metagRoot

F449309

General Info

Members	Datasets	Scaffolds	Average Seq Length
464	341	416	277

Family's Representative Sequence

Representative Sequence	3300025936\|Ga0207670_10307304\|Ga0207670_103073041
Length	329
Sequence	MKDLSGKIAFVTGAASGIGLGIATALSQAGVKVMLCDIEEEALTKAVAALKLTNADVDGVRADVSLKAELQDAADATVARYGKIHILVNNAGVGXXXXYGRWTDASWNWALGVNLMSVIWGIEIFGPLIEAHGEGGQIVSTASIAGLIAGSGPSYNVTKYGVVALSEGLRITLAPRAIGVSVLCPGFIRTQIMNSRRNVPQRFASALEAVPTEGPIAEFVKTVQERVSRGIDPLYVGELVREGIENDWPYIFTDTEFEPLIDERFAAIKQGFDRIRGRILADALAAIDSEVEETIERHSHATLVACWTSRSRRAWQRSPISRGQYDRPR

Samples

	Sample ID	Description	Type	Environment
1	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
2	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
3	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
4	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
5	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
6	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
7	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
8	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
9	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
10	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
11	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
12	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
13	2906610324
14	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
15	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
16	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
17	2922425934
18	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
19	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
20	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
21	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
22	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
23	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
24	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
25	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
26	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
27	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
28	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
29	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
30	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
31	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
32	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
33	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
34	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
35	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
36	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
37	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
38	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
39	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
40	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
41	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
42	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
43	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
44	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
45	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
46	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
47	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
48	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
49	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
50	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
51	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
52	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
53	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
54	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
55	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
56	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
57	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
58	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
59	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
60	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
61	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
62	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
63	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
64	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
65	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
66	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
67	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
68	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
69	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
70	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
71	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
72	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
73	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
74	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
75	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
76	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
77	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
78	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
79	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
80	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
81	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
82	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
83	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
84	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
85	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
86	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
87	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
88	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
89	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
90	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
91	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
92	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
93	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
94	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
95	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
96	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
97	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
98	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
99	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
100	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
101	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
102	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
103	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
104	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
105	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
106	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
107	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
108	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
109	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
110	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
111	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
112	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
113	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
114	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
115	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
116	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
117	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
118	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
119	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
120	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
121	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
122	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
123	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
124	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
125	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
126	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
127	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
128	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
177	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
178	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
179	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
183	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
184	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
185	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
186	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
187	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
188	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
189	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
190	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
191	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
192	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
193	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
194	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
195	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
196	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
197	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
198	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
199	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
200	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
201	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
202	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
203	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
204	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
205	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
206	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
207	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
208	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
209	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
210	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
211	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
212	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
213	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
214	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
215	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
216	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
217	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
218	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
219	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
220	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
221	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
222	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
223	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
224	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
225	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
226	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
227	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
228	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
229	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
230	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
231	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
232	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
233	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
234	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
235	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
236	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
237	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
238	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
239	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
240	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
241	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
242	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
243	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
244	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
245	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
246	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
247	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
248	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
249	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
250	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
251	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
252	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
253	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
254	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
255	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
256	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
257	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
258	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
259	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
260	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
261	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
262	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
263	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
264	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
265	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
266	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
267	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
268	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
269	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
270	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
271	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
272	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
273	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
274	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
275	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
276	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
277	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
278	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
279	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
280	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
281	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
282	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
283	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
284	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
285	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
286	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
287	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
288	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
289	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
290	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
291	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
292	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
293	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
294	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
295	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
296	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
297	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
298	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
299	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
300	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
301	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
302	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
303	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
304	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
305	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
306	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
307	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
308	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
309	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
310	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
311	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
312	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
313	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
314	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
315	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
316	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
317	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
318	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
319	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
320	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
321	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
322	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
323	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
324	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
325	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
326	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
327	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
328	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
329	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
330	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
331	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
332	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
333	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
334	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
335	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
336	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
337	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
338	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
339	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
340	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
341	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	90.04
Metatranscriptomes	0
Isolates	9.96

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.76
Nodule	10.34
Rhizoplane	5.17
Rhizosphere	70.26
Stem	0
Stem Tuber	0
Unclassified	6.47

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10058519	3300003203	Bacteria	1256
2	rootH2_10245547	3300003320	Bacteria	1030
3	JGI25404J52841_10000080	3300003659	Bacteria	8854
4	JGI25404J52841_10000392	3300003659	Bacteria	6042
5	Ga0055542_1013423	3300003762	Bacteria	1377
6	Ga0070666_10001509	3300005335	Bacteria	14131
7	Ga0070689_100275770	3300005340	Bacteria	1393
8	Ga0070691_10000188	3300005341	Bacteria	20589
9	Ga0070691_10095353	3300005341	Bacteria	1472
10	Ga0070692_10198430	3300005345	Bacteria	1174
11	Ga0070673_100004906	3300005364	Bacteria	8521
12	Ga0070673_100423715	3300005364	Bacteria	1194
13	Ga0070688_100028944	3300005365	Bacteria	3312
14	Ga0070667_100012814	3300005367	Bacteria	6928
15	Ga0070709_10002131	3300005434	Bacteria	10708
16	Ga0070709_10108756	3300005434	Bacteria	1860
17	Ga0070714_100010468	3300005435	Bacteria	7331
18	Ga0070714_100105974	3300005435	Bacteria	2483
19	Ga0070713_100027234	3300005436	Bacteria	4499
20	Ga0070710_10001373	3300005437	Bacteria	11479
21	Ga0070711_100001786	3300005439	Bacteria	11974
22	Ga0070711_100551067	3300005439	Bacteria	957
23	Ga0070705_100078773	3300005440	Bacteria	2016
24	Ga0070708_100422166	3300005445	Bacteria	1258
25	Ga0070663_100360655	3300005455	Bacteria	1179
26	Ga0070662_100107492	3300005457	Bacteria	2121
27	Ga0070681_10182052	3300005458	Bacteria	2022
28	Ga0070707_100229140	3300005468	Bacteria	1809
29	Ga0070698_100007048	3300005471	Bacteria	12176
30	Ga0070699_100127857	3300005518	Bacteria	2238
31	Ga0070684_100133906	3300005535	Bacteria	2237
32	Ga0070684_100219682	3300005535	Bacteria	1734
33	Ga0068853_100204202	3300005539	Bacteria	1799
34	Ga0068853_100297112	3300005539	Bacteria	1492
35	Ga0070672_100029769	3300005543	Bacteria	4097
36	Ga0070672_100194760	3300005543	Bacteria	1693
37	Ga0070686_100263362	3300005544	Bacteria	1264
38	Ga0070695_100064091	3300005545	Bacteria	2390
39	Ga0070696_100163246	3300005546	Bacteria	1642
40	Ga0070696_100336653	3300005546	Bacteria	1165
41	Ga0070693_100031355	3300005547	Bacteria	2912
42	Ga0070665_100079098	3300005548	Bacteria	3294
43	Ga0070704_100611005	3300005549	Bacteria	959
44	Ga0068855_100144131	3300005563	Bacteria	2713
45	Ga0068855_100360782	3300005563	Bacteria	1599
46	Ga0068857_100001469	3300005577	Bacteria	18747
47	Ga0068857_100029286	3300005577	Bacteria	4859
48	Ga0068856_100004172	3300005614	Bacteria	14431
49	Ga0068852_100030637	3300005616	Bacteria	4432
50	Ga0068864_100065372	3300005618	Bacteria	3155
51	Ga0068864_100129160	3300005618	Bacteria	2268
52	Ga0068864_100216448	3300005618	Bacteria	1766
53	Ga0068863_100395324	3300005841	Bacteria	1351
54	Ga0068858_100091538	3300005842	Bacteria	2831
55	Ga0068858_100137625	3300005842	Bacteria	2292
56	Ga0068858_100161229	3300005842	Bacteria	2111
57	Ga0068858_100210515	3300005842	Bacteria	1840
58	Ga0068858_100224365	3300005842	Bacteria	1780
59	Ga0068860_100043887	3300005843	Bacteria	4263
60	Ga0081455_10000197	3300005937	Bacteria	76374
61	Ga0081455_10007709	3300005937	Bacteria	11292
62	Ga0081455_10058341	3300005937	Bacteria	3266
63	Ga0081455_10203598	3300005937	Bacteria	1480
64	Ga0081540_1002252	3300005983	Bacteria	15882
65	Ga0081540_1004101	3300005983	Bacteria	11251
66	Ga0081540_1006841	3300005983	Bacteria	8232
67	Ga0081540_1063089	3300005983	Bacteria	1755
68	Ga0081540_1115471	3300005983	Bacteria	1125
69	Ga0081539_10003299	3300005985	Bacteria	20183
70	Ga0081539_10004863	3300005985	Bacteria	14362
71	Ga0070717_10044712	3300006028	Bacteria	3618
72	Ga0070717_10475781	3300006028	Bacteria	1127
73	Ga0075365_10006833	3300006038	Bacteria	6325
74	Ga0075365_10047948	3300006038	Bacteria	2810
75	Ga0075365_10073891	3300006038	Bacteria	2299
76	Ga0075364_10025968	3300006051	Bacteria	3733
77	Ga0070716_100003956	3300006173	Bacteria	7032
78	Ga0070716_100235235	3300006173	Unclassified	1239
79	Ga0070712_100256136	3300006175	Bacteria	1400
80	Ga0070712_100364094	3300006175	Bacteria	1186
81	Ga0075366_10104445	3300006195	Bacteria	1702
82	Ga0075428_100145557	3300006844	Bacteria	2575
83	Ga0075428_100399384	3300006844	Bacteria	1473
84	Ga0075431_100146950	3300006847	Bacteria	2429
85	Ga0075433_10116682	3300006852	Bacteria	2368
86	Ga0075434_100099871	3300006871	Bacteria	2907
87	Ga0075434_100503901	3300006871	Bacteria	1231
88	Ga0075429_100229395	3300006880	Bacteria	1626
89	Ga0068865_100001260	3300006881	Bacteria	14745
90	Ga0075436_100158103	3300006914	Bacteria	1597
91	Ga0099824_1013423	3300006942	Bacteria	8513
92	Ga0075435_100085648	3300007076	Bacteria	2594
93	Ga0075435_100392009	3300007076	Bacteria	1194
94	Ga0099794_10020884	3300007265	Bacteria	2969
95	Ga0105240_10020454	3300009093	Bacteria	8827
96	Ga0105240_10269715	3300009093	Bacteria	1960
97	Ga0105240_10324306	3300009093	Bacteria	1754
98	Ga0105247_10006140	3300009101	Bacteria	7463
99	Ga0105247_10018692	3300009101	Bacteria	4160
100	Ga0114129_10140587	3300009147	Bacteria	3310
101	Ga0114129_10267605	3300009147	Bacteria	2288
102	Ga0105243_10521934	3300009148	Bacteria	1130
103	Ga0105241_10006288	3300009174	Bacteria	8755
104	Ga0105241_10016468	3300009174	Bacteria	5423
105	Ga0105241_10049746	3300009174	Bacteria	3193
106	Ga0105248_10101722	3300009177	Bacteria	3239
107	Ga0105248_10109258	3300009177	Bacteria	3118
108	Ga0105248_10127309	3300009177	Unclassified	2873
109	Ga0105237_10148265	3300009545	Bacteria	2342
110	Ga0105237_10319724	3300009545	Bacteria	1556
111	Ga0105238_10001095	3300009551	Bacteria	27380
112	Ga0099796_10017496	3300010159	Bacteria	2136
113	Ga0099796_10111979	3300010159	Bacteria	1040
114	Ga0105239_10002944	3300010375	Bacteria	21247
115	Ga0105239_10085832	3300010375	Unclassified	3470
116	Ga0105246_10019783	3300011119	Bacteria	4311
117	Ga0105246_10200433	3300011119	Unclassified	1551
118	Ga0157371_10270656	3300013102	Bacteria	1226
119	Ga0157370_10001547	3300013104	Bacteria	28470
120	Ga0157374_10209834	3300013296	Bacteria	1909
121	Ga0163162_10052617	3300013306	Bacteria	4090
122	Ga0163162_10079045	3300013306	Bacteria	3355
123	Ga0163162_10175434	3300013306	Bacteria	2269
124	Ga0157372_10012864	3300013307	Bacteria	8921
125	Ga0157375_11112302	3300013308	Bacteria	925
126	Ga0163163_10294611	3300014325	Bacteria	1675
127	Ga0163163_10543874	3300014325	Bacteria	1224
128	Ga0157379_10003593	3300014968	Bacteria	13146
129	Ga0157379_10003995	3300014968	Bacteria	12575
130	Ga0157379_10019701	3300014968	Bacteria	5960
131	Ga0157379_10030167	3300014968	Bacteria	4824
132	Ga0157376_10017084	3300014969	Bacteria	5526
133	Ga0157376_10102466	3300014969	Bacteria	2504
134	Ga0163161_10049643	3300017792	Bacteria	3033
135	Ga0214544_1014616	3300021320	Bacteria	8667
136	Ga0214544_1017506	3300021320	Bacteria	6381
137	Ga0214542_1010780	3300021321	Bacteria	13037
138	Ga0214542_1014611	3300021321	Bacteria	8667
139	Ga0214545_1000519	3300021324	Bacteria	61850
140	Ga0214543_1017766	3300021327	Bacteria	6830
141	Ga0213873_10015751	3300021358	Bacteria	1699
142	Ga0213876_10009960	3300021384	Bacteria	5109
143	Ga0209148_1001232	3300025254	Bacteria	14323
144	Ga0209233_1011887	3300025261	Bacteria	2549
145	Ga0209455_1005364	3300025272	Bacteria	3979
146	Ga0209758_1000650	3300025297	Bacteria	52689
147	Ga0207697_10018357	3300025315	Bacteria	2868
148	Ga0207653_10010010	3300025885	Bacteria	2957
149	Ga0207692_10001280	3300025898	Bacteria	9333
150	Ga0207642_10101917	3300025899	Bacteria	1443
151	Ga0207710_10009527	3300025900	Bacteria	4085
152	Ga0207688_10016568	3300025901	Bacteria	3998
153	Ga0207680_10003678	3300025903	Bacteria	7205
154	Ga0207699_10031629	3300025906	Bacteria	2973
155	Ga0207684_10063168	3300025910	Bacteria	3144
156	Ga0207684_10311733	3300025910	Bacteria	1356
157	Ga0207654_10007628	3300025911	Bacteria	5454
158	Ga0207654_10013534	3300025911	Bacteria	4198
159	Ga0207707_10009976	3300025912	Bacteria	8236
160	Ga0207671_10020705	3300025914	Bacteria	5003
161	Ga0207671_10071699	3300025914	Bacteria	2584
162	Ga0207671_10180936	3300025914	Bacteria	1641
163	Ga0207693_10106162	3300025915	Bacteria	2203
164	Ga0207693_10192070	3300025915	Bacteria	1607
165	Ga0207663_10002335	3300025916	Bacteria	9110
166	Ga0207663_10061356	3300025916	Bacteria	2385
167	Ga0207662_10205616	3300025918	Bacteria	1276
168	Ga0207657_10206515	3300025919	Bacteria	1578
169	Ga0207657_10306759	3300025919	Bacteria	1257
170	Ga0207649_10138097	3300025920	Bacteria	1664
171	Ga0207646_10352628	3300025922	Bacteria	1330
172	Ga0207694_10110520	3300025924	Bacteria	2186
173	Ga0207694_10115596	3300025924	Bacteria	2138
174	Ga0207650_10024565	3300025925	Bacteria	4286
175	Ga0207659_10424257	3300025926	Bacteria	1116
176	Ga0207687_10030690	3300025927	Bacteria	3625
177	Ga0207700_10010361	3300025928	Bacteria	5877
178	Ga0207700_10012246	3300025928	Bacteria	5521
179	Ga0207664_10007776	3300025929	Bacteria	7444
180	Ga0207706_10057920	3300025933	Bacteria	3413
181	Ga0207686_10332745	3300025934	Bacteria	1138
182	Ga0207709_10047517	3300025935	Bacteria	2610
183	Ga0207670_10015098	3300025936	Unclassified	4605
184	Ga0207670_10307304	3300025936	Bacteria	1244
185	Ga0207665_10040333	3300025939	Bacteria	3114
186	Ga0207691_10218768	3300025940	Bacteria	1652
187	Ga0207679_10131072	3300025945	Unclassified	2011
188	Ga0207667_10183178	3300025949	Bacteria	2150
189	Ga0207651_10003945	3300025960	Bacteria	7366
190	Ga0207651_10235664	3300025960	Bacteria	1489
191	Ga0207668_10024090	3300025972	Bacteria	3923
192	Ga0207668_10057832	3300025972	Bacteria	2707
193	Ga0207658_10055002	3300025986	Bacteria	2947
194	Ga0207658_10278261	3300025986	Bacteria	1433
195	Ga0207677_10093490	3300026023	Bacteria	2192
196	Ga0207703_10019376	3300026035	Bacteria	5315
197	Ga0207703_10099049	3300026035	Bacteria	2467
198	Ga0207639_10019659	3300026041	Bacteria	4821
199	Ga0207639_10191728	3300026041	Bacteria	1746
200	Ga0207708_10039372	3300026075	Bacteria	3601
201	Ga0207708_10121565	3300026075	Bacteria	2035
202	Ga0207708_10297909	3300026075	Bacteria	1311
203	Ga0207702_10065561	3300026078	Bacteria	3111
204	Ga0207648_10047494	3300026089	Bacteria	3763
205	Ga0207676_10263971	3300026095	Bacteria	1556
206	Ga0207674_10000275	3300026116	Bacteria	64784
207	Ga0207674_10026008	3300026116	Bacteria	6228
208	Ga0207675_100213995	3300026118	Bacteria	1855
209	Ga0209589_1000018	3300027357	Bacteria	192614
210	Ga0209489_100026	3300027361	Bacteria	192614
211	Ga0209700_100035	3300027363	Bacteria	192614
212	Ga0209588_1000354	3300027671	Bacteria	11922
213	Ga0268266_10069038	3300028379	Bacteria	3061
214	Ga0268266_10176646	3300028379	Bacteria	1942
215	Ga0268266_10258191	3300028379	Bacteria	1614
216	Ga0268264_10000049	3300028381	Bacteria	329992
217	Ga0268264_10133876	3300028381	Bacteria	2201
218	Ga0268264_10171662	3300028381	Bacteria	1962
219	Ga0265334_10003251	3300028573	Bacteria	7418
220	Ga0307517_10218208	3300028786	Bacteria	1163
221	Ga0307515_10218182	3300028794	Bacteria	1733
222	Ga0265338_10019331	3300028800	Bacteria	7233
223	Ga0265332_10025140	3300031238	Bacteria	2617
224	Ga0265340_10025115	3300031247	Bacteria	3021
225	Ga0265340_10057000	3300031247	Bacteria	1878
226	Ga0307508_10000001	3300031616	Bacteria	553635
227	Ga0307516_10092330	3300031730	Bacteria	2854
228	Ga0307516_10099046	3300031730	Bacteria	2733
229	Ga0307416_100657185	3300032002	Bacteria	1134
230	Ga0373948_0022231	3300034817	Bacteria	1222
231	Ga0373929_0035001	3300035085	Bacteria	1092
232	Ga0373944_0007330	3300035089	Bacteria	2952
233	Ga0373923_0089716	3300035111	Bacteria	1343
234	Ga0373932_0028400	3300035112	Bacteria	1538
235	Ga0373939_0062855	3300035114	Bacteria	1188
236	Ga0373945_0065051	3300035116	Bacteria	1368
237	Ga0373954_0019140	3300035118	Bacteria	3086
238	Ga0373957_0041685	3300035120	Bacteria	1729
239	Ga0373960_0091838	3300035121	Bacteria	972
240	Ga0373946_0050731	3300035171	Bacteria	1734
241	Ga0373955_0143938	3300035172	Bacteria	1399
242	Ga0373942_0061945	3300035207	Bacteria	1074
243	Ga0373962_0025885	3300035242	Bacteria	1578
244	Ga0373931_0024746	3300035691	Bacteria	3044
245	Ga0373931_0196739	3300035691	Bacteria	1202
246	Ga0373935_0288407	3300035692	Bacteria	1157
247	Ga0373927_0003562	3300035695	Bacteria	11119
248	Ga0373927_0120583	3300035695	Bacteria	1712
249	Ga0373927_0346253	3300035695	Bacteria	979
250	Ga0373933_0036252	3300035724	Bacteria	2885
251	Ga0373947_0061612	3300035725	Bacteria	2280
252	Ga0373937_0064220	3300036401	Bacteria	3377
253	Ga0373937_0318859	3300036401	Bacteria	1470
254	Ga0373937_0667114	3300036401	Bacteria	986
255	Ga0373925_0015336	3300037068	Bacteria	5543
256	Ga0373925_0081019	3300037068	Bacteria	2468
257	Ga0373925_0461757	3300037068	Bacteria	1041
258	Ga0436365_0603453	3300039437	Bacteria	22491
259	Ga0436365_0915438	3300039437	Bacteria	3423
260	Ga0436365_1080221	3300039437	Bacteria	3172
261	Ga0436365_1440722	3300039437	Bacteria	5929
262	Ga0436360_0764361	3300039438	Bacteria	10077
263	Ga0436360_0889684	3300039438	Bacteria	2781
264	Ga0436361_1030330	3300039447	Bacteria	2234
265	Ga0451851_0938607	3300041507	Bacteria	1104
266	Ga0466963_0021312	3300044694	Bacteria	4086
267	Ga0466970_0026476	3300044765	Bacteria	3039
268	Ga0466957_0048714	3300044842	Bacteria	2575
269	Ga0466967_0067499	3300045976	Bacteria	3190
270	Ga0495592_0004608	3300046454	Bacteria	10094
271	Ga0495592_0013986	3300046454	Bacteria	6096
272	Ga0495603_0029094	3300046455	Bacteria	3332
273	Ga0495603_0137971	3300046455	Bacteria	1419
274	Ga0495590_0087698	3300046457	Bacteria	1099
275	Ga0495629_0168732	3300046459	Bacteria	1519
276	Ga0495651_0031950	3300046462	Bacteria	4105
277	Ga0495651_0083085	3300046462	Bacteria	2415
278	Ga0495653_0034170	3300046463	Bacteria	4024
279	Ga0495653_0184697	3300046463	Bacteria	1427
280	Ga0495650_0040736	3300046471	Bacteria	1991
281	Ga0495580_0102322	3300046472	Bacteria	1992
282	Ga0495582_0072752	3300046473	Bacteria	1902
283	Ga0495639_0312081	3300046475	Bacteria	785
284	Ga0495596_0036376	3300046500	Bacteria	1950
285	Ga0495583_0133259	3300046506	Bacteria	1038
286	Ga0495606_0011670	3300046507	Bacteria	7136
287	Ga0495608_0022672	3300046511	Bacteria	4306
288	Ga0495610_0058774	3300046512	Bacteria	1838
289	Ga0495616_0154829	3300046513	Bacteria	1034
290	Ga0495620_0078600	3300046515	Bacteria	1337
291	Ga0495628_0419116	3300046516	Bacteria	976
292	Ga0495630_0149892	3300046517	Bacteria	1774
293	Ga0495631_0026072	3300046518	Bacteria	2687
294	Ga0495663_0076526	3300046525	Bacteria	1072
295	Ga0495666_0121459	3300046526	Bacteria	1223
296	Ga0495642_0087619	3300046528	Bacteria	1315
297	Ga0495652_0042131	3300046529	Bacteria	3937
298	Ga0495654_0146543	3300046530	Bacteria	1047
299	Ga0495587_0007553	3300046536	Bacteria	7038
300	Ga0495587_0089536	3300046536	Bacteria	1778
301	Ga0495633_0088319	3300046558	Bacteria	1441
302	Ga0495667_0014242	3300046559	Bacteria	5371
303	Ga0495667_0045435	3300046559	Bacteria	2908
304	Ga0495656_0023187	3300046615	Bacteria	2440
305	Ga0495656_0155701	3300046615	Bacteria	1107
306	Ga0495668_0065267	3300046616	Bacteria	2004
307	Ga0495635_0000088	3300046663	Bacteria	54355
308	Ga0495635_0034107	3300046663	Bacteria	3531
309	Ga0495635_0318117	3300046663	Bacteria	1042
310	Ga0495659_0111509	3300046664	Unclassified	1069
311	Ga0495661_0079170	3300046665	Bacteria	1899
312	Ga0495657_0038472	3300046675	Bacteria	3291
313	Ga0495657_0120740	3300046675	Bacteria	1650
314	Ga0495599_0013740	3300046678	Bacteria	5007
315	Ga0495599_0037491	3300046678	Bacteria	3045
316	Ga0495623_0029338	3300046679	Bacteria	3539
317	Ga0495623_0130019	3300046679	Bacteria	1508
318	Ga0495646_0002491	3300046680	Bacteria	11308
319	Ga0495646_0084641	3300046680	Bacteria	1841
320	Ga0495647_0107437	3300046681	Bacteria	1161
321	Ga0495669_0001834	3300046684	Bacteria	8694
322	Ga0495613_0074467	3300046689	Bacteria	2472
323	Ga0495671_0085284	3300046692	Bacteria	1547
324	Ga0495649_0156522	3300046694	Bacteria	1195
325	Ga0495589_0260541	3300046794	Bacteria	809
326	Ga0495600_0018382	3300046809	Bacteria	4452
327	Ga0495600_0024667	3300046809	Bacteria	3871
328	Ga0495660_0151947	3300046810	Bacteria	1142
329	Ga0495604_0059745	3300047317	Bacteria	2921
330	Ga0495636_0106490	3300047318	Bacteria	1230
331	Ga0495674_0284811	3300047319	Bacteria	1353
332	Ga0495676_0125747	3300047321	Bacteria	1858
333	Ga0495680_0002817	3300047322	Bacteria	17493
334	Ga0495683_0196729	3300047323	Bacteria	911
335	Ga0495675_0020716	3300047444	Bacteria	4184
336	Ga0495677_0038751	3300047445	Bacteria	1741
337	Ga0495679_034791	3300047446	Bacteria	1601
338	Ga0495685_087124	3300047447	Bacteria	1036
339	Ga0495684_0002666	3300047471	Bacteria	14140
340	Ga0495684_0064192	3300047471	Bacteria	2790
341	Ga0495686_0004747	3300047472	Bacteria	10995
342	Ga0495593_0034978	3300047673	Bacteria	2729
343	Ga0495602_0071799	3300048088	Bacteria	2955
344	Ga0495626_0129522	3300048091	Bacteria	1078
345	Ga0496101_0404958	3300048904	Bacteria	1074
346	Ga0496102_0069029	3300048905	Bacteria	3244
347	Ga0496102_0119747	3300048905	Bacteria	2458
348	Ga0496103_0064687	3300048906	Bacteria	2280
349	Ga0496103_0118070	3300048906	Bacteria	1689
350	Ga0496104_0036592	3300048907	Bacteria	4590
351	Ga0496104_0038996	3300048907	Bacteria	4446
352	Ga0496105_0030243	3300048908	Bacteria	4438
353	Ga0496106_0196167	3300048909	Bacteria	1606
354	Ga0496106_0396319	3300048909	Bacteria	1109
355	Ga0496107_0176882	3300048910	Bacteria	1584
356	Ga0496107_0290865	3300048910	Bacteria	1216
357	Ga0496107_0490343	3300048910	Bacteria	911
358	Ga0496108_0020878	3300048911	Bacteria	5386
359	Ga0496108_0487264	3300048911	Bacteria	1077
360	Ga0496109_0234952	3300048912	Bacteria	1725
361	Ga0496110_0112701	3300048913	Bacteria	2445
362	Ga0496111_0286696	3300048914	Bacteria	1221
363	Ga0496112_0052506	3300048915	Bacteria	4000
364	Ga0496112_0151095	3300048915	Bacteria	2289
365	Ga0496112_0194162	3300048915	Bacteria	1991
366	Ga0496113_0115939	3300048916	Bacteria	2090
367	Ga0496114_0060741	3300048917	Bacteria	3159
368	Ga0496115_0059007	3300048918	Bacteria	3089
369	Ga0496116_0098485	3300048919	Bacteria	1754
370	Ga0496120_0023117	3300048923	Bacteria	3896
371	Ga0496121_0082349	3300048924	Bacteria	2544
372	Ga0496121_0172149	3300048924	Bacteria	1571
373	Ga0496124_0177364	3300048927	Bacteria	1643
374	Ga0496125_0077331	3300048928	Bacteria	2566
375	Ga0496126_0014034	3300048929	Bacteria	8117
376	Ga0496126_0033620	3300048929	Bacteria	4822
377	Ga0501034_0554673	3300049571	Bacteria	1058
378	Ga0501043_0181284	3300049579	Bacteria	1641
379	nmdc:mga00v17_8809_c2	3300050491	Bacteria	3240
380	nmdc:mga0yw44_149269_c1	3300050492	Bacteria	1524
381	nmdc:mga0yw44_94541_c1	3300050492	Bacteria	1895
382	nmdc:mga0k408_101640_c1	3300050493	Bacteria	1695
383	nmdc:mga06z11_26903_c1	3300050494	Bacteria	2744
384	nmdc:mga07m45_12512_c1	3300050496	Bacteria	4486
385	nmdc:mga07m45_16626_c1	3300050496	Unclassified	3939
386	nmdc:mga09592_85259_c1	3300050508	Bacteria	2695
387	nmdc:mga06r32_104768_c1	3300050510	Bacteria	2778
388	nmdc:mga0n895_123098_c1	3300050512	Bacteria	2615
389	nmdc:mga0n895_235264_c1	3300050512	Bacteria	1859
390	nmdc:mga0rr50_269709_c1	3300050513	Bacteria	1418
391	nmdc:mga08x19_241822_c1	3300050514	Bacteria	1244
392	nmdc:mga0a205_132225_c1	3300050515	Bacteria	2396
393	nmdc:mga0sz30_86139_c1	3300050516	Bacteria	1364
394	Ga0495601_0145434	3300053077	Bacteria	1547
395	Ga0495595_0126053	3300053084	Bacteria	1249
396	Ga0495595_0175728	3300053084	Bacteria	1061
397	Ga0495619_0000879	3300053085	Bacteria	19742
398	Ga0495619_0020861	3300053085	Bacteria	4178
399	Ga0500581_087657	3300053089	Bacteria	1546
400	Ga0500647_0061221	3300053091	Bacteria	1812
401	Ga0500641_0001149	3300053096	Bacteria	9411
402	Ga0500641_0126416	3300053096	Bacteria	1103
403	Ga0500648_036002	3300053097	Bacteria	2802
404	Ga0500555_051120	3300053103	Bacteria	1131
405	Ga0500592_018244	3300053116	Bacteria	1127
406	Ga0500658_0034760	3300053134	Bacteria	1992
407	Ga0500658_0043884	3300053134	Bacteria	1801
408	Ga0500616_0068242	3300053153	Bacteria	1822
409	Ga0500622_0124237	3300053156	Bacteria	1248
410	Ga0500634_0082821	3300053161	Bacteria	1648
411	Ga0500638_125703	3300053162	Bacteria	1168
412	Ga0500639_119635	3300053163	Bacteria	1267
413	Ga0500637_0122847	3300053178	Bacteria	1506
414	Ga0500609_010598	3300053731	Bacteria	1242
415	Ga0500596_008262	3300053735	Bacteria	1666
416	Ga0500661_007016	3300055283	Bacteria	2090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025916	Ga0207663_10061356	Ga0207663_100613564	226
2	3300005439	Ga0070711_100551067	Ga0070711_1005510671	235
3	3300046475	Ga0495639_0312081	Ga0495639_0312081_13_765	249
4	3300046794	Ga0495589_0260541	Ga0495589_0260541_39_791	249
5	3300050514	nmdc:mga08x19_241822_c1	nmdc:mga08x19_241822_c1_11_763	249
6	3300039438	Ga0436360_0889684	Ga0436360_0889684_1258_2058	251
7	3300014325	Ga0163163_10543874	Ga0163163_105438742	260
8	3300009147	Ga0114129_10140587	Ga0114129_101405871	263
9	3300035085	Ga0373929_0035001	Ga0373929_0035001_194_991	263
10	3300035112	Ga0373932_0028400	Ga0373932_0028400_209_1006	263
11	3300035242	Ga0373962_0025885	Ga0373962_0025885_117_914	263
12	3300035691	Ga0373931_0024746	Ga0373931_0024746_1166_1963	263
13	3300035692	Ga0373935_0288407	Ga0373935_0288407_95_892	263
14	3300035695	Ga0373927_0346253	Ga0373927_0346253_107_904	263
15	3300048904	Ga0496101_0404958	Ga0496101_0404958_72_869	263
16	3300048905	Ga0496102_0069029	Ga0496102_0069029_435_1232	263
17	3300048906	Ga0496103_0064687	Ga0496103_0064687_1367_2164	263
18	3300048907	Ga0496104_0038996	Ga0496104_0038996_3488_4285	263
19	3300048908	Ga0496105_0030243	Ga0496105_0030243_1935_2732	263
20	3300048909	Ga0496106_0396319	Ga0496106_0396319_161_958	263
21	3300048910	Ga0496107_0490343	Ga0496107_0490343_73_870	263
22	3300048911	Ga0496108_0487264	Ga0496108_0487264_89_886	263
23	3300048912	Ga0496109_0234952	Ga0496109_0234952_449_1246	263
24	3300048913	Ga0496110_0112701	Ga0496110_0112701_372_1169	263
25	3300048915	Ga0496112_0052506	Ga0496112_0052506_3061_3858	263
26	3300048917	Ga0496114_0060741	Ga0496114_0060741_2292_3089	263
27	3300005618	Ga0068864_100129160	Ga0068864_1001291601	265
28	3300005841	Ga0068863_100395324	Ga0068863_1003953241	265
29	3300009177	Ga0105248_10101722	Ga0105248_101017222	265
30	3300009545	Ga0105237_10319724	Ga0105237_103197241	265
31	3300013306	Ga0163162_10079045	Ga0163162_100790456	265
32	3300036401	Ga0373937_0667114	Ga0373937_0667114_41_877	265
33	3300049579	Ga0501043_0181284	Ga0501043_0181284_325_1167	265
34	3300010159	Ga0099796_10017496	Ga0099796_100174962	266
35	3300005842	Ga0068858_100224365	Ga0068858_1002243652	267
36	3300006038	Ga0075365_10006833	Ga0075365_100068335	267
37	3300006051	Ga0075364_10025968	Ga0075364_100259682	267
38	3300009174	Ga0105241_10016468	Ga0105241_100164683	267
39	3300014968	Ga0157379_10003593	Ga0157379_1000359311	267
40	3300025911	Ga0207654_10007628	Ga0207654_100076284	267
41	3300026035	Ga0207703_10019376	Ga0207703_100193765	267
42	3300046507	Ga0495606_0011670	Ga0495606_0011670_5188_6060	267
43	3300047472	Ga0495686_0004747	Ga0495686_0004747_9881_10753	267
44	3300050491	nmdc:mga00v17_8809_c2	nmdc:mga00v17_8809_c2_606_1466	267
45	3300050492	nmdc:mga0yw44_149269_c1	nmdc:mga0yw44_149269_c1_238_1098	267
46	3300053153	Ga0500616_0068242	Ga0500616_0068242_239_1111	267
47	3300005937	Ga0081455_10007709	Ga0081455_100077098	268
48	3300005983	Ga0081540_1006841	Ga0081540_10068418	268
49	3300006038	Ga0075365_10073891	Ga0075365_100738913	268
50	3300044765	Ga0466970_0026476	Ga0466970_0026476_66_920	268
51	3300048924	Ga0496121_0082349	Ga0496121_0082349_577_1431	268
52	3300005434	Ga0070709_10108756	Ga0070709_101087561	269
53	3300005435	Ga0070714_100010468	Ga0070714_1000104684	269
54	3300005436	Ga0070713_100027234	Ga0070713_1000272344	269
55	3300005549	Ga0070704_100611005	Ga0070704_1006110051	269
56	3300005618	Ga0068864_100216448	Ga0068864_1002164482	269
57	3300006852	Ga0075433_10116682	Ga0075433_101166822	269
58	3300025928	Ga0207700_10012246	Ga0207700_100122462	269
59	3300026095	Ga0207676_10263971	Ga0207676_102639712	269
60	3300039437	Ga0436365_0603453	Ga0436365_0603453_4827_5681	269
61	3300046454	Ga0495592_0004608	Ga0495592_0004608_2052_2891	269
62	3300050510	nmdc:mga06r32_104768_c1	nmdc:mga06r32_104768_c1_1583_2419	269
63	3300050515	nmdc:mga0a205_132225_c1	nmdc:mga0a205_132225_c1_573_1409	269
64	3300003659	JGI25404J52841_10000392	JGI25404J52841_100003928	270
65	3300003762	Ga0055542_1013423	Ga0055542_10134232	270
66	3300005937	Ga0081455_10058341	Ga0081455_100583414	270
67	3300006942	Ga0099824_1013423	Ga0099824_10134238	270
68	3300009174	Ga0105241_10006288	Ga0105241_100062886	270
69	3300025254	Ga0209148_1001232	Ga0209148_10012329	270
70	3300025261	Ga0209233_1011887	Ga0209233_10118871	270
71	3300025272	Ga0209455_1005364	Ga0209455_10053642	270
72	3300027357	Ga0209589_1000018	Ga0209589_1000018119	270
73	3300027361	Ga0209489_100026	Ga0209489_100026119	270
74	3300027363	Ga0209700_100035	Ga0209700_100035119	270
75	3300044694	Ga0466963_0021312	Ga0466963_0021312_2548_3402	270
76	3300044842	Ga0466957_0048714	Ga0466957_0048714_1628_2482	270
77	3300045976	Ga0466967_0067499	Ga0466967_0067499_1170_2024	270
78	3300046810	Ga0495660_0151947	Ga0495660_0151947_173_1027	270
79	3300005983	Ga0081540_1063089	Ga0081540_10630892	271
80	3300006844	Ga0075428_100145557	Ga0075428_1001455572	271
81	3300009101	Ga0105247_10006140	Ga0105247_100061403	271
82	3300013307	Ga0157372_10012864	Ga0157372_100128642	271
83	3300025297	Ga0209758_1000650	Ga0209758_100065013	271
84	3300025900	Ga0207710_10009527	Ga0207710_100095273	271
85	3300025914	Ga0207671_10071699	Ga0207671_100716992	271
86	3300031616	Ga0307508_10000001	Ga0307508_10000001253	271
87	3300005364	Ga0070673_100423715	Ga0070673_1004237152	272
88	3300005843	Ga0068860_100043887	Ga0068860_1000438872	272
89	3300005937	Ga0081455_10000197	Ga0081455_1000019757	272
90	3300006028	Ga0070717_10475781	Ga0070717_104757811	272
91	3300006175	Ga0070712_100364094	Ga0070712_1003640942	272
92	3300006844	Ga0075428_100399384	Ga0075428_1003993842	272
93	3300006847	Ga0075431_100146950	Ga0075431_1001469502	272
94	3300006871	Ga0075434_100503901	Ga0075434_1005039012	272
95	3300006880	Ga0075429_100229395	Ga0075429_1002293952	272
96	3300006881	Ga0068865_100001260	Ga0068865_1000012604	272
97	3300009101	Ga0105247_10018692	Ga0105247_100186922	272
98	3300009147	Ga0114129_10267605	Ga0114129_102676052	272
99	3300010159	Ga0099796_10111979	Ga0099796_101119791	272
100	3300021320	Ga0214544_1014616	Ga0214544_10146168	272
101	3300021320	Ga0214544_1017506	Ga0214544_10175066	272
102	3300021321	Ga0214542_1010780	Ga0214542_101078010	272
103	3300021321	Ga0214542_1014611	Ga0214542_10146118	272
104	3300021324	Ga0214545_1000519	Ga0214545_100051953	272
105	3300021327	Ga0214543_1017766	Ga0214543_10177664	272
106	3300021358	Ga0213873_10015751	Ga0213873_100157512	272
107	3300025899	Ga0207642_10101917	Ga0207642_101019171	272
108	3300025912	Ga0207707_10009976	Ga0207707_100099762	272
109	3300025972	Ga0207668_10057832	Ga0207668_100578323	272
110	3300026075	Ga0207708_10039372	Ga0207708_100393723	272
111	3300027671	Ga0209588_1000354	Ga0209588_10003548	272
112	3300028381	Ga0268264_10000049	Ga0268264_10000049195	272
113	3300028381	Ga0268264_10171662	Ga0268264_101716622	272
114	3300028573	Ga0265334_10003251	Ga0265334_100032512	272
115	3300031238	Ga0265332_10025140	Ga0265332_100251403	272
116	3300031730	Ga0307516_10092330	Ga0307516_100923303	272
117	3300031730	Ga0307516_10099046	Ga0307516_100990464	272
118	3300035089	Ga0373944_0007330	Ga0373944_0007330_1444_2292	272
119	3300035118	Ga0373954_0019140	Ga0373954_0019140_1400_2248	272
120	3300035171	Ga0373946_0050731	Ga0373946_0050731_690_1544	272
121	3300035725	Ga0373947_0061612	Ga0373947_0061612_494_1342	272
122	3300039437	Ga0436365_1080221	Ga0436365_1080221_1716_2582	272
123	3300039437	Ga0436365_1440722	Ga0436365_1440722_4236_5093	272
124	3300046462	Ga0495651_0083085	Ga0495651_0083085_449_1297	272
125	3300046463	Ga0495653_0034170	Ga0495653_0034170_1761_2609	272
126	3300046536	Ga0495587_0089536	Ga0495587_0089536_215_1063	272
127	3300046558	Ga0495633_0088319	Ga0495633_0088319_359_1213	272
128	3300046559	Ga0495667_0014242	Ga0495667_0014242_2926_3774	272
129	3300046663	Ga0495635_0000088	Ga0495635_0000088_2912_3760	272
130	3300046664	Ga0495659_0111509	Ga0495659_0111509_137_982	272
131	3300046675	Ga0495657_0120740	Ga0495657_0120740_716_1564	272
132	3300046678	Ga0495599_0013740	Ga0495599_0013740_3279_4127	272
133	3300046679	Ga0495623_0029338	Ga0495623_0029338_1584_2432	272
134	3300046680	Ga0495646_0002491	Ga0495646_0002491_9103_9951	272
135	3300046809	Ga0495600_0024667	Ga0495600_0024667_1319_2167	272
136	3300047318	Ga0495636_0106490	Ga0495636_0106490_163_1011	272
137	3300047319	Ga0495674_0284811	Ga0495674_0284811_81_938	272
138	3300047471	Ga0495684_0002666	Ga0495684_0002666_7787_8635	272
139	3300048924	Ga0496121_0172149	Ga0496121_0172149_693_1541	272
140	3300048927	Ga0496124_0177364	Ga0496124_0177364_680_1528	272
141	3300048929	Ga0496126_0033620	Ga0496126_0033620_3385_4233	272
142	3300050496	nmdc:mga07m45_16626_c1	nmdc:mga07m45_16626_c1_2921_3766	272
143	3300050508	nmdc:mga09592_85259_c1	nmdc:mga09592_85259_c1_1288_2133	272
144	3300053085	Ga0495619_0000879	Ga0495619_0000879_16968_17816	272
145	3300053091	Ga0500647_0061221	Ga0500647_0061221_748_1602	272
146	3300053097	Ga0500648_036002	Ga0500648_036002_1525_2379	272
147	3300053162	Ga0500638_125703	Ga0500638_125703_196_1050	272
148	3300053163	Ga0500639_119635	Ga0500639_119635_383_1237	272
149	3300053178	Ga0500637_0122847	Ga0500637_0122847_310_1164	272
150	3300053735	Ga0500596_008262	Ga0500596_008262_359_1213	272
151	3300005341	Ga0070691_10000188	Ga0070691_100001886	273
152	3300005341	Ga0070691_10095353	Ga0070691_100953532	273
153	3300005435	Ga0070714_100105974	Ga0070714_1001059742	273
154	3300005535	Ga0070684_100133906	Ga0070684_1001339062	273
155	3300005539	Ga0068853_100204202	Ga0068853_1002042022	273
156	3300005545	Ga0070695_100064091	Ga0070695_1000640912	273
157	3300005546	Ga0070696_100336653	Ga0070696_1003366531	273
158	3300005547	Ga0070693_100031355	Ga0070693_1000313552	273
159	3300005548	Ga0070665_100079098	Ga0070665_1000790982	273
160	3300005563	Ga0068855_100144131	Ga0068855_1001441312	273
161	3300005577	Ga0068857_100001469	Ga0068857_10000146911	273
162	3300005614	Ga0068856_100004172	Ga0068856_1000041723	273
163	3300005616	Ga0068852_100030637	Ga0068852_1000306372	273
164	3300005618	Ga0068864_100065372	Ga0068864_1000653723	273
165	3300005842	Ga0068858_100091538	Ga0068858_1000915381	273
166	3300005842	Ga0068858_100161229	Ga0068858_1001612292	273
167	3300005842	Ga0068858_100210515	Ga0068858_1002105152	273
168	3300006195	Ga0075366_10104445	Ga0075366_101044451	273
169	3300006914	Ga0075436_100158103	Ga0075436_1001581032	273
170	3300007076	Ga0075435_100085648	Ga0075435_1000856482	273
171	3300007076	Ga0075435_100392009	Ga0075435_1003920091	273
172	3300009093	Ga0105240_10020454	Ga0105240_100204542	273
173	3300009093	Ga0105240_10269715	Ga0105240_102697152	273
174	3300009093	Ga0105240_10324306	Ga0105240_103243062	273
175	3300009174	Ga0105241_10049746	Ga0105241_100497462	273
176	3300009177	Ga0105248_10109258	Ga0105248_101092583	273
177	3300009545	Ga0105237_10148265	Ga0105237_101482652	273
178	3300009551	Ga0105238_10001095	Ga0105238_100010959	273
179	3300010375	Ga0105239_10002944	Ga0105239_1000294416	273
180	3300011119	Ga0105246_10019783	Ga0105246_100197831	273
181	3300013102	Ga0157371_10270656	Ga0157371_102706561	273
182	3300013104	Ga0157370_10001547	Ga0157370_1000154710	273
183	3300014968	Ga0157379_10003995	Ga0157379_100039955	273
184	3300014968	Ga0157379_10019701	Ga0157379_100197017	273
185	3300014969	Ga0157376_10017084	Ga0157376_100170845	273
186	3300017792	Ga0163161_10049643	Ga0163161_100496431	273
187	3300025885	Ga0207653_10010010	Ga0207653_100100103	273
188	3300025901	Ga0207688_10016568	Ga0207688_100165682	273
189	3300025911	Ga0207654_10013534	Ga0207654_100135344	273
190	3300025914	Ga0207671_10020705	Ga0207671_100207054	273
191	3300025914	Ga0207671_10180936	Ga0207671_101809362	273
192	3300025924	Ga0207694_10110520	Ga0207694_101105201	273
193	3300025924	Ga0207694_10115596	Ga0207694_101155962	273
194	3300025927	Ga0207687_10030690	Ga0207687_100306902	273
195	3300025949	Ga0207667_10183178	Ga0207667_101831782	273
196	3300025960	Ga0207651_10235664	Ga0207651_102356642	273
197	3300026023	Ga0207677_10093490	Ga0207677_100934902	273
198	3300026035	Ga0207703_10099049	Ga0207703_100990496	273
199	3300026041	Ga0207639_10019659	Ga0207639_100196592	273
200	3300026041	Ga0207639_10191728	Ga0207639_101917282	273
201	3300026078	Ga0207702_10065561	Ga0207702_100655611	273
202	3300026116	Ga0207674_10000275	Ga0207674_1000027561	273
203	3300026116	Ga0207674_10026008	Ga0207674_100260084	273
204	3300026118	Ga0207675_100213995	Ga0207675_1002139953	273
205	3300028379	Ga0268266_10069038	Ga0268266_100690382	273
206	3300028381	Ga0268264_10133876	Ga0268264_101338762	273
207	3300035207	Ga0373942_0061945	Ga0373942_0061945_74_928	273
208	3300035695	Ga0373927_0120583	Ga0373927_0120583_378_1229	273
209	3300037068	Ga0373925_0461757	Ga0373925_0461757_148_999	273
210	3300041507	Ga0451851_0938607	Ga0451851_0938607_148_999	273
211	3300046472	Ga0495580_0102322	Ga0495580_0102322_333_1184	273
212	3300048928	Ga0496125_0077331	Ga0496125_0077331_606_1460	273
213	3300049571	Ga0501034_0554673	Ga0501034_0554673_177_1025	273
214	3300050494	nmdc:mga06z11_26903_c1	nmdc:mga06z11_26903_c1_1075_1929	273
215	3300050512	nmdc:mga0n895_123098_c1	nmdc:mga0n895_123098_c1_871_1725	273
216	3300050513	nmdc:mga0rr50_269709_c1	nmdc:mga0rr50_269709_c1_408_1262	273
217	3300050516	nmdc:mga0sz30_86139_c1	nmdc:mga0sz30_86139_c1_461_1315	273
218	3300005345	Ga0070692_10198430	Ga0070692_101984301	274
219	3300005440	Ga0070705_100078773	Ga0070705_1000787732	274
220	3300005445	Ga0070708_100422166	Ga0070708_1004221661	274
221	3300005458	Ga0070681_10182052	Ga0070681_101820522	274
222	3300005543	Ga0070672_100194760	Ga0070672_1001947602	274
223	3300005544	Ga0070686_100263362	Ga0070686_1002633621	274
224	3300005546	Ga0070696_100163246	Ga0070696_1001632463	274
225	3300005983	Ga0081540_1115471	Ga0081540_11154712	274
226	3300013306	Ga0163162_10175434	Ga0163162_101754342	274
227	3300025315	Ga0207697_10018357	Ga0207697_100183571	274
228	3300025910	Ga0207684_10063168	Ga0207684_100631681	274
229	3300025915	Ga0207693_10192070	Ga0207693_101920702	274
230	3300025918	Ga0207662_10205616	Ga0207662_102056161	274
231	3300025919	Ga0207657_10306759	Ga0207657_103067591	274
232	3300025926	Ga0207659_10424257	Ga0207659_104242571	274
233	3300025934	Ga0207686_10332745	Ga0207686_103327451	274
234	3300025935	Ga0207709_10047517	Ga0207709_100475171	274
235	3300025940	Ga0207691_10218768	Ga0207691_102187681	274
236	3300025972	Ga0207668_10024090	Ga0207668_100240901	274
237	3300025986	Ga0207658_10278261	Ga0207658_102782611	274
238	3300026075	Ga0207708_10297909	Ga0207708_102979091	274
239	3300026089	Ga0207648_10047494	Ga0207648_100474944	274
240	3300028786	Ga0307517_10218208	Ga0307517_102182081	274
241	3300028794	Ga0307515_10218182	Ga0307515_102181822	274
242	3300031247	Ga0265340_10025115	Ga0265340_100251153	274
243	3300031247	Ga0265340_10057000	Ga0265340_100570003	274
244	3300034817	Ga0373948_0022231	Ga0373948_0022231_150_1004	274
245	3300035114	Ga0373939_0062855	Ga0373939_0062855_175_1029	274
246	3300035116	Ga0373945_0065051	Ga0373945_0065051_414_1268	274
247	3300035121	Ga0373960_0091838	Ga0373960_0091838_98_952	274
248	3300035695	Ga0373927_0003562	Ga0373927_0003562_1990_2844	274
249	3300037068	Ga0373925_0015336	Ga0373925_0015336_4553_5407	274
250	3300046455	Ga0495603_0029094	Ga0495603_0029094_2297_3151	274
251	3300046457	Ga0495590_0087698	Ga0495590_0087698_31_885	274
252	3300046471	Ga0495650_0040736	Ga0495650_0040736_53_907	274
253	3300046473	Ga0495582_0072752	Ga0495582_0072752_794_1648	274
254	3300046500	Ga0495596_0036376	Ga0495596_0036376_919_1773	274
255	3300046506	Ga0495583_0133259	Ga0495583_0133259_119_973	274
256	3300046512	Ga0495610_0058774	Ga0495610_0058774_961_1815	274
257	3300046513	Ga0495616_0154829	Ga0495616_0154829_156_1010	274
258	3300046515	Ga0495620_0078600	Ga0495620_0078600_406_1260	274
259	3300046517	Ga0495630_0149892	Ga0495630_0149892_78_932	274
260	3300046518	Ga0495631_0026072	Ga0495631_0026072_97_951	274
261	3300046525	Ga0495663_0076526	Ga0495663_0076526_14_868	274
262	3300046526	Ga0495666_0121459	Ga0495666_0121459_214_1068	274
263	3300046528	Ga0495642_0087619	Ga0495642_0087619_106_960	274
264	3300046530	Ga0495654_0146543	Ga0495654_0146543_73_927	274
265	3300046665	Ga0495661_0079170	Ga0495661_0079170_82_936	274
266	3300046681	Ga0495647_0107437	Ga0495647_0107437_61_915	274
267	3300046684	Ga0495669_0001834	Ga0495669_0001834_65_919	274
268	3300046692	Ga0495671_0085284	Ga0495671_0085284_109_963	274
269	3300046694	Ga0495649_0156522	Ga0495649_0156522_290_1144	274
270	3300047321	Ga0495676_0125747	Ga0495676_0125747_116_970	274
271	3300047323	Ga0495683_0196729	Ga0495683_0196729_65_889	274
272	3300047445	Ga0495677_0038751	Ga0495677_0038751_217_1071	274
273	3300047446	Ga0495679_034791	Ga0495679_034791_326_1180	274
274	3300047447	Ga0495685_087124	Ga0495685_087124_25_879	274
275	3300048091	Ga0495626_0129522	Ga0495626_0129522_188_1042	274
276	3300048910	Ga0496107_0176882	Ga0496107_0176882_236_1090	274
277	3300048914	Ga0496111_0286696	Ga0496111_0286696_314_1162	274
278	3300048919	Ga0496116_0098485	Ga0496116_0098485_283_1131	274
279	3300048923	Ga0496120_0023117	Ga0496120_0023117_252_1106	274
280	3300048929	Ga0496126_0014034	Ga0496126_0014034_252_1106	274
281	3300053089	Ga0500581_087657	Ga0500581_087657_371_1225	274
282	3300053096	Ga0500641_0126416	Ga0500641_0126416_50_904	274
283	3300053103	Ga0500555_051120	Ga0500555_051120_97_951	274
284	3300053116	Ga0500592_018244	Ga0500592_018244_220_1074	274
285	3300053134	Ga0500658_0043884	Ga0500658_0043884_37_891	274
286	3300053156	Ga0500622_0124237	Ga0500622_0124237_201_1055	274
287	3300053161	Ga0500634_0082821	Ga0500634_0082821_41_895	274
288	3300053731	Ga0500609_010598	Ga0500609_010598_100_954	274
289	3300005434	Ga0070709_10002131	Ga0070709_100021312	275
290	3300005437	Ga0070710_10001373	Ga0070710_100013737	275
291	3300005439	Ga0070711_100001786	Ga0070711_1000017866	275
292	3300006173	Ga0070716_100003956	Ga0070716_1000039564	275
293	3300025898	Ga0207692_10001280	Ga0207692_100012808	275
294	3300025906	Ga0207699_10031629	Ga0207699_100316294	275
295	3300025916	Ga0207663_10002335	Ga0207663_100023356	275
296	3300025928	Ga0207700_10010361	Ga0207700_100103613	275
297	3300025929	Ga0207664_10007776	Ga0207664_100077764	275
298	3300025939	Ga0207665_10040333	Ga0207665_100403334	275
299	3300046615	Ga0495656_0023187	Ga0495656_0023187_182_1036	275
300	3300050493	nmdc:mga0k408_101640_c1	nmdc:mga0k408_101640_c1_610_1458	275
301	3300037068	Ga0373925_0081019	Ga0373925_0081019_964_1803	278
302	iso_pu_bacteria	2513237141	2513891161	278
303	iso_pu_bacteria	2528768022	2528856143	278
304	iso_pu_bacteria	2791355197	2793070758	278
305	iso_pu_bacteria	2824626560	2824628076	278
306	iso_pu_bacteria	2824635225	2824637498	278
307	iso_pu_bacteria	2824644064	2824645401	278
308	iso_pu_bacteria	2824714736	2824715621	278
309	iso_pu_bacteria	2824723954	2824725039	278
310	iso_pu_bacteria	2879099564	2879100701	278
311	iso_pu_bacteria	2885374607	2885377914	278
312	iso_pu_bacteria	2903748898	2903753258	278
313	iso_pu_bacteria	2904690495	2904694626	278
314	iso_pu_bacteria	2906610324	2906617169	278
315	iso_pu_bacteria	2906635258	2906635768	278
316	iso_pu_bacteria	2908756301	2908760181	278
317	iso_pu_bacteria	2908775508	2908778394	278
318	iso_pu_bacteria	2922425934	2922430666	278
319	iso_pu_bacteria	2929615660	2929615714	278
320	iso_pu_bacteria	2929624759	2929630329	278
321	iso_pu_bacteria	2932784394	2932791843	278
322	iso_pu_bacteria	2932809354	2932815584	278
323	iso_pu_bacteria	2932818245	2932819345	278
324	iso_pu_bacteria	2932828146	2932836033	278
325	iso_pu_bacteria	2933577622	2933578999	278
326	iso_pu_bacteria	2935638405	2935647783	278
327	iso_pu_bacteria	2935665750	2935674806	278
328	iso_pu_bacteria	2935694250	2935698874	278
329	iso_pu_bacteria	2935703347	2935708492	278
330	iso_pu_bacteria	2935760218	2935768310	278
331	iso_pu_bacteria	2935801545	2935809322	278
332	iso_pu_bacteria	2935810662	2935819462	278
333	iso_pu_bacteria	2935827899	2935837267	278
334	iso_pu_bacteria	2935864058	2935871681	278
335	iso_pu_bacteria	2935873716	2935881952	278
336	iso_pu_bacteria	2935992306	2935998779	278
337	iso_pu_bacteria	2936002035	2936007338	278
338	iso_pu_bacteria	2936037263	2936046307	278
339	iso_pu_bacteria	3005594810	3005596402	278
340	iso_pu_bacteria	3005718088	3005719547	278
341	iso_pu_bacteria	8016511872	8016514481	278
342	iso_pu_bacteria	8017057580	8017061944	278
343	iso_pu_bacteria	8019576017	8019581479	278
344	iso_pu_bacteria	8019586578	8019589107	278
345	iso_pu_bacteria	8019597564	8019602125	278
346	iso_pu_bacteria	8019608314	8019616432	278
347	iso_pu_bacteria	8055742211	8055747362	278
348	iso_pu_bacteria	8056689827	8056692863	278
349	3300028800	Ga0265338_10019331	Ga0265338_100193312	279
350	3300053077	Ga0495601_0145434	Ga0495601_0145434_80_922	279
351	3300006173	Ga0070716_100235235	Ga0070716_1002352351	280
352	3300009177	Ga0105248_10127309	Ga0105248_101273092	280
353	3300025936	Ga0207670_10307304	Ga0207670_103073041	280
354	3300039447	Ga0436361_1030330	Ga0436361_1030330_158_1003	280
355	iso_pu_bacteria	3005474847	3005477738	280
356	3300005335	Ga0070666_10001509	Ga0070666_1000150914	281
357	3300005340	Ga0070689_100275770	Ga0070689_1002757701	281
358	3300005364	Ga0070673_100004906	Ga0070673_1000049062	281
359	3300005365	Ga0070688_100028944	Ga0070688_1000289442	281
360	3300005367	Ga0070667_100012814	Ga0070667_1000128146	281
361	3300005455	Ga0070663_100360655	Ga0070663_1003606551	281
362	3300005457	Ga0070662_100107492	Ga0070662_1001074922	281
363	3300005535	Ga0070684_100219682	Ga0070684_1002196822	281
364	3300005539	Ga0068853_100297112	Ga0068853_1002971121	281
365	3300005543	Ga0070672_100029769	Ga0070672_1000297693	281
366	3300005563	Ga0068855_100360782	Ga0068855_1003607821	281
367	3300005842	Ga0068858_100137625	Ga0068858_1001376252	281
368	3300006028	Ga0070717_10044712	Ga0070717_100447124	281
369	3300006175	Ga0070712_100256136	Ga0070712_1002561361	281
370	3300010375	Ga0105239_10085832	Ga0105239_100858324	281
371	3300011119	Ga0105246_10200433	Ga0105246_102004331	281
372	3300013296	Ga0157374_10209834	Ga0157374_102098342	281
373	3300013306	Ga0163162_10052617	Ga0163162_100526171	281
374	3300013308	Ga0157375_11112302	Ga0157375_111123021	281
375	3300014968	Ga0157379_10030167	Ga0157379_100301672	281
376	3300014969	Ga0157376_10102466	Ga0157376_101024662	281
377	3300021384	Ga0213876_10009960	Ga0213876_100099607	281
378	3300025903	Ga0207680_10003678	Ga0207680_100036782	281
379	3300025915	Ga0207693_10106162	Ga0207693_101061621	281
380	3300025919	Ga0207657_10206515	Ga0207657_102065152	281
381	3300025920	Ga0207649_10138097	Ga0207649_101380972	281
382	3300025925	Ga0207650_10024565	Ga0207650_100245653	281
383	3300025933	Ga0207706_10057920	Ga0207706_100579203	281
384	3300025936	Ga0207670_10015098	Ga0207670_100150984	281
385	3300025945	Ga0207679_10131072	Ga0207679_101310722	281
386	3300025960	Ga0207651_10003945	Ga0207651_100039453	281
387	3300025986	Ga0207658_10055002	Ga0207658_100550024	281
388	3300026075	Ga0207708_10121565	Ga0207708_101215652	281
389	3300028379	Ga0268266_10176646	Ga0268266_101766462	281
390	3300035111	Ga0373923_0089716	Ga0373923_0089716_212_1063	281
391	3300035120	Ga0373957_0041685	Ga0373957_0041685_110_1006	281
392	3300035172	Ga0373955_0143938	Ga0373955_0143938_287_1183	281
393	3300035724	Ga0373933_0036252	Ga0373933_0036252_1789_2685	281
394	3300036401	Ga0373937_0064220	Ga0373937_0064220_542_1396	281
395	3300036401	Ga0373937_0318859	Ga0373937_0318859_389_1285	281
396	3300039437	Ga0436365_0915438	Ga0436365_0915438_386_1357	281
397	3300046454	Ga0495592_0013986	Ga0495592_0013986_4880_5776	281
398	3300046459	Ga0495629_0168732	Ga0495629_0168732_287_1183	281
399	3300046462	Ga0495651_0031950	Ga0495651_0031950_2965_3861	281
400	3300046463	Ga0495653_0184697	Ga0495653_0184697_245_1141	281
401	3300046511	Ga0495608_0022672	Ga0495608_0022672_426_1322	281
402	3300046516	Ga0495628_0419116	Ga0495628_0419116_67_963	281
403	3300046529	Ga0495652_0042131	Ga0495652_0042131_427_1323	281
404	3300046536	Ga0495587_0007553	Ga0495587_0007553_5892_6788	281
405	3300046559	Ga0495667_0045435	Ga0495667_0045435_245_1141	281
406	3300046663	Ga0495635_0034107	Ga0495635_0034107_398_1294	281
407	3300046663	Ga0495635_0318117	Ga0495635_0318117_17_865	281
408	3300046675	Ga0495657_0038472	Ga0495657_0038472_609_1505	281
409	3300046678	Ga0495599_0037491	Ga0495599_0037491_1789_2685	281
410	3300046679	Ga0495623_0130019	Ga0495623_0130019_326_1222	281
411	3300046680	Ga0495646_0084641	Ga0495646_0084641_708_1604	281
412	3300046689	Ga0495613_0074467	Ga0495613_0074467_259_1155	281
413	3300046809	Ga0495600_0018382	Ga0495600_0018382_245_1141	281
414	3300047317	Ga0495604_0059745	Ga0495604_0059745_1781_2677	281
415	3300047322	Ga0495680_0002817	Ga0495680_0002817_427_1323	281
416	3300047444	Ga0495675_0020716	Ga0495675_0020716_2602_3498	281
417	3300047471	Ga0495684_0064192	Ga0495684_0064192_89_985	281
418	3300047673	Ga0495593_0034978	Ga0495593_0034978_1742_2638	281
419	3300048088	Ga0495602_0071799	Ga0495602_0071799_360_1256	281
420	3300048905	Ga0496102_0119747	Ga0496102_0119747_262_1110	281
421	3300048906	Ga0496103_0118070	Ga0496103_0118070_829_1677	281
422	3300048907	Ga0496104_0036592	Ga0496104_0036592_1980_2828	281
423	3300048909	Ga0496106_0196167	Ga0496106_0196167_501_1349	281
424	3300048910	Ga0496107_0290865	Ga0496107_0290865_235_1083	281
425	3300048911	Ga0496108_0020878	Ga0496108_0020878_1179_2027	281
426	3300048915	Ga0496112_0151095	Ga0496112_0151095_995_1843	281
427	3300048915	Ga0496112_0194162	Ga0496112_0194162_654_1502	281
428	3300048916	Ga0496113_0115939	Ga0496113_0115939_97_945	281
429	3300048918	Ga0496115_0059007	Ga0496115_0059007_574_1422	281
430	3300050496	nmdc:mga07m45_12512_c1	nmdc:mga07m45_12512_c1_291_1142	281
431	3300053084	Ga0495595_0126053	Ga0495595_0126053_13_864	281
432	3300053085	Ga0495619_0020861	Ga0495619_0020861_287_1183	281
433	3300055283	Ga0500661_007016	Ga0500661_007016_478_1332	281
434	3300003203	JGI25406J46586_10058519	JGI25406J46586_100585192	282
435	3300003320	rootH2_10245547	rootH2_102455471	282
436	3300003659	JGI25404J52841_10000080	JGI25404J52841_100000803	282
437	3300005468	Ga0070707_100229140	Ga0070707_1002291402	282
438	3300005471	Ga0070698_100007048	Ga0070698_1000070482	282
439	3300005518	Ga0070699_100127857	Ga0070699_1001278572	282
440	3300005577	Ga0068857_100029286	Ga0068857_1000292863	282
441	3300005937	Ga0081455_10203598	Ga0081455_102035981	282
442	3300005983	Ga0081540_1002252	Ga0081540_100225213	282
443	3300005983	Ga0081540_1004101	Ga0081540_100410111	282
444	3300005985	Ga0081539_10003299	Ga0081539_100032998	282
445	3300005985	Ga0081539_10004863	Ga0081539_100048635	282
446	3300006038	Ga0075365_10047948	Ga0075365_100479483	282
447	3300006871	Ga0075434_100099871	Ga0075434_1000998713	282
448	3300007265	Ga0099794_10020884	Ga0099794_100208842	282
449	3300009148	Ga0105243_10521934	Ga0105243_105219342	282
450	3300014325	Ga0163163_10294611	Ga0163163_102946112	282
451	3300025910	Ga0207684_10311733	Ga0207684_103117332	282
452	3300025922	Ga0207646_10352628	Ga0207646_103526282	282
453	3300028379	Ga0268266_10258191	Ga0268266_102581912	282
454	3300032002	Ga0307416_100657185	Ga0307416_1006571852	282
455	3300035691	Ga0373931_0196739	Ga0373931_0196739_149_1009	282
456	3300039438	Ga0436360_0764361	Ga0436360_0764361_7553_8404	282
457	3300046455	Ga0495603_0137971	Ga0495603_0137971_167_1018	282
458	3300046615	Ga0495656_0155701	Ga0495656_0155701_203_1054	282
459	3300046616	Ga0495668_0065267	Ga0495668_0065267_112_963	282
460	3300050492	nmdc:mga0yw44_94541_c1	nmdc:mga0yw44_94541_c1_536_1384	282
461	3300050512	nmdc:mga0n895_235264_c1	nmdc:mga0n895_235264_c1_390_1250	282
462	3300053084	Ga0495595_0175728	Ga0495595_0175728_44_898	282
463	3300053096	Ga0500641_0001149	Ga0500641_0001149_7325_8173	282
464	3300053134	Ga0500658_0034760	Ga0500658_0034760_628_1476	282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

201

0.97 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

224

0.89 PF08659

KR

KR domain

8

156

0.81 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7djs-assembly1.cif.gz_C	crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad	0.9582	7	192
6zzp-assembly2.cif.gz_D-3	crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate	0.9551	2	192
4y98-assembly1.cif.gz_A	crystal structure of ligd-apo form from sphingobium sp. strain syk-6	0.952	3	270
7e6o-assembly1.cif.gz_A	crystal structure of polyol dehydrogenase from paracoccus denitrificans	0.9498	3	188
7e6o-assembly1.cif.gz_B	crystal structure of polyol dehydrogenase from paracoccus denitrificans	0.9489	3	188

ID	Description	Score	Start	End	Superfamily
af_C6T421_12_106_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.955	2	81	3.40.50.720
4j36B00	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9521	7	40	3.50.50.60
4y98A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.952	3	270	3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9476	2	195	3.40.50.720
af_K7L453_6_225_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9475	7	192	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A534PYM4-F1-model_v4	SDR family NAD(P)-dependent oxidoreductase	0.977	1	185	GO:0016491
AF-A0A3C1FMV4-F1-model_v4	Short-chain dehydrogenase	0.9704	1	204	GO:0016491
AF-A0A109SUQ6-F1-model_v4	deleted	0.9648	1	197
AF-A0A1N6LD60-F1-model_v4	deleted	0.9638	1	282
AF-A0A534PYM4-F1-model_v4	SDR family NAD(P)-dependent oxidoreductase	0.9616	1	185	GO:0016491

Feature Viewer

pLDDT	pTM	Quality
94.82	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449309

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

7

201

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

224

0.89

PF08659

KR

KR domain

8

156

0.81

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map