052703_1709_2479 228
464 3300048088 Ga0495602_0014347 Ga0495602_0014347_4527_5297 228
465 3300053077 Ga0495601_0015849 Ga0495601_0015849_816_1586 228
466 3300053078 Ga0495612_0070547 Ga0495612_0070547_322_1092 228
467 3300053084 Ga0495595_0006402 Ga0495595_0006402_1585_2355 228
468 3300053085 Ga0495619_0002191 Ga0495619_0002191_43_813 228
469 3300053085 Ga0495619_0153193 Ga0495619_0153193_92_856 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

160

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8789 1 211
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.8665 5 197
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8467 5 207
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8459 5 200
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.8438 5 197
ID Description Score Start End Superfamily
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8985 5 74 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8919 3 209 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8828 5 211 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8636 4 205 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8569 2 68 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Y6BQL7-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family 0.9382 5 210 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A367PN30-F1-model_v4 ABC transporter ATP-binding protein 0.936 3 210 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7C2J2Y6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9349 2 210 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A4Q7NHZ9-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2 (HAAT family) 0.9325 1 212 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A366H0G6-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2 (HAAT family) 0.9324 1 211 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
85.2 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map