F449385

General Info

Members Datasets Scaffolds Average Seq Length
464 248 453 138

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_1259183|Ga0501070_1259183_29_529
Length 166
Sequence MAETDRARFTARRRIIAIGFNAEKSMLWVKAFHIVFMVTWFAGLFYLPRLFVYHAMTEDAAGNARFKLMERKLYFGIMTPGAVLTVALGIWMLIDYGWAAYSRSGWLHAKLALVAVLIAYHVYCGRLLADFKHDRNRHSHVFYRWFNEIPVLILIAVVILVVVRPF

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
5 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
6 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
7 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
8 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
9 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
248 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.29
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1006625 3300001976 Bacteria 1515
2 Ga0065712_10292833 3300005290 Bacteria 874
3 Ga0065712_10297134 3300005290 Bacteria 866
4 Ga0065715_10071848 3300005293 Bacteria 605
5 Ga0065715_10270299 3300005293 Bacteria 1113
6 Ga0070676_10350360 3300005328 Bacteria 1015
7 Ga0070676_11388088 3300005328 Bacteria 538
8 Ga0070670_100032729 3300005331 Bacteria 4479
9 Ga0070670_100036494 3300005331 Bacteria 4230
10 Ga0070670_100096557 3300005331 Bacteria 2542
11 Ga0070670_100434060 3300005331 Bacteria 1162
12 Ga0070670_101020872 3300005331 Bacteria 753
13 Ga0070677_10216748 3300005333 Bacteria 932
14 Ga0068869_100015913 3300005334 Bacteria 5060
15 Ga0068869_100295911 3300005334 Bacteria 1305
16 Ga0068869_100307514 3300005334 Bacteria 1282
17 Ga0068869_101225674 3300005334 Bacteria 660
18 Ga0070666_10262981 3300005335 Bacteria 1223
19 Ga0070666_10492769 3300005335 Bacteria 888
20 Ga0070680_100482920 3300005336 Bacteria 1059
21 Ga0070682_100238601 3300005337 Bacteria 1304
22 Ga0070682_100958885 3300005337 Bacteria 707
23 Ga0068868_100074177 3300005338 Bacteria 2717
24 Ga0068868_100297567 3300005338 Bacteria 1370
25 Ga0068868_100343160 3300005338 Bacteria 1277
26 Ga0068868_101075038 3300005338 Bacteria 739
27 Ga0070660_100081765 3300005339 Bacteria 2536
28 Ga0070660_101489906 3300005339 Bacteria 575
29 Ga0070689_100104883 3300005340 Bacteria 2241
30 Ga0070689_101699261 3300005340 Bacteria 574
31 Ga0070687_100018048 3300005343 Bacteria 3255
32 Ga0070687_100095668 3300005343 Bacteria 1652
33 Ga0070661_100016963 3300005344 Bacteria 5158
34 Ga0070661_101438661 3300005344 Bacteria 580
35 Ga0070692_10024376 3300005345 Bacteria 2973
36 Ga0070692_10067535 3300005345 Bacteria 1898
37 Ga0070692_10574123 3300005345 Bacteria 742
38 Ga0070668_100278016 3300005347 Bacteria 1397
39 Ga0070669_100348558 3300005353 Bacteria 1201
40 Ga0070669_100416811 3300005353 Bacteria 1101
41 Ga0070675_100310392 3300005354 Bacteria 1391
42 Ga0070675_100380151 3300005354 Bacteria 1257
43 Ga0070675_100419419 3300005354 Bacteria 1196
44 Ga0070675_100740246 3300005354 Bacteria 897
45 Ga0070671_100081931 3300005355 Bacteria 2698
46 Ga0070671_100177949 3300005355 Bacteria 1800
47 Ga0070674_100043382 3300005356 Bacteria 3060
48 Ga0070674_102081216 3300005356 Bacteria 517
49 Ga0070673_100176965 3300005364 Bacteria 1824
50 Ga0070688_100066977 3300005365 Bacteria 2287
51 Ga0070659_100664238 3300005366 Bacteria 899
52 Ga0070659_101315978 3300005366 Bacteria 641
53 Ga0070667_100049464 3300005367 Bacteria 3541
54 Ga0070667_100265676 3300005367 Bacteria 1537
55 Ga0070709_10239887 3300005434 Bacteria 1301
56 Ga0070711_100597555 3300005439 Bacteria 920
57 Ga0070705_101134818 3300005440 Bacteria 641
58 Ga0070700_100007079 3300005441 Bacteria 6030
59 Ga0070700_100126268 3300005441 Bacteria 1720
60 Ga0070694_100352946 3300005444 Bacteria 1140
61 Ga0070708_100559188 3300005445 Bacteria 1079
62 Ga0070663_101489619 3300005455 Bacteria 601
63 Ga0070678_100052731 3300005456 Bacteria 2955
64 Ga0070678_100071481 3300005456 Bacteria 2598
65 Ga0070678_100617006 3300005456 Bacteria 970
66 Ga0070662_100061865 3300005457 Bacteria 2734
67 Ga0070662_101021288 3300005457 Bacteria 708
68 Ga0070681_10140106 3300005458 Bacteria 2349
69 Ga0070681_10977462 3300005458 Bacteria 766
70 Ga0068867_100012234 3300005459 Bacteria 6065
71 Ga0068867_100039276 3300005459 Bacteria 3450
72 Ga0068867_100390163 3300005459 Bacteria 1172
73 Ga0068867_100556305 3300005459 Bacteria 994
74 Ga0070685_10501830 3300005466 Bacteria 859
75 Ga0070706_100007046 3300005467 Bacteria 10598
76 Ga0070706_100734685 3300005467 Bacteria 915
77 Ga0070707_100004600 3300005468 Bacteria 12909
78 Ga0070707_102212369 3300005468 Bacteria 517
79 Ga0070698_100998611 3300005471 Bacteria 784
80 Ga0070699_100162813 3300005518 Bacteria 1975
81 Ga0070699_100348865 3300005518 Bacteria 1333
82 Ga0070679_100189514 3300005530 Bacteria 2026
83 Ga0070684_100144252 3300005535 Bacteria 2155
84 Ga0070697_100050573 3300005536 Bacteria 3374
85 Ga0068853_100255861 3300005539 Bacteria 1608
86 Ga0068853_100391643 3300005539 Bacteria 1299
87 Ga0068853_101639810 3300005539 Bacteria 623
88 Ga0070686_100045163 3300005544 Bacteria 2774
89 Ga0070686_101254979 3300005544 Bacteria 617
90 Ga0070695_100122851 3300005545 Bacteria 1779
91 Ga0070695_101161423 3300005545 Bacteria 634
92 Ga0070695_101259242 3300005545 Bacteria 610
93 Ga0070695_101383274 3300005545 Bacteria 583
94 Ga0070695_101463141 3300005545 Bacteria 568
95 Ga0070696_100995647 3300005546 Bacteria 700
96 Ga0070696_101898940 3300005546 Bacteria 516
97 Ga0070693_100368840 3300005547 Bacteria 987
98 Ga0070693_100545327 3300005547 Unclassified 829
99 Ga0070665_100202999 3300005548 Bacteria 1983
100 Ga0070665_101038530 3300005548 Bacteria 831
101 Ga0070704_100705873 3300005549 Bacteria 895
102 Ga0070704_101401655 3300005549 Bacteria 641
103 Ga0068855_100730521 3300005563 Bacteria 1057
104 Ga0068855_100757272 3300005563 Bacteria 1035
105 Ga0070664_100071856 3300005564 Bacteria 2966
106 Ga0070664_101922691 3300005564 Bacteria 561
107 Ga0068857_100489707 3300005577 Bacteria 1153
108 Ga0068854_100759989 3300005578 Bacteria 842
109 Ga0068856_100256471 3300005614 Bacteria 1764
110 Ga0068856_101395812 3300005614 Bacteria 715
111 Ga0070702_100714736 3300005615 Bacteria 765
112 Ga0068852_100071009 3300005616 Bacteria 3056
113 Ga0068852_102279880 3300005616 Bacteria 563
114 Ga0068859_100006929 3300005617 Bacteria 11508
115 Ga0068859_100209166 3300005617 Bacteria 2037
116 Ga0068859_100557220 3300005617 Bacteria 1240
117 Ga0068864_100082484 3300005618 Bacteria 2821
118 Ga0068864_100424143 3300005618 Bacteria 1268
119 Ga0068864_101063722 3300005618 Bacteria 804
120 Ga0068866_10078151 3300005718 Bacteria 1769
121 Ga0068861_100452555 3300005719 Bacteria 1151
122 Ga0068861_100578340 3300005719 Bacteria 1028
123 Ga0068861_100603110 3300005719 Bacteria 1008
124 Ga0068861_100701646 3300005719 Bacteria 940
125 Ga0068851_10003969 3300005834 Bacteria 6626
126 Ga0068870_10202077 3300005840 Bacteria 1205
127 Ga0068870_10357815 3300005840 Bacteria 938
128 Ga0068863_100020923 3300005841 Bacteria 6248
129 Ga0068863_100138534 3300005841 Bacteria 2325
130 Ga0068863_100239702 3300005841 Bacteria 1750
131 Ga0068858_100010808 3300005842 Bacteria 8630
132 Ga0068858_100028034 3300005842 Bacteria 5233
133 Ga0068860_100778291 3300005843 Bacteria 970
134 Ga0068862_100073033 3300005844 Bacteria 2965
135 Ga0075364_10152960 3300006051 Bacteria 1555
136 Ga0070715_10796609 3300006163 Bacteria 573
137 Ga0097621_100026373 3300006237 Bacteria 4557
138 Ga0097621_100111538 3300006237 Bacteria 2311
139 Ga0097621_101724006 3300006237 Bacteria 597
140 Ga0068871_100066781 3300006358 Bacteria 2949
141 Ga0068871_100110908 3300006358 Bacteria 2307
142 Ga0068871_100524648 3300006358 Bacteria 1070
143 Ga0068871_100597355 3300006358 Bacteria 1003
144 Ga0075434_100134240 3300006871 Bacteria 2494
145 Ga0075434_100264640 3300006871 Bacteria 1739
146 Ga0075434_100358136 3300006871 Bacteria 1480
147 Ga0068865_100547174 3300006881 Bacteria 972
148 Ga0097620_100006929 3300006931 Bacteria 11508
149 Ga0097620_100209170 3300006931 Bacteria 2037
150 Ga0097620_100557203 3300006931 Bacteria 1240
151 Ga0075435_100206571 3300007076 Bacteria 1665
152 Ga0075435_100235481 3300007076 Bacteria 1556
153 Ga0099794_10037360 3300007265 Bacteria 2299
154 Ga0105251_10007498 3300009011 Bacteria 6709
155 Ga0105244_10022854 3300009036 Bacteria 3438
156 Ga0105244_10177309 3300009036 Bacteria 1012
157 Ga0111539_10008285 3300009094 Bacteria 13231
158 Ga0111539_10055424 3300009094 Bacteria 4712
159 Ga0105245_10270236 3300009098 Bacteria 1658
160 Ga0105247_10005196 3300009101 Bacteria 8231
161 Ga0105247_10467969 3300009101 Bacteria 912
162 Ga0105243_10040470 3300009148 Bacteria 3640
163 Ga0105243_10091971 3300009148 Bacteria 2500
164 Ga0105243_10134251 3300009148 Bacteria 2104
165 Ga0105243_10613554 3300009148 Bacteria 1049
166 Ga0105242_10031301 3300009176 Bacteria 4248
167 Ga0105242_10064032 3300009176 Bacteria 3029
168 Ga0105242_10161818 3300009176 Bacteria 1960
169 Ga0105242_10501943 3300009176 Bacteria 1154
170 Ga0105242_10672657 3300009176 Bacteria 1009
171 Ga0105242_10846254 3300009176 Bacteria 910
172 Ga0105248_10000992 3300009177 Bacteria 31434
173 Ga0105248_10690324 3300009177 Bacteria 1152
174 Ga0105248_10870923 3300009177 Bacteria 1017
175 Ga0105248_12424471 3300009177 Bacteria 598
176 Ga0105237_11427213 3300009545 Bacteria 699
177 Ga0105238_10433359 3300009551 Bacteria 1310
178 Ga0105249_11608691 3300009553 Bacteria 722
179 Ga0105249_12834120 3300009553 Bacteria 556
180 Ga0105239_10263603 3300010375 Bacteria 1937
181 Ga0105239_10297125 3300010375 Bacteria 1819
182 Ga0105246_10064289 3300011119 Bacteria 2563
183 Ga0105246_11758993 3300011119 Bacteria 591
184 Ga0157373_10270697 3300013100 Bacteria 1202
185 Ga0157373_10284402 3300013100 Bacteria 1172
186 Ga0157371_10119444 3300013102 Bacteria 1874
187 Ga0157371_11184129 3300013102 Bacteria 588
188 Ga0157369_10037445 3300013105 Bacteria 5311
189 Ga0157369_11580752 3300013105 Bacteria 667
190 Ga0157374_10003255 3300013296 Bacteria 13642
191 Ga0157374_10010560 3300013296 Bacteria 7949
192 Ga0157374_10183715 3300013296 Bacteria 2044
193 Ga0157374_10194482 3300013296 Bacteria 1985
194 Ga0157374_10238988 3300013296 Bacteria 1786
195 Ga0157374_10355950 3300013296 Bacteria 1455
196 Ga0157374_12272586 3300013296 Bacteria 569
197 Ga0157378_10040438 3300013297 Bacteria 4134
198 Ga0157378_10064164 3300013297 Bacteria 3284
199 Ga0157378_10064846 3300013297 Bacteria 3268
200 Ga0157378_10071086 3300013297 Bacteria 3125
201 Ga0157378_10969611 3300013297 Bacteria 883
202 Ga0157378_11517602 3300013297 Bacteria 715
203 Ga0163162_11477749 3300013306 Bacteria 774
204 Ga0157372_10075662 3300013307 Bacteria 3799
205 Ga0157372_10162967 3300013307 Bacteria 2577
206 Ga0157372_11363375 3300013307 Bacteria 818
207 Ga0157372_12018940 3300013307 Bacteria 663
208 Ga0157375_10045551 3300013308 Bacteria 4270
209 Ga0157375_10243132 3300013308 Bacteria 1959
210 Ga0157375_10509105 3300013308 Bacteria 1368
211 Ga0157375_10806204 3300013308 Bacteria 1087
212 Ga0163163_10411642 3300014325 Bacteria 1411
213 Ga0163163_11232476 3300014325 Bacteria 811
214 Ga0163163_11274167 3300014325 Bacteria 797
215 Ga0157380_10106188 3300014326 Bacteria 2349
216 Ga0157380_10688351 3300014326 Bacteria 1026
217 Ga0157380_11458796 3300014326 Bacteria 736
218 Ga0182008_10136752 3300014497 Bacteria 1224
219 Ga0157377_10447156 3300014745 Bacteria 891
220 Ga0157379_10023823 3300014968 Bacteria 5434
221 Ga0157379_10067099 3300014968 Bacteria 3208
222 Ga0157376_10012058 3300014969 Bacteria 6398
223 Ga0157376_10345231 3300014969 Bacteria 1423
224 Ga0157376_10417062 3300014969 Bacteria 1302
225 Ga0163161_10323200 3300017792 Bacteria 1220
226 Ga0207697_10013643 3300025315 Bacteria 3386
227 Ga0207656_10011875 3300025321 Bacteria 3300
228 Ga0207655_1049492 3300025728 Bacteria 1715
229 Ga0207655_1098466 3300025728 Bacteria 1012
230 Ga0207682_10002051 3300025893 Bacteria 9121
231 Ga0207642_10073993 3300025899 Bacteria 1631
232 Ga0207642_10197820 3300025899 Bacteria 1108
233 Ga0207688_10004075 3300025901 Bacteria 7962
234 Ga0207680_10512653 3300025903 Bacteria 855
235 Ga0207685_10667109 3300025905 Bacteria 563
236 Ga0207645_10014310 3300025907 Bacteria 5313
237 Ga0207643_10016987 3300025908 Bacteria 3972
238 Ga0207643_10177099 3300025908 Bacteria 1289
239 Ga0207643_10390649 3300025908 Bacteria 878
240 Ga0207684_10102452 3300025910 Bacteria 2448
241 Ga0207684_10261314 3300025910 Bacteria 1494
242 Ga0207707_10006346 3300025912 Bacteria 10327
243 Ga0207662_10021580 3300025918 Bacteria 3684
244 Ga0207662_10085654 3300025918 Bacteria 1930
245 Ga0207649_10042285 3300025920 Bacteria 2779
246 Ga0207652_10039685 3300025921 Bacteria 3996
247 Ga0207646_10023410 3300025922 Bacteria 5673
248 Ga0207646_11059513 3300025922 Bacteria 715
249 Ga0207681_10472961 3300025923 Bacteria 1022
250 Ga0207681_10573030 3300025923 Bacteria 931
251 Ga0207694_10414550 3300025924 Bacteria 1121
252 Ga0207650_10012522 3300025925 Bacteria 5854
253 Ga0207650_10057952 3300025925 Bacteria 2882
254 Ga0207650_10076577 3300025925 Bacteria 2527
255 Ga0207650_10303728 3300025925 Bacteria 1304
256 Ga0207650_10621708 3300025925 Bacteria 909
257 Ga0207650_10810118 3300025925 Bacteria 794
258 Ga0207659_10268478 3300025926 Bacteria 1391
259 Ga0207659_10344723 3300025926 Bacteria 1235
260 Ga0207687_10204891 3300025927 Bacteria 1544
261 Ga0207687_11187092 3300025927 Bacteria 656
262 Ga0207644_10070624 3300025931 Bacteria 2553
263 Ga0207644_10098414 3300025931 Bacteria 2192
264 Ga0207690_10054275 3300025932 Bacteria 2694
265 Ga0207706_11567420 3300025933 Bacteria 535
266 Ga0207686_10146625 3300025934 Bacteria 1638
267 Ga0207686_10395710 3300025934 Bacteria 1051
268 Ga0207709_10394440 3300025935 Bacteria 1056
269 Ga0207709_10798243 3300025935 Bacteria 762
270 Ga0207670_10220551 3300025936 Bacteria 1451
271 Ga0207670_10722387 3300025936 Bacteria 826
272 Ga0207669_10065934 3300025937 Bacteria 2249
273 Ga0207669_10363217 3300025937 Bacteria 1123
274 Ga0207669_10631996 3300025937 Bacteria 873
275 Ga0207669_11042230 3300025937 Bacteria 689
276 Ga0207669_11939378 3300025937 Bacteria 503
277 Ga0207704_10548438 3300025938 Bacteria 939
278 Ga0207665_10398237 3300025939 Bacteria 1048
279 Ga0207691_10125656 3300025940 Bacteria 2270
280 Ga0207711_10246184 3300025941 Bacteria 1640
281 Ga0207689_10022518 3300025942 Bacteria 5297
282 Ga0207689_10049766 3300025942 Bacteria 3457
283 Ga0207689_10122065 3300025942 Bacteria 2143
284 Ga0207689_10378687 3300025942 Bacteria 1178
285 Ga0207689_10420296 3300025942 Bacteria 1115
286 Ga0207679_10007025 3300025945 Bacteria 7136
287 Ga0207679_10687047 3300025945 Bacteria 928
288 Ga0207679_11702917 3300025945 Bacteria 577
289 Ga0207667_11036171 3300025949 Bacteria 806
290 Ga0207651_10051371 3300025960 Bacteria 2804
291 Ga0207712_10049635 3300025961 Bacteria 2925
292 Ga0207640_10584360 3300025981 Bacteria 943
293 Ga0207658_10069890 3300025986 Bacteria 2655
294 Ga0207658_10348258 3300025986 Bacteria 1289
295 Ga0207677_10117633 3300026023 Bacteria 1993
296 Ga0207677_10276446 3300026023 Bacteria 1376
297 Ga0207677_10412684 3300026023 Bacteria 1148
298 Ga0207703_10006739 3300026035 Bacteria 9161
299 Ga0207703_11241257 3300026035 Bacteria 717
300 Ga0207639_10472451 3300026041 Bacteria 1142
301 Ga0207639_10720296 3300026041 Bacteria 926
302 Ga0207639_11285631 3300026041 Bacteria 687
303 Ga0207678_10090138 3300026067 Bacteria 2621
304 Ga0207678_11269331 3300026067 Bacteria 652
305 Ga0207678_11539683 3300026067 Bacteria 586
306 Ga0207708_10009391 3300026075 Bacteria 7240
307 Ga0207708_10014475 3300026075 Bacteria 5904
308 Ga0207708_10090480 3300026075 Bacteria 2359
309 Ga0207708_10227526 3300026075 Bacteria 1496
310 Ga0207702_10191476 3300026078 Bacteria 1890
311 Ga0207702_11835851 3300026078 Bacteria 598
312 Ga0207702_11898686 3300026078 Bacteria 587
313 Ga0207641_10094991 3300026088 Bacteria 2615
314 Ga0207641_10204130 3300026088 Bacteria 1824
315 Ga0207641_10507713 3300026088 Bacteria 1171
316 Ga0207648_10009225 3300026089 Bacteria 9476
317 Ga0207648_10105669 3300026089 Bacteria 2470
318 Ga0207648_10286973 3300026089 Bacteria 1473
319 Ga0207648_10618133 3300026089 Bacteria 1000
320 Ga0207676_10079872 3300026095 Bacteria 2653
321 Ga0207676_10195890 3300026095 Bacteria 1782
322 Ga0207674_10025008 3300026116 Bacteria 6374
323 Ga0207674_10408548 3300026116 Bacteria 1312
324 Ga0207675_100089447 3300026118 Bacteria 2893
325 Ga0207675_100099171 3300026118 Bacteria 2744
326 Ga0207675_100492874 3300026118 Bacteria 1219
327 Ga0207675_101345313 3300026118 Bacteria 735
328 Ga0207675_101719836 3300026118 Bacteria 647
329 Ga0207683_10025278 3300026121 Bacteria 5122
330 Ga0207683_10065963 3300026121 Bacteria 3191
331 Ga0207683_10452759 3300026121 Bacteria 1183
332 Ga0207698_10050531 3300026142 Bacteria 3172
333 Ga0207698_11585494 3300026142 Bacteria 670
334 Ga0209371_1000127 3300027312 Bacteria 127069
335 Ga0209371_1014420 3300027312 Bacteria 2167
336 Ga0209588_1185232 3300027671 Bacteria 652
337 Ga0209974_10032564 3300027876 Bacteria 1727
338 Ga0207428_10114524 3300027907 Bacteria 2072
339 Ga0207428_10353324 3300027907 Bacteria 1081
340 Ga0268266_10933519 3300028379 Bacteria 839
341 Ga0268265_10098575 3300028380 Bacteria 2354
342 Ga0268265_10195054 3300028380 Bacteria 1752
343 Ga0268265_10229425 3300028380 Bacteria 1631
344 Ga0268265_10675764 3300028380 Bacteria 995
345 Ga0268264_10340118 3300028381 Bacteria 1425
346 Ga0265318_10146243 3300028577 Bacteria 867
347 Ga0268256_1000104 3300030500 Bacteria 127069
348 Ga0268256_1015976 3300030500 Bacteria 2167
349 Ga0265331_10022712 3300031250 Bacteria 3198
350 Ga0265331_10049007 3300031250 Bacteria 2030
351 Ga0316575_10000620 3300031665 Bacteria 10468
352 Ga0316578_10002679 3300031728 Bacteria 7917
353 Ga0316578_10034624 3300031728 Bacteria 2900
354 Ga0316577_10048029 3300031733 Bacteria 2384
355 Ga0316577_10070263 3300031733 Bacteria 1955
356 Ga0307413_10058308 3300031824 Bacteria 2366
357 Ga0307413_11138447 3300031824 Bacteria 676
358 Ga0307412_10400050 3300031911 Bacteria 1118
359 Ga0307414_11533344 3300032004 Bacteria 620
360 Ga0307411_10059229 3300032005 Bacteria 2538
361 Ga0307415_100037066 3300032126 Bacteria 3202
362 Ga0316583_10004682 3300032133 Bacteria 4883
363 Ga0316583_10023167 3300032133 Bacteria 2220
364 Ga0373928_0083208 3300035084 Bacteria 810
365 Ga0373940_0079090 3300035088 Bacteria 969
366 Ga0373944_0286446 3300035089 Bacteria 615
367 Ga0373932_0101194 3300035112 Bacteria 938
368 Ga0373957_0309071 3300035120 Bacteria 671
369 Ga0373943_0434711 3300035170 Bacteria 761
370 Ga0373931_0377206 3300035691 Bacteria 893
371 Ga0373931_0929722 3300035691 Unclassified 586
372 Ga0373927_0799403 3300035695 Bacteria 623
373 Ga0316582_0000109 3300036647 Bacteria 23364
374 Ga0316584_0022991 3300036712 Bacteria 4551
375 Ga0373925_0214213 3300037068 Bacteria 1535
376 Ga0395900_1830547 3300037418 Bacteria 518
377 Ga0316581_0001871 3300037588 Bacteria 4899
378 Ga0395901_0148469 3300038443 Bacteria 2464
379 Ga0395901_1110237 3300038443 Bacteria 761
380 Ga0439438_000617 3300041405 Bacteria 16040
381 Ga0439466_0067604 3300041411 Bacteria 1143
382 Ga0451845_0179696 3300041501 Bacteria 546
383 Ga0439452_027298 3300042010 Bacteria 1434
384 Ga0439464_0007662 3300042439 Bacteria 2825
385 Ga0453684_0001700 3300044712 Bacteria 59293
386 Ga0453684_0741939 3300044712 Bacteria 1064
387 Ga0451576_0885781 3300045051 Bacteria 937
388 Ga0495580_0107565 3300046472 Bacteria 1937
389 Ga0495658_0008655 3300046683 Bacteria 5051
390 Ga0495636_0036192 3300047318 Bacteria 2035
391 Ga0495676_0403448 3300047321 Bacteria 907
392 Ga0496101_1262599 3300048904 Bacteria 578
393 Ga0496106_0747220 3300048909 Bacteria 778
394 Ga0496108_0798125 3300048911 Bacteria 815
395 Ga0496109_0174770 3300048912 Bacteria 2016
396 Ga0496109_0366093 3300048912 Bacteria 1362
397 Ga0496114_0764124 3300048917 Bacteria 844
398 Ga0501298_042729 3300049521 Bacteria 923
399 Ga0501032_0002183 3300049569 Bacteria 15403
400 Ga0501032_0073907 3300049569 Bacteria 2271
401 Ga0501032_0166924 3300049569 Bacteria 1444
402 Ga0501033_0003980 3300049570 Bacteria 11963
403 Ga0501034_0002247 3300049571 Bacteria 23780
404 Ga0501034_0019347 3300049571 Bacteria 6965
405 Ga0501034_0485387 3300049571 Bacteria 1150
406 Ga0501034_1247695 3300049571 Bacteria 621
407 Ga0501036_0005393 3300049572 Bacteria 10359
408 Ga0501036_0187508 3300049572 Bacteria 1741
409 Ga0501037_0007022 3300049573 Bacteria 8222
410 Ga0501037_0063828 3300049573 Bacteria 2685
411 Ga0501038_0014589 3300049574 Bacteria 7161
412 Ga0501039_0138437 3300049575 Bacteria 1912
413 Ga0501039_0629261 3300049575 Bacteria 840
414 Ga0501040_0309941 3300049576 Bacteria 1128
415 Ga0501043_0003463 3300049579 Bacteria 12960
416 Ga0501043_0468720 3300049579 Bacteria 944
417 Ga0501046_1100259 3300049580 Bacteria 549
418 Ga0501047_0012766 3300049581 Bacteria 7960
419 Ga0501068_0007273 3300049584 Bacteria 6131
420 Ga0501068_0059428 3300049584 Bacteria 2321
421 Ga0501068_0752814 3300049584 Bacteria 638
422 Ga0501069_0704941 3300049585 Bacteria 609
423 Ga0501070_0007828 3300049586 Bacteria 9057
424 Ga0501070_0122484 3300049586 Bacteria 2149
425 Ga0501070_1259183 3300049586 Bacteria 566
426 Ga0501073_0000427 3300049589 Bacteria 28847
427 Ga0501073_0000811 3300049589 Bacteria 22210
428 Ga0501074_0082398 3300049590 Bacteria 2307
429 Ga0501076_0602458 3300049592 Bacteria 906
430 Ga0501080_0004682 3300049742 Bacteria 12199
431 Ga0501080_0006805 3300049742 Bacteria 10306
432 Ga0501080_0289345 3300049742 Bacteria 1488
433 Ga0501081_0376630 3300049743 Bacteria 1048
434 Ga0501083_0049138 3300049744 Bacteria 2845
435 Ga0501083_0107543 3300049744 Bacteria 1835
436 Ga0501083_0345003 3300049744 Bacteria 968
437 Ga0501035_0256037 3300049822 Bacteria 1485
438 Ga0501035_0461017 3300049822 Bacteria 1050
439 Ga0501044_0002077 3300049823 Bacteria 23079
440 Ga0501044_0340001 3300049823 Bacteria 1422
441 Ga0501044_0588074 3300049823 Bacteria 1007
442 Ga0501045_0320390 3300049824 Bacteria 1154
443 nmdc:mga09592_937137_c1 3300050508 Bacteria 726
444 nmdc:mga06r32_675771_c1 3300050510 Bacteria 999
445 nmdc:mga08y16_20638_c1 3300050511 Bacteria 6953
446 nmdc:mga08y16_35981_c1 3300050511 Bacteria 5199
447 nmdc:mga0n895_189308_c1 3300050512 Bacteria 2089
448 nmdc:mga0n895_234805_c1 3300050512 Bacteria 1861
449 nmdc:mga0n895_594968_c1 3300050512 Bacteria 1109
450 nmdc:mga0n895_676211_c1 3300050512 Bacteria 1029
451 nmdc:mga0rr50_811616_c1 3300050513 Bacteria 798
452 Ga0501084_0695989 3300054114 Bacteria 857
453 Ga0501082_0016123 3300060353 Bacteria 6427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100358136 Ga0075434_1003581362 121
2 3300007076 Ga0075435_100206571 Ga0075435_1002065713 121
3 3300050512 nmdc:mga0n895_594968_c1 nmdc:mga0n895_594968_c1_506_922 121
4 3300050513 nmdc:mga0rr50_811616_c1 nmdc:mga0rr50_811616_c1_350_766 121
5 3300049823 Ga0501044_0588074 Ga0501044_0588074_620_997 125
6 3300005468 Ga0070707_100004600 Ga0070707_1000046002 126
7 3300013297 Ga0157378_10071086 Ga0157378_100710864 126
8 3300025912 Ga0207707_10006346 Ga0207707_100063463 126
9 3300025922 Ga0207646_10023410 Ga0207646_100234102 126
10 3300046472 Ga0495580_0107565 Ga0495580_0107565_564_944 126
11 3300047321 Ga0495676_0403448 Ga0495676_0403448_211_591 126
12 3300049584 Ga0501068_0752814 Ga0501068_0752814_239_619 126
13 3300050508 nmdc:mga09592_937137_c1 nmdc:mga09592_937137_c1_298_678 126
14 3300050512 nmdc:mga0n895_234805_c1 nmdc:mga0n895_234805_c1_1028_1408 126
15 3300005337 Ga0070682_100238601 Ga0070682_1002386012 128
16 3300005338 Ga0068868_101075038 Ga0068868_1010750381 128
17 3300005539 Ga0068853_101639810 Ga0068853_1016398101 128
18 3300013307 Ga0157372_10075662 Ga0157372_100756622 128
19 3300049572 Ga0501036_0187508 Ga0501036_0187508_546_983 128
20 3300025932 Ga0207690_10054275 Ga0207690_100542754 129
21 3300025933 Ga0207706_11567420 Ga0207706_115674201 129
22 3300026041 Ga0207639_11285631 Ga0207639_112856311 129
23 3300026067 Ga0207678_10090138 Ga0207678_100901383 129
24 3300031665 Ga0316575_10000620 Ga0316575_1000062012 130
25 3300049569 Ga0501032_0002183 Ga0501032_0002183_12512_12955 130
26 3300049575 Ga0501039_0138437 Ga0501039_0138437_1358_1801 130
27 3300005339 Ga0070660_101489906 Ga0070660_1014899061 131
28 3300009094 Ga0111539_10008285 Ga0111539_1000828512 131
29 3300041411 Ga0439466_0067604 Ga0439466_0067604_465_890 131
30 3300042439 Ga0439464_0007662 Ga0439464_0007662_1151_1576 131
31 3300005339 Ga0070660_100081765 Ga0070660_1000817652 132
32 3300005344 Ga0070661_101438661 Ga0070661_1014386611 132
33 3300005366 Ga0070659_100664238 Ga0070659_1006642382 132
34 3300005439 Ga0070711_100597555 Ga0070711_1005975552 132
35 3300005564 Ga0070664_101922691 Ga0070664_1019226911 132
36 3300005614 Ga0068856_101395812 Ga0068856_1013958122 132
37 3300009011 Ga0105251_10007498 Ga0105251_100074985 132
38 3300009545 Ga0105237_11427213 Ga0105237_114272132 132
39 3300013100 Ga0157373_10284402 Ga0157373_102844022 132
40 3300013102 Ga0157371_10119444 Ga0157371_101194443 132
41 3300013105 Ga0157369_10037445 Ga0157369_100374453 132
42 3300013307 Ga0157372_11363375 Ga0157372_113633751 132
43 3300014497 Ga0182008_10136752 Ga0182008_101367522 132
44 3300025728 Ga0207655_1049492 Ga0207655_10494921 132
45 3300025945 Ga0207679_11702917 Ga0207679_117029171 132
46 3300026078 Ga0207702_11898686 Ga0207702_118986861 132
47 3300027312 Ga0209371_1014420 Ga0209371_10144203 132
48 3300030500 Ga0268256_1015976 Ga0268256_10159763 132
49 3300031250 Ga0265331_10022712 Ga0265331_100227124 132
50 3300037418 Ga0395900_1830547 Ga0395900_1830547_10_423 132
51 3300038443 Ga0395901_0148469 Ga0395901_0148469_2021_2434 132
52 3300042010 Ga0439452_027298 Ga0439452_027298_781_1206 132
53 3300047318 Ga0495636_0036192 Ga0495636_0036192_1220_1633 132
54 3300048911 Ga0496108_0798125 Ga0496108_0798125_148_561 132
55 3300048912 Ga0496109_0366093 Ga0496109_0366093_329_742 132
56 3300049571 Ga0501034_1247695 Ga0501034_1247695_129_566 132
57 3300049573 Ga0501037_0063828 Ga0501037_0063828_871_1308 132
58 3300049576 Ga0501040_0309941 Ga0501040_0309941_220_636 132
59 3300049592 Ga0501076_0602458 Ga0501076_0602458_238_654 132
60 3300049743 Ga0501081_0376630 Ga0501081_0376630_618_1034 132
61 3300049823 Ga0501044_0340001 Ga0501044_0340001_215_652 132
62 3300049824 Ga0501045_0320390 Ga0501045_0320390_401_817 132
63 iso_pu_bacteria 8001522603 8001526527 133
64 3300009036 Ga0105244_10022854 Ga0105244_100228544 134
65 iso_pu_bacteria 2510065053 2510285447 135
66 iso_pu_bacteria 2510065055 2510295910 135
67 iso_pu_bacteria 2510065058 2510313539 135
68 iso_pu_bacteria 2773857672 2774132463 135
69 iso_pu_bacteria 2917832318 2917833934 135
70 iso_pu_bacteria 2919125081 2919129949 135
71 iso_pu_bacteria 2974298342 2974302878 135
72 iso_pu_bacteria 2984499530 2984499538 135
73 iso_pu_bacteria 2984504281 2984505982 135
74 iso_pu_bacteria 8016728285 8016732052 135
75 3300005467 Ga0070706_100734685 Ga0070706_1007346852 136
76 3300006051 Ga0075364_10152960 Ga0075364_101529602 136
77 3300025910 Ga0207684_10261314 Ga0207684_102613143 136
78 3300025937 Ga0207669_10363217 Ga0207669_103632171 136
79 3300027876 Ga0209974_10032564 Ga0209974_100325643 136
80 3300027907 Ga0207428_10353324 Ga0207428_103533242 136
81 3300048917 Ga0496114_0764124 Ga0496114_0764124_134_544 136
82 3300050511 nmdc:mga08y16_20638_c1 nmdc:mga08y16_20638_c1_6003_6413 136
83 3300005290 Ga0065712_10292833 Ga0065712_102928331 137
84 3300005290 Ga0065712_10297134 Ga0065712_102971341 137
85 3300005293 Ga0065715_10071848 Ga0065715_100718481 137
86 3300005328 Ga0070676_11388088 Ga0070676_113880881 137
87 3300005331 Ga0070670_100096557 Ga0070670_1000965573 137
88 3300005331 Ga0070670_100434060 Ga0070670_1004340602 137
89 3300005333 Ga0070677_10216748 Ga0070677_102167481 137
90 3300005334 Ga0068869_100015913 Ga0068869_1000159135 137
91 3300005334 Ga0068869_100295911 Ga0068869_1002959112 137
92 3300005334 Ga0068869_101225674 Ga0068869_1012256742 137
93 3300005335 Ga0070666_10262981 Ga0070666_102629812 137
94 3300005336 Ga0070680_100482920 Ga0070680_1004829202 137
95 3300005338 Ga0068868_100343160 Ga0068868_1003431602 137
96 3300005340 Ga0070689_100104883 Ga0070689_1001048832 137
97 3300005340 Ga0070689_101699261 Ga0070689_1016992611 137
98 3300005343 Ga0070687_100018048 Ga0070687_1000180484 137
99 3300005343 Ga0070687_100095668 Ga0070687_1000956683 137
100 3300005345 Ga0070692_10024376 Ga0070692_100243764 137
101 3300005345 Ga0070692_10067535 Ga0070692_100675352 137
102 3300005347 Ga0070668_100278016 Ga0070668_1002780162 137
103 3300005353 Ga0070669_100348558 Ga0070669_1003485582 137
104 3300005353 Ga0070669_100416811 Ga0070669_1004168112 137
105 3300005354 Ga0070675_100310392 Ga0070675_1003103922 137
106 3300005354 Ga0070675_100419419 Ga0070675_1004194192 137
107 3300005354 Ga0070675_100740246 Ga0070675_1007402462 137
108 3300005355 Ga0070671_100177949 Ga0070671_1001779492 137
109 3300005356 Ga0070674_102081216 Ga0070674_1020812161 137
110 3300005364 Ga0070673_100176965 Ga0070673_1001769652 137
111 3300005365 Ga0070688_100066977 Ga0070688_1000669772 137
112 3300005366 Ga0070659_101315978 Ga0070659_1013159781 137
113 3300005367 Ga0070667_100265676 Ga0070667_1002656762 137
114 3300005434 Ga0070709_10239887 Ga0070709_102398872 137
115 3300005440 Ga0070705_101134818 Ga0070705_1011348182 137
116 3300005441 Ga0070700_100007079 Ga0070700_1000070796 137
117 3300005444 Ga0070694_100352946 Ga0070694_1003529463 137
118 3300005445 Ga0070708_100559188 Ga0070708_1005591883 137
119 3300005455 Ga0070663_101489619 Ga0070663_1014896192 137
120 3300005456 Ga0070678_100071481 Ga0070678_1000714812 137
121 3300005456 Ga0070678_100617006 Ga0070678_1006170062 137
122 3300005457 Ga0070662_100061865 Ga0070662_1000618652 137
123 3300005458 Ga0070681_10140106 Ga0070681_101401063 137
124 3300005458 Ga0070681_10977462 Ga0070681_109774621 137
125 3300005459 Ga0068867_100039276 Ga0068867_1000392762 137
126 3300005459 Ga0068867_100390163 Ga0068867_1003901632 137
127 3300005459 Ga0068867_100556305 Ga0068867_1005563052 137
128 3300005466 Ga0070685_10501830 Ga0070685_105018301 137
129 3300005467 Ga0070706_100007046 Ga0070706_1000070469 137
130 3300005468 Ga0070707_102212369 Ga0070707_1022123691 137
131 3300005471 Ga0070698_100998611 Ga0070698_1009986111 137
132 3300005518 Ga0070699_100162813 Ga0070699_1001628131 137
133 3300005518 Ga0070699_100348865 Ga0070699_1003488652 137
134 3300005530 Ga0070679_100189514 Ga0070679_1001895142 137
135 3300005536 Ga0070697_100050573 Ga0070697_1000505733 137
136 3300005539 Ga0068853_100255861 Ga0068853_1002558611 137
137 3300005539 Ga0068853_100391643 Ga0068853_1003916432 137
138 3300005544 Ga0070686_100045163 Ga0070686_1000451633 137
139 3300005544 Ga0070686_101254979 Ga0070686_1012549791 137
140 3300005545 Ga0070695_100122851 Ga0070695_1001228512 137
141 3300005545 Ga0070695_101161423 Ga0070695_1011614231 137
142 3300005545 Ga0070695_101259242 Ga0070695_1012592421 137
143 3300005545 Ga0070695_101383274 Ga0070695_1013832741 137
144 3300005545 Ga0070695_101463141 Ga0070695_1014631411 137
145 3300005546 Ga0070696_100995647 Ga0070696_1009956471 137
146 3300005546 Ga0070696_101898940 Ga0070696_1018989401 137
147 3300005547 Ga0070693_100368840 Ga0070693_1003688402 137
148 3300005547 Ga0070693_100545327 Ga0070693_1005453271 137
149 3300005548 Ga0070665_100202999 Ga0070665_1002029992 137
150 3300005548 Ga0070665_101038530 Ga0070665_1010385302 137
151 3300005549 Ga0070704_100705873 Ga0070704_1007058732 137
152 3300005549 Ga0070704_101401655 Ga0070704_1014016551 137
153 3300005563 Ga0068855_100730521 Ga0068855_1007305212 137
154 3300005563 Ga0068855_100757272 Ga0068855_1007572722 137
155 3300005577 Ga0068857_100489707 Ga0068857_1004897073 137
156 3300005578 Ga0068854_100759989 Ga0068854_1007599892 137
157 3300005616 Ga0068852_102279880 Ga0068852_1022798802 137
158 3300005617 Ga0068859_100006929 Ga0068859_1000069294 137
159 3300005617 Ga0068859_100557220 Ga0068859_1005572202 137
160 3300005618 Ga0068864_100082484 Ga0068864_1000824844 137
161 3300005718 Ga0068866_10078151 Ga0068866_100781512 137
162 3300005719 Ga0068861_100452555 Ga0068861_1004525552 137
163 3300005719 Ga0068861_100578340 Ga0068861_1005783402 137
164 3300005719 Ga0068861_100701646 Ga0068861_1007016461 137
165 3300005840 Ga0068870_10202077 Ga0068870_102020772 137
166 3300005840 Ga0068870_10357815 Ga0068870_103578151 137
167 3300005841 Ga0068863_100020923 Ga0068863_1000209236 137
168 3300005841 Ga0068863_100138534 Ga0068863_1001385343 137
169 3300005841 Ga0068863_100239702 Ga0068863_1002397022 137
170 3300005842 Ga0068858_100010808 Ga0068858_1000108083 137
171 3300005842 Ga0068858_100028034 Ga0068858_1000280342 137
172 3300005843 Ga0068860_100778291 Ga0068860_1007782912 137
173 3300005844 Ga0068862_100073033 Ga0068862_1000730334 137
174 3300006163 Ga0070715_10796609 Ga0070715_107966091 137
175 3300006237 Ga0097621_100026373 Ga0097621_1000263732 137
176 3300006237 Ga0097621_100111538 Ga0097621_1001115383 137
177 3300006237 Ga0097621_101724006 Ga0097621_1017240061 137
178 3300006358 Ga0068871_100066781 Ga0068871_1000667814 137
179 3300006358 Ga0068871_100110908 Ga0068871_1001109082 137
180 3300006358 Ga0068871_100597355 Ga0068871_1005973552 137
181 3300006871 Ga0075434_100264640 Ga0075434_1002646402 137
182 3300006881 Ga0068865_100547174 Ga0068865_1005471742 137
183 3300006931 Ga0097620_100006929 Ga0097620_10000692911 137
184 3300006931 Ga0097620_100557203 Ga0097620_1005572032 137
185 3300007076 Ga0075435_100235481 Ga0075435_1002354812 137
186 3300007265 Ga0099794_10037360 Ga0099794_100373603 137
187 3300009094 Ga0111539_10055424 Ga0111539_100554243 137
188 3300009098 Ga0105245_10270236 Ga0105245_102702362 137
189 3300009101 Ga0105247_10005196 Ga0105247_100051969 137
190 3300009148 Ga0105243_10040470 Ga0105243_100404703 137
191 3300009148 Ga0105243_10091971 Ga0105243_100919713 137
192 3300009176 Ga0105242_10031301 Ga0105242_100313013 137
193 3300009176 Ga0105242_10064032 Ga0105242_100640323 137
194 3300009176 Ga0105242_10161818 Ga0105242_101618183 137
195 3300009176 Ga0105242_10672657 Ga0105242_106726572 137
196 3300009176 Ga0105242_10846254 Ga0105242_108462542 137
197 3300009177 Ga0105248_10000992 Ga0105248_1000099223 137
198 3300009177 Ga0105248_10690324 Ga0105248_106903242 137
199 3300009177 Ga0105248_10870923 Ga0105248_108709232 137
200 3300009553 Ga0105249_11608691 Ga0105249_116086912 137
201 3300009553 Ga0105249_12834120 Ga0105249_128341201 137
202 3300010375 Ga0105239_10263603 Ga0105239_102636033 137
203 3300011119 Ga0105246_10064289 Ga0105246_100642892 137
204 3300011119 Ga0105246_11758993 Ga0105246_117589932 137
205 3300013100 Ga0157373_10270697 Ga0157373_102706972 137
206 3300013296 Ga0157374_10003255 Ga0157374_100032553 137
207 3300013296 Ga0157374_10183715 Ga0157374_101837153 137
208 3300013296 Ga0157374_10194482 Ga0157374_101944823 137
209 3300013296 Ga0157374_10355950 Ga0157374_103559502 137
210 3300013296 Ga0157374_12272586 Ga0157374_122725862 137
211 3300013297 Ga0157378_10040438 Ga0157378_100404383 137
212 3300013297 Ga0157378_10064164 Ga0157378_100641643 137
213 3300013297 Ga0157378_10969611 Ga0157378_109696111 137
214 3300013306 Ga0163162_11477749 Ga0163162_114777492 137
215 3300013308 Ga0157375_10045551 Ga0157375_100455516 137
216 3300013308 Ga0157375_10509105 Ga0157375_105091052 137
217 3300013308 Ga0157375_10806204 Ga0157375_108062042 137
218 3300014325 Ga0163163_10411642 Ga0163163_104116422 137
219 3300014325 Ga0163163_11232476 Ga0163163_112324762 137
220 3300014325 Ga0163163_11274167 Ga0163163_112741672 137
221 3300014326 Ga0157380_10106188 Ga0157380_101061883 137
222 3300014326 Ga0157380_10688351 Ga0157380_106883512 137
223 3300014326 Ga0157380_11458796 Ga0157380_114587961 137
224 3300014745 Ga0157377_10447156 Ga0157377_104471562 137
225 3300014968 Ga0157379_10023823 Ga0157379_100238237 137
226 3300014968 Ga0157379_10067099 Ga0157379_100670993 137
227 3300014969 Ga0157376_10012058 Ga0157376_100120584 137
228 3300014969 Ga0157376_10345231 Ga0157376_103452312 137
229 3300014969 Ga0157376_10417062 Ga0157376_104170622 137
230 3300017792 Ga0163161_10323200 Ga0163161_103232002 137
231 3300025315 Ga0207697_10013643 Ga0207697_100136433 137
232 3300025893 Ga0207682_10002051 Ga0207682_100020519 137
233 3300025899 Ga0207642_10073993 Ga0207642_100739932 137
234 3300025899 Ga0207642_10197820 Ga0207642_101978202 137
235 3300025901 Ga0207688_10004075 Ga0207688_100040753 137
236 3300025905 Ga0207685_10667109 Ga0207685_106671091 137
237 3300025907 Ga0207645_10014310 Ga0207645_100143103 137
238 3300025908 Ga0207643_10016987 Ga0207643_100169872 137
239 3300025908 Ga0207643_10177099 Ga0207643_101770992 137
240 3300025908 Ga0207643_10390649 Ga0207643_103906492 137
241 3300025910 Ga0207684_10102452 Ga0207684_101024523 137
242 3300025918 Ga0207662_10021580 Ga0207662_100215804 137
243 3300025921 Ga0207652_10039685 Ga0207652_100396855 137
244 3300025922 Ga0207646_11059513 Ga0207646_110595132 137
245 3300025923 Ga0207681_10472961 Ga0207681_104729612 137
246 3300025925 Ga0207650_10076577 Ga0207650_100765774 137
247 3300025925 Ga0207650_10303728 Ga0207650_103037281 137
248 3300025925 Ga0207650_10621708 Ga0207650_106217081 137
249 3300025926 Ga0207659_10268478 Ga0207659_102684782 137
250 3300025926 Ga0207659_10344723 Ga0207659_103447232 137
251 3300025927 Ga0207687_10204891 Ga0207687_102048912 137
252 3300025927 Ga0207687_11187092 Ga0207687_111870921 137
253 3300025931 Ga0207644_10098414 Ga0207644_100984143 137
254 3300025934 Ga0207686_10146625 Ga0207686_101466253 137
255 3300025934 Ga0207686_10395710 Ga0207686_103957102 137
256 3300025935 Ga0207709_10394440 Ga0207709_103944403 137
257 3300025936 Ga0207670_10220551 Ga0207670_102205513 137
258 3300025936 Ga0207670_10722387 Ga0207670_107223872 137
259 3300025937 Ga0207669_11042230 Ga0207669_110422301 137
260 3300025937 Ga0207669_11939378 Ga0207669_119393781 137
261 3300025938 Ga0207704_10548438 Ga0207704_105484381 137
262 3300025939 Ga0207665_10398237 Ga0207665_103982372 137
263 3300025940 Ga0207691_10125656 Ga0207691_101256563 137
264 3300025941 Ga0207711_10246184 Ga0207711_102461842 137
265 3300025942 Ga0207689_10022518 Ga0207689_100225185 137
266 3300025942 Ga0207689_10049766 Ga0207689_100497662 137
267 3300025942 Ga0207689_10122065 Ga0207689_101220653 137
268 3300025942 Ga0207689_10378687 Ga0207689_103786872 137
269 3300025945 Ga0207679_10687047 Ga0207679_106870472 137
270 3300025949 Ga0207667_11036171 Ga0207667_110361712 137
271 3300025960 Ga0207651_10051371 Ga0207651_100513713 137
272 3300025961 Ga0207712_10049635 Ga0207712_100496353 137
273 3300025986 Ga0207658_10348258 Ga0207658_103482582 137
274 3300026023 Ga0207677_10276446 Ga0207677_102764462 137
275 3300026035 Ga0207703_10006739 Ga0207703_100067393 137
276 3300026041 Ga0207639_10472451 Ga0207639_104724512 137
277 3300026041 Ga0207639_10720296 Ga0207639_107202962 137
278 3300026067 Ga0207678_11269331 Ga0207678_112693312 137
279 3300026075 Ga0207708_10009391 Ga0207708_100093912 137
280 3300026075 Ga0207708_10014475 Ga0207708_100144752 137
281 3300026075 Ga0207708_10227526 Ga0207708_102275262 137
282 3300026088 Ga0207641_10094991 Ga0207641_100949913 137
283 3300026088 Ga0207641_10204130 Ga0207641_102041302 137
284 3300026088 Ga0207641_10507713 Ga0207641_105077132 137
285 3300026089 Ga0207648_10105669 Ga0207648_101056692 137
286 3300026089 Ga0207648_10286973 Ga0207648_102869733 137
287 3300026089 Ga0207648_10618133 Ga0207648_106181332 137
288 3300026095 Ga0207676_10079872 Ga0207676_100798722 137
289 3300026095 Ga0207676_10195890 Ga0207676_101958903 137
290 3300026116 Ga0207674_10025008 Ga0207674_100250087 137
291 3300026116 Ga0207674_10408548 Ga0207674_104085483 137
292 3300026118 Ga0207675_100089447 Ga0207675_1000894472 137
293 3300026118 Ga0207675_100099171 Ga0207675_1000991713 137
294 3300026118 Ga0207675_101345313 Ga0207675_1013453132 137
295 3300026121 Ga0207683_10025278 Ga0207683_100252787 137
296 3300026121 Ga0207683_10452759 Ga0207683_104527592 137
297 3300026142 Ga0207698_11585494 Ga0207698_115854942 137
298 3300027671 Ga0209588_1185232 Ga0209588_11852322 137
299 3300027907 Ga0207428_10114524 Ga0207428_101145243 137
300 3300028379 Ga0268266_10933519 Ga0268266_109335192 137
301 3300028380 Ga0268265_10098575 Ga0268265_100985753 137
302 3300028380 Ga0268265_10195054 Ga0268265_101950542 137
303 3300028380 Ga0268265_10675764 Ga0268265_106757642 137
304 3300028381 Ga0268264_10340118 Ga0268264_103401183 137
305 3300028577 Ga0265318_10146243 Ga0265318_101462432 137
306 3300031250 Ga0265331_10049007 Ga0265331_100490072 137
307 3300031728 Ga0316578_10002679 Ga0316578_100026797 137
308 3300031728 Ga0316578_10034624 Ga0316578_100346241 137
309 3300031733 Ga0316577_10048029 Ga0316577_100480291 137
310 3300031733 Ga0316577_10070263 Ga0316577_100702631 137
311 3300031824 Ga0307413_10058308 Ga0307413_100583083 137
312 3300031824 Ga0307413_11138447 Ga0307413_111384471 137
313 3300031911 Ga0307412_10400050 Ga0307412_104000502 137
314 3300032004 Ga0307414_11533344 Ga0307414_115333442 137
315 3300032005 Ga0307411_10059229 Ga0307411_100592294 137
316 3300032126 Ga0307415_100037066 Ga0307415_1000370662 137
317 3300032133 Ga0316583_10004682 Ga0316583_100046823 137
318 3300032133 Ga0316583_10023167 Ga0316583_100231672 137
319 3300035084 Ga0373928_0083208 Ga0373928_0083208_256_669 137
320 3300035088 Ga0373940_0079090 Ga0373940_0079090_403_816 137
321 3300035089 Ga0373944_0286446 Ga0373944_0286446_21_434 137
322 3300035112 Ga0373932_0101194 Ga0373932_0101194_214_627 137
323 3300035170 Ga0373943_0434711 Ga0373943_0434711_48_473 137
324 3300035691 Ga0373931_0377206 Ga0373931_0377206_460_873 137
325 3300035691 Ga0373931_0929722 Ga0373931_0929722_160_573 137
326 3300035695 Ga0373927_0799403 Ga0373927_0799403_179_604 137
327 3300036647 Ga0316582_0000109 Ga0316582_0000109_20588_21013 137
328 3300036712 Ga0316584_0022991 Ga0316584_0022991_526_951 137
329 3300037068 Ga0373925_0214213 Ga0373925_0214213_115_540 137
330 3300037588 Ga0316581_0001871 Ga0316581_0001871_2397_2822 137
331 3300044712 Ga0453684_0001700 Ga0453684_0001700_28224_28649 137
332 3300044712 Ga0453684_0741939 Ga0453684_0741939_576_1001 137
333 3300045051 Ga0451576_0885781 Ga0451576_0885781_382_795 137
334 3300046683 Ga0495658_0008655 Ga0495658_0008655_2004_2417 137
335 3300048904 Ga0496101_1262599 Ga0496101_1262599_55_468 137
336 3300048909 Ga0496106_0747220 Ga0496106_0747220_284_703 137
337 3300048912 Ga0496109_0174770 Ga0496109_0174770_519_932 137
338 3300049521 Ga0501298_042729 Ga0501298_042729_91_504 137
339 3300049569 Ga0501032_0073907 Ga0501032_0073907_321_734 137
340 3300049569 Ga0501032_0166924 Ga0501032_0166924_930_1355 137
341 3300049570 Ga0501033_0003980 Ga0501033_0003980_816_1241 137
342 3300049571 Ga0501034_0002247 Ga0501034_0002247_16936_17361 137
343 3300049571 Ga0501034_0019347 Ga0501034_0019347_1933_2346 137
344 3300049571 Ga0501034_0485387 Ga0501034_0485387_201_614 137
345 3300049572 Ga0501036_0005393 Ga0501036_0005393_1281_1706 137
346 3300049573 Ga0501037_0007022 Ga0501037_0007022_5513_5938 137
347 3300049574 Ga0501038_0014589 Ga0501038_0014589_261_686 137
348 3300049575 Ga0501039_0629261 Ga0501039_0629261_201_614 137
349 3300049579 Ga0501043_0003463 Ga0501043_0003463_1535_1960 137
350 3300049579 Ga0501043_0468720 Ga0501043_0468720_91_504 137
351 3300049580 Ga0501046_1100259 Ga0501046_1100259_34_447 137
352 3300049581 Ga0501047_0012766 Ga0501047_0012766_393_818 137
353 3300049584 Ga0501068_0007273 Ga0501068_0007273_2597_3010 137
354 3300049584 Ga0501068_0059428 Ga0501068_0059428_672_1097 137
355 3300049585 Ga0501069_0704941 Ga0501069_0704941_94_507 137
356 3300049586 Ga0501070_0007828 Ga0501070_0007828_374_787 137
357 3300049586 Ga0501070_0122484 Ga0501070_0122484_1262_1675 137
358 3300049586 Ga0501070_1259183 Ga0501070_1259183_29_529 137
359 3300049589 Ga0501073_0000427 Ga0501073_0000427_22113_22538 137
360 3300049589 Ga0501073_0000811 Ga0501073_0000811_12638_13051 137
361 3300049590 Ga0501074_0082398 Ga0501074_0082398_1745_2170 137
362 3300049742 Ga0501080_0004682 Ga0501080_0004682_4803_5228 137
363 3300049742 Ga0501080_0006805 Ga0501080_0006805_3157_3570 137
364 3300049742 Ga0501080_0289345 Ga0501080_0289345_556_969 137
365 3300049744 Ga0501083_0049138 Ga0501083_0049138_1970_2383 137
366 3300049744 Ga0501083_0107543 Ga0501083_0107543_1388_1813 137
367 3300049744 Ga0501083_0345003 Ga0501083_0345003_378_791 137
368 3300049822 Ga0501035_0256037 Ga0501035_0256037_908_1321 137
369 3300049822 Ga0501035_0461017 Ga0501035_0461017_228_653 137
370 3300049823 Ga0501044_0002077 Ga0501044_0002077_11934_12359 137
371 3300050510 nmdc:mga06r32_675771_c1 nmdc:mga06r32_675771_c1_172_585 137
372 3300050511 nmdc:mga08y16_35981_c1 nmdc:mga08y16_35981_c1_2928_3341 137
373 3300050512 nmdc:mga0n895_676211_c1 nmdc:mga0n895_676211_c1_604_1017 137
374 3300054114 Ga0501084_0695989 Ga0501084_0695989_264_689 137
375 3300060353 Ga0501082_0016123 Ga0501082_0016123_803_1228 137
376 3300005331 Ga0070670_101020872 Ga0070670_1010208722 138
377 3300005337 Ga0070682_100958885 Ga0070682_1009588852 138
378 3300005367 Ga0070667_100049464 Ga0070667_1000494643 138
379 3300005617 Ga0068859_100209166 Ga0068859_1002091662 138
380 3300005719 Ga0068861_100603110 Ga0068861_1006031102 138
381 3300006931 Ga0097620_100209170 Ga0097620_1002091702 138
382 3300009177 Ga0105248_12424471 Ga0105248_124244711 138
383 3300025923 Ga0207681_10573030 Ga0207681_105730301 138
384 3300025925 Ga0207650_10810118 Ga0207650_108101182 138
385 3300025986 Ga0207658_10069890 Ga0207658_100698904 138
386 3300026023 Ga0207677_10412684 Ga0207677_104126842 138
387 3300026118 Ga0207675_101719836 Ga0207675_1017198362 138
388 3300005334 Ga0068869_100307514 Ga0068869_1003075142 139
389 3300005338 Ga0068868_100074177 Ga0068868_1000741772 139
390 3300005345 Ga0070692_10574123 Ga0070692_105741231 139
391 3300005356 Ga0070674_100043382 Ga0070674_1000433822 139
392 3300005441 Ga0070700_100126268 Ga0070700_1001262682 139
393 3300005456 Ga0070678_100052731 Ga0070678_1000527312 139
394 3300005457 Ga0070662_101021288 Ga0070662_1010212882 139
395 3300005459 Ga0068867_100012234 Ga0068867_1000122343 139
396 3300005615 Ga0070702_100714736 Ga0070702_1007147361 139
397 3300005618 Ga0068864_101063722 Ga0068864_1010637221 139
398 3300006871 Ga0075434_100134240 Ga0075434_1001342403 139
399 3300009036 Ga0105244_10177309 Ga0105244_101773091 139
400 3300009101 Ga0105247_10467969 Ga0105247_104679692 139
401 3300009148 Ga0105243_10613554 Ga0105243_106135543 139
402 3300010375 Ga0105239_10297125 Ga0105239_102971253 139
403 3300013296 Ga0157374_10238988 Ga0157374_102389882 139
404 3300013297 Ga0157378_10064846 Ga0157378_100648462 139
405 3300013307 Ga0157372_10162967 Ga0157372_101629674 139
406 3300013308 Ga0157375_10243132 Ga0157375_102431321 139
407 3300025728 Ga0207655_1098466 Ga0207655_10984662 139
408 3300025918 Ga0207662_10085654 Ga0207662_100856542 139
409 3300025937 Ga0207669_10065934 Ga0207669_100659343 139
410 3300025942 Ga0207689_10420296 Ga0207689_104202962 139
411 3300026023 Ga0207677_10117633 Ga0207677_101176333 139
412 3300026035 Ga0207703_11241257 Ga0207703_112412571 139
413 3300026075 Ga0207708_10090480 Ga0207708_100904802 139
414 3300026089 Ga0207648_10009225 Ga0207648_100092254 139
415 3300026118 Ga0207675_100492874 Ga0207675_1004928742 139
416 3300026121 Ga0207683_10065963 Ga0207683_100659632 139
417 3300027312 Ga0209371_1000127 Ga0209371_1000127112 139
418 3300028380 Ga0268265_10229425 Ga0268265_102294252 139
419 3300030500 Ga0268256_1000104 Ga0268256_1000104112 139
420 3300041405 Ga0439438_000617 Ga0439438_000617_6066_6491 139
421 3300041501 Ga0451845_0179696 Ga0451845_0179696_11_430 139
422 3300050512 nmdc:mga0n895_189308_c1 nmdc:mga0n895_189308_c1_598_1023 139
423 3300001976 JGI24752J21851_1006625 JGI24752J21851_10066253 142
424 3300005293 Ga0065715_10270299 Ga0065715_102702992 142
425 3300005328 Ga0070676_10350360 Ga0070676_103503602 142
426 3300005331 Ga0070670_100032729 Ga0070670_1000327294 142
427 3300005331 Ga0070670_100036494 Ga0070670_1000364944 142
428 3300005335 Ga0070666_10492769 Ga0070666_104927691 142
429 3300005338 Ga0068868_100297567 Ga0068868_1002975672 142
430 3300005344 Ga0070661_100016963 Ga0070661_1000169633 142
431 3300005354 Ga0070675_100380151 Ga0070675_1003801512 142
432 3300005355 Ga0070671_100081931 Ga0070671_1000819314 142
433 3300005535 Ga0070684_100144252 Ga0070684_1001442522 142
434 3300005564 Ga0070664_100071856 Ga0070664_1000718562 142
435 3300005614 Ga0068856_100256471 Ga0068856_1002564712 142
436 3300005616 Ga0068852_100071009 Ga0068852_1000710092 142
437 3300005618 Ga0068864_100424143 Ga0068864_1004241432 142
438 3300005834 Ga0068851_10003969 Ga0068851_100039698 142
439 3300006358 Ga0068871_100524648 Ga0068871_1005246482 142
440 3300009148 Ga0105243_10134251 Ga0105243_101342512 142
441 3300009176 Ga0105242_10501943 Ga0105242_105019431 142
442 3300009551 Ga0105238_10433359 Ga0105238_104333592 142
443 3300013102 Ga0157371_11184129 Ga0157371_111841291 142
444 3300013105 Ga0157369_11580752 Ga0157369_115807521 142
445 3300013296 Ga0157374_10010560 Ga0157374_1001056010 142
446 3300013297 Ga0157378_11517602 Ga0157378_115176022 142
447 3300013307 Ga0157372_12018940 Ga0157372_120189402 142
448 3300025321 Ga0207656_10011875 Ga0207656_100118754 142
449 3300025903 Ga0207680_10512653 Ga0207680_105126532 142
450 3300025920 Ga0207649_10042285 Ga0207649_100422852 142
451 3300025924 Ga0207694_10414550 Ga0207694_104145502 142
452 3300025925 Ga0207650_10012522 Ga0207650_100125224 142
453 3300025925 Ga0207650_10057952 Ga0207650_100579523 142
454 3300025931 Ga0207644_10070624 Ga0207644_100706242 142
455 3300025935 Ga0207709_10798243 Ga0207709_107982432 142
456 3300025937 Ga0207669_10631996 Ga0207669_106319962 142
457 3300025945 Ga0207679_10007025 Ga0207679_100070257 142
458 3300025981 Ga0207640_10584360 Ga0207640_105843602 142
459 3300026067 Ga0207678_11539683 Ga0207678_115396832 142
460 3300026078 Ga0207702_10191476 Ga0207702_101914762 142
461 3300026078 Ga0207702_11835851 Ga0207702_118358511 142
462 3300026142 Ga0207698_10050531 Ga0207698_100505315 142
463 3300035120 Ga0373957_0309071 Ga0373957_0309071_30_470 142
464 3300038443 Ga0395901_1110237 Ga0395901_1110237_251_733 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

22

166

0.93

PF05425

CopD

Copper resistance protein D

68

164

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c98-assembly1.cif.gz_B revised structure of the munc18a-syntaxin1 complex 0.561 6 110
7ah0-assembly1.cif.gz_A crystal structure of the de novo designed two-heme binding protein, 4d2 0.5453 6 131
4lle-assembly2.cif.gz_D the crystal structure of r60l mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.505 7 141
7ah0-assembly1.cif.gz_A crystal structure of the de novo designed two-heme binding protein, 4d2 0.5029 6 131
4lle-assembly2.cif.gz_D the crystal structure of r60l mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.494 7 141
ID Description Score Start End Superfamily
af_Q4D2D0_26_123_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5968 1 74 3.40.50.300
af_I1KYI2_192_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.5358 5 137 2.60.120.200
af_Q9LYS9_197_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.5256 5 142 2.60.120.200
af_Q9LYS9_197_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.5086 5 142 2.60.120.200
af_G5ECH4_2_140_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4875 4 109 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A1B4V228-F1-model_v4 Protoporphyrinogen IX oxidase (EC 1.3.99.-) 0.9681 2 142 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A1B4V228-F1-model_v4 Protoporphyrinogen IX oxidase (EC 1.3.99.-) 0.9613 2 142 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A2W5N740-F1-model_v4 deleted 0.9597 6 122
AF-A0A3E0WGN7-F1-model_v4 Protoporphyrinogen IX oxidase (EC 1.3.99.-) 0.9548 6 142 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A4P5U0L3-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9531 6 142 GO:0005886
GO:0006782
GO:0046872
GO:0070818

Feature Viewer

pLDDT pTM Quality
88.83 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map