metagRoot

F448272

General Info

Members	Datasets	Scaffolds	Average Seq Length
458	195	458	288

Family's Representative Sequence

Representative Sequence	3300050507\|nmdc:mga05p37_785290_c1\|nmdc:mga05p37_785290_c1_34_1023
Length	316
Sequence	MYHWLFGTWLRQKQQSILLQTRTRWKIIFYQLHQTRMLSLLKIELFXXXXRPRTYQIALKFGGEEYVGLMLSGMSGSFEEIPAKDILNGYLVCFIILNLLLIHVPILVALVAGDAIAGEANMGTLRLIAAKPFSRIKLLTVKFIASVFYTLILLVWVAVLALFVSIAVFGVNWLGVPRELQFNVLEADDVMWRYALAFCFAAIGLICVAALAFMLSVFSDNSIGPIVATVCVIIVFTILTQLQIPFYDESVKPYLFTTHMLGWKGFFYVKGIEGETVKGSIENLPAILKSAAILIVYTAVFLGIGFWYFKRKDILS

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
3	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
4	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
5	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
6	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
7	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
8	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
9	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
10	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
11	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
12	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
13	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
14	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
15	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
16	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
17	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
18	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
22	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
23	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
24	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
25	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
26	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
27	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
28	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
34	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
35	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
36	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
37	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
38	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
41	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
42	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
43	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
44	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
47	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
48	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
49	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
50	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
54	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
57	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
58	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
59	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
60	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
61	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
62	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
63	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
65	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
66	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
67	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
68	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
69	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
70	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
71	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
73	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
74	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
76	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
81	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
82	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
83	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
89	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
90	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
91	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
92	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
93	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
94	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
95	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
143	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
147	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
148	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
149	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
150	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
151	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
152	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
153	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
154	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
155	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
156	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
157	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
158	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
159	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
160	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
161	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
162	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
163	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
164	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
165	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
166	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
167	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
168	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
169	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
170	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
171	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
172	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
173	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
174	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
175	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
176	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
177	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
178	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
179	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
180	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
181	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
182	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
183	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
184	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
185	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
186	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
187	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
188	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
189	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
190	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
191	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
192	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
193	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
194	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
195	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.97
Nodule	0
Rhizoplane	0.44
Rhizosphere	94.76
Stem	0
Stem Tuber	0
Unclassified	2.84

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_1361775	2162886012	Bacteria	2805
2	rootH1_10028407	3300003316	Bacteria	7989
3	rootL2_10318608	3300003322	Unclassified	1721
4	rootH1_10332763	3300003323	Bacteria	2038
5	Ga0065704_10178962	3300005289	Bacteria	1248
6	Ga0065712_10000551	3300005290	Bacteria	10759
7	Ga0065715_10002371	3300005293	Bacteria	5496
8	Ga0065715_10019395	3300005293	Bacteria	2460
9	Ga0065707_10094407	3300005295	Unclassified	3503
10	Ga0065707_10127714	3300005295	Bacteria	1978
11	Ga0065707_10146744	3300005295	Bacteria	1705
12	Ga0070658_10473968	3300005327	Unclassified	1080
13	Ga0070676_10018110	3300005328	Bacteria	3900
14	Ga0070683_100000690	3300005329	Bacteria	24470
15	Ga0070683_100008953	3300005329	Bacteria	8531
16	Ga0070683_100142409	3300005329	Bacteria	2272
17	Ga0070683_100397566	3300005329	Bacteria	1314
18	Ga0070690_100083138	3300005330	Bacteria	2097
19	Ga0070670_100019856	3300005331	Bacteria	5769
20	Ga0070670_100027295	3300005331	Bacteria	4911
21	Ga0070670_100072666	3300005331	Bacteria	2954
22	Ga0070670_100087636	3300005331	Bacteria	2675
23	Ga0070670_100196349	3300005331	Bacteria	1753
24	Ga0070677_10074045	3300005333	Bacteria	1440
25	Ga0068869_100012104	3300005334	Bacteria	5687
26	Ga0068869_100057491	3300005334	Bacteria	2840
27	Ga0068869_100063385	3300005334	Bacteria	2716
28	Ga0068869_100070786	3300005334	Bacteria	2581
29	Ga0068869_100077457	3300005334	Unclassified	2474
30	Ga0068869_100214071	3300005334	Unclassified	1525
31	Ga0070666_10000019	3300005335	Bacteria	185877
32	Ga0070666_10014374	3300005335	Bacteria	5039
33	Ga0070666_10049353	3300005335	Bacteria	2828
34	Ga0070666_10064304	3300005335	Bacteria	2488
35	Ga0070666_10430056	3300005335	Bacteria	952
36	Ga0070680_100077668	3300005336	Bacteria	2734
37	Ga0070682_100001035	3300005337	Bacteria	16081
38	Ga0070682_100015346	3300005337	Bacteria	4437
39	Ga0068868_100012971	3300005338	Bacteria	6097
40	Ga0068868_100213197	3300005338	Bacteria	1614
41	Ga0068868_100217111	3300005338	Unclassified	1600
42	Ga0070660_100034424	3300005339	Bacteria	3827
43	Ga0070660_100134682	3300005339	Bacteria	1979
44	Ga0070689_100008203	3300005340	Bacteria	7343
45	Ga0070689_100026726	3300005340	Bacteria	4347
46	Ga0070689_100058863	3300005340	Bacteria	2985
47	Ga0070691_10067959	3300005341	Unclassified	1725
48	Ga0070687_100019693	3300005343	Bacteria	3144
49	Ga0070661_100000615	3300005344	Bacteria	26536
50	Ga0070668_100008223	3300005347	Bacteria	7745
51	Ga0070668_100248923	3300005347	Bacteria	1475
52	Ga0070669_100012757	3300005353	Bacteria	5965
53	Ga0070669_100107857	3300005353	Bacteria	2110
54	Ga0070669_100108453	3300005353	Bacteria	2104
55	Ga0070675_100000570	3300005354	Bacteria	25293
56	Ga0070675_100026342	3300005354	Bacteria	4666
57	Ga0070675_100065034	3300005354	Bacteria	3015
58	Ga0070675_100068384	3300005354	Bacteria	2941
59	Ga0070675_100144610	3300005354	Bacteria	2035
60	Ga0070671_100042666	3300005355	Bacteria	3770
61	Ga0070671_100069493	3300005355	Bacteria	2938
62	Ga0070671_100185383	3300005355	Bacteria	1763
63	Ga0070673_100002308	3300005364	Bacteria	11592
64	Ga0070673_100015161	3300005364	Bacteria	5402
65	Ga0070673_100025247	3300005364	Bacteria	4370
66	Ga0070673_100103543	3300005364	Bacteria	2349
67	Ga0070673_100230159	3300005364	Unclassified	1608
68	Ga0070688_100001242	3300005365	Bacteria	12718
69	Ga0070688_100004531	3300005365	Bacteria	7248
70	Ga0070688_100018463	3300005365	Bacteria	4024
71	Ga0070659_100008665	3300005366	Bacteria	7440
72	Ga0070667_100003997	3300005367	Bacteria	12487
73	Ga0070667_100105235	3300005367	Bacteria	2442
74	Ga0070701_10043427	3300005438	Unclassified	2300
75	Ga0070678_100004844	3300005456	Bacteria	7690
76	Ga0070662_100003664	3300005457	Bacteria	9597
77	Ga0070662_100054538	3300005457	Bacteria	2897
78	Ga0070662_100055167	3300005457	Bacteria	2882
79	Ga0070662_100056771	3300005457	Bacteria	2842
80	Ga0070662_100186431	3300005457	Bacteria	1638
81	Ga0070681_10162716	3300005458	Bacteria	2155
82	Ga0068867_100037534	3300005459	Bacteria	3522
83	Ga0068867_100048238	3300005459	Bacteria	3132
84	Ga0068867_100050207	3300005459	Bacteria	3073
85	Ga0068867_100105614	3300005459	Bacteria	2156
86	Ga0068867_100206463	3300005459	Bacteria	1575
87	Ga0070685_10004817	3300005466	Bacteria	6829
88	Ga0070685_10007675	3300005466	Bacteria	5521
89	Ga0070685_10011838	3300005466	Bacteria	4573
90	Ga0070685_10239303	3300005466	Bacteria	1197
91	Ga0070698_100006625	3300005471	Bacteria	12560
92	Ga0070698_100165567	3300005471	Bacteria	2154
93	Ga0070698_100311866	3300005471	Bacteria	1504
94	Ga0070679_100066554	3300005530	Bacteria	3591
95	Ga0070679_100485976	3300005530	Bacteria	1179
96	Ga0070684_100000986	3300005535	Bacteria	20347
97	Ga0070684_100044373	3300005535	Bacteria	3845
98	Ga0070684_100098263	3300005535	Bacteria	2612
99	Ga0068853_100013072	3300005539	Bacteria	6771
100	Ga0068853_100037485	3300005539	Bacteria	4125
101	Ga0068853_100063734	3300005539	Bacteria	3193
102	Ga0068853_100076208	3300005539	Bacteria	2928
103	Ga0068853_100307974	3300005539	Unclassified	1466
104	Ga0070672_100021870	3300005543	Bacteria	4686
105	Ga0070686_100021601	3300005544	Bacteria	3830
106	Ga0070686_100260102	3300005544	Bacteria	1272
107	Ga0070696_100266038	3300005546	Unclassified	1302
108	Ga0070665_100000018	3300005548	Bacteria	434118
109	Ga0068855_100155875	3300005563	Bacteria	2595
110	Ga0068855_100166222	3300005563	Bacteria	2501
111	Ga0070664_100001066	3300005564	Bacteria	21588
112	Ga0070664_100085866	3300005564	Bacteria	2718
113	Ga0070664_100158746	3300005564	Bacteria	2000
114	Ga0068857_100001057	3300005577	Bacteria	21331
115	Ga0068857_100022395	3300005577	Bacteria	5559
116	Ga0068857_100023982	3300005577	Bacteria	5370
117	Ga0068857_100025645	3300005577	Bacteria	5189
118	Ga0068857_100368143	3300005577	Bacteria	1333
119	Ga0068854_100105695	3300005578	Bacteria	2117
120	Ga0068854_100413881	3300005578	Bacteria	1118
121	Ga0068852_100009554	3300005616	Bacteria	7206
122	Ga0068852_100159366	3300005616	Bacteria	2106
123	Ga0068852_100176706	3300005616	Bacteria	2005
124	Ga0068859_100000013	3300005617	Bacteria	291126
125	Ga0068859_100016151	3300005617	Bacteria	7496
126	Ga0068859_100097112	3300005617	Bacteria	2999
127	Ga0068859_100220681	3300005617	Bacteria	1983
128	Ga0068859_100344535	3300005617	Bacteria	1585
129	Ga0068864_100004091	3300005618	Bacteria	11979
130	Ga0068864_100043410	3300005618	Bacteria	3850
131	Ga0068864_100112929	3300005618	Unclassified	2422
132	Ga0068866_10069488	3300005718	Bacteria	1856
133	Ga0068861_100014667	3300005719	Bacteria	5503
134	Ga0068861_100041153	3300005719	Bacteria	3460
135	Ga0068861_100050381	3300005719	Bacteria	3157
136	Ga0068861_100230344	3300005719	Unclassified	1571
137	Ga0068870_10085570	3300005840	Bacteria	1753
138	Ga0068863_100017465	3300005841	Bacteria	6878
139	Ga0068863_100095693	3300005841	Unclassified	2819
140	Ga0068863_100147933	3300005841	Bacteria	2247
141	Ga0068863_100388354	3300005841	Bacteria	1364
142	Ga0068863_100487270	3300005841	Bacteria	1213
143	Ga0068858_100005907	3300005842	Bacteria	11948
144	Ga0068858_100064670	3300005842	Bacteria	3386
145	Ga0068858_100110180	3300005842	Bacteria	2571
146	Ga0068860_100000983	3300005843	Bacteria	31545
147	Ga0068860_100003160	3300005843	Bacteria	17008
148	Ga0068860_100084921	3300005843	Bacteria	3011
149	Ga0068860_100183562	3300005843	Unclassified	2022
150	Ga0068860_100295745	3300005843	Unclassified	1585
151	Ga0068862_100041057	3300005844	Bacteria	3935
152	Ga0068862_100103452	3300005844	Bacteria	2494
153	Ga0070715_10021239	3300006163	Bacteria	2515
154	Ga0075366_10003142	3300006195	Bacteria	8641
155	Ga0075366_10045288	3300006195	Bacteria	2608
156	Ga0097621_100021201	3300006237	Bacteria	5020
157	Ga0097621_100034636	3300006237	Bacteria	4029
158	Ga0097621_100071274	3300006237	Bacteria	2871
159	Ga0097621_100304743	3300006237	Bacteria	1408
160	Ga0097621_100400083	3300006237	Bacteria	1229
161	Ga0068871_100016275	3300006358	Bacteria	5595
162	Ga0068871_100022431	3300006358	Bacteria	4866
163	Ga0068871_100038051	3300006358	Bacteria	3839
164	Ga0068871_100064884	3300006358	Bacteria	2990
165	Ga0068871_100244047	3300006358	Bacteria	1563
166	Ga0068871_100581258	3300006358	Bacteria	1017
167	Ga0075428_100001815	3300006844	Bacteria	22850
168	Ga0075428_100002594	3300006844	Bacteria	19646
169	Ga0075430_100007617	3300006846	Bacteria	9147
170	Ga0075430_100097687	3300006846	Bacteria	2454
171	Ga0075431_100024797	3300006847	Bacteria	6149
172	Ga0075431_100035835	3300006847	Bacteria	5108
173	Ga0075434_100137119	3300006871	Bacteria	2466
174	Ga0075429_100001013	3300006880	Bacteria	22376
175	Ga0075429_100028184	3300006880	Bacteria	4875
176	Ga0068865_100012800	3300006881	Bacteria	5288
177	Ga0068865_100049974	3300006881	Bacteria	2886
178	Ga0097620_100000013	3300006931	Bacteria	291126
179	Ga0097620_100016151	3300006931	Bacteria	7496
180	Ga0097620_100087076	3300006931	Bacteria	3171
181	Ga0097620_100097101	3300006931	Bacteria	2999
182	Ga0097620_100220703	3300006931	Bacteria	1983
183	Ga0097620_100344500	3300006931	Bacteria	1585
184	Ga0105251_10076876	3300009011	Bacteria	1548
185	Ga0105240_10111072	3300009093	Bacteria	3317
186	Ga0111539_10009424	3300009094	Bacteria	12319
187	Ga0111539_10233291	3300009094	Bacteria	2142
188	Ga0111539_10247096	3300009094	Bacteria	2077
189	Ga0105247_10001711	3300009101	Bacteria	15470
190	Ga0105247_10010653	3300009101	Bacteria	5551
191	Ga0114129_10038739	3300009147	Bacteria	6720
192	Ga0114129_10099972	3300009147	Bacteria	4013
193	Ga0105241_10002606	3300009174	Bacteria	13525
194	Ga0105241_10023950	3300009174	Bacteria	4532
195	Ga0105242_10032727	3300009176	Bacteria	4159
196	Ga0105248_10534895	3300009177	Bacteria	1322
197	Ga0105237_10000186	3300009545	Bacteria	87958
198	Ga0105237_10008863	3300009545	Bacteria	10846
199	Ga0105237_10126904	3300009545	Bacteria	2545
200	Ga0105237_10343804	3300009545	Bacteria	1496
201	Ga0105238_10313987	3300009551	Bacteria	1553
202	Ga0105238_10435747	3300009551	Bacteria	1307
203	Ga0105249_10001305	3300009553	Bacteria	21857
204	Ga0105249_10002125	3300009553	Bacteria	17191
205	Ga0105249_10004589	3300009553	Bacteria	11938
206	Ga0105249_10017591	3300009553	Bacteria	6346
207	Ga0105249_10066289	3300009553	Bacteria	3324
208	Ga0105249_10136214	3300009553	Bacteria	2350
209	Ga0105249_10153255	3300009553	Bacteria	2221
210	Ga0105249_10328861	3300009553	Bacteria	1542
211	Ga0105249_10520721	3300009553	Bacteria	1236
212	Ga0105249_10742354	3300009553	Bacteria	1043
213	Ga0157370_10058730	3300013104	Bacteria	3656
214	Ga0157370_10275811	3300013104	Unclassified	1554
215	Ga0157374_10045341	3300013296	Bacteria	4069
216	Ga0157374_10053269	3300013296	Bacteria	3771
217	Ga0157374_10112049	3300013296	Bacteria	2625
218	Ga0157378_10008006	3300013297	Bacteria	9228
219	Ga0157378_10111771	3300013297	Bacteria	2505
220	Ga0157378_10170276	3300013297	Bacteria	2042
221	Ga0157378_10290406	3300013297	Unclassified	1579
222	Ga0163162_10008657	3300013306	Bacteria	9907
223	Ga0163162_10009101	3300013306	Bacteria	9655
224	Ga0163162_10026861	3300013306	Bacteria	5692
225	Ga0163162_10083143	3300013306	Bacteria	3275
226	Ga0163162_10121898	3300013306	Bacteria	2712
227	Ga0163162_10360163	3300013306	Bacteria	1587
228	Ga0157372_10286234	3300013307	Unclassified	1917
229	Ga0157372_11025043	3300013307	Unclassified	955
230	Ga0157375_10009353	3300013308	Bacteria	8601
231	Ga0157375_10041368	3300013308	Bacteria	4449
232	Ga0157375_10063960	3300013308	Bacteria	3662
233	Ga0157375_10074839	3300013308	Bacteria	3409
234	Ga0157375_10084502	3300013308	Bacteria	3223
235	Ga0157375_10094282	3300013308	Bacteria	3062
236	Ga0157375_10120369	3300013308	Bacteria	2734
237	Ga0157375_10368231	3300013308	Bacteria	1603
238	Ga0163163_10000057	3300014325	Bacteria	124939
239	Ga0163163_10168240	3300014325	Unclassified	2238
240	Ga0163163_10225243	3300014325	Bacteria	1924
241	Ga0163163_10237635	3300014325	Bacteria	1871
242	Ga0163163_10290436	3300014325	Bacteria	1687
243	Ga0163163_10309748	3300014325	Bacteria	1632
244	Ga0163163_10420332	3300014325	Bacteria	1396
245	Ga0163163_10472161	3300014325	Bacteria	1315
246	Ga0157380_10006905	3300014326	Bacteria	8028
247	Ga0157380_10048001	3300014326	Bacteria	3361
248	Ga0157380_10165884	3300014326	Bacteria	1924
249	Ga0157377_10002222	3300014745	Bacteria	8531
250	Ga0157377_10002409	3300014745	Bacteria	8259
251	Ga0157377_10018966	3300014745	Bacteria	3587
252	Ga0157377_10020120	3300014745	Bacteria	3492
253	Ga0157379_10069223	3300014968	Bacteria	3156
254	Ga0157379_10097793	3300014968	Bacteria	2635
255	Ga0157379_10217547	3300014968	Bacteria	1730
256	Ga0157379_10257809	3300014968	Bacteria	1584
257	Ga0157379_10281073	3300014968	Bacteria	1515
258	Ga0157376_10004238	3300014969	Bacteria	9956
259	Ga0157376_10004626	3300014969	Bacteria	9586
260	Ga0157376_10119623	3300014969	Bacteria	2332
261	Ga0157376_10142924	3300014969	Bacteria	2149
262	Ga0157376_10219966	3300014969	Unclassified	1758
263	Ga0157376_10221325	3300014969	Bacteria	1753
264	Ga0157376_10282503	3300014969	Bacteria	1564
265	Ga0163161_10003529	3300017792	Bacteria	10949
266	Ga0163161_10049038	3300017792	Bacteria	3050
267	Ga0163161_10139649	3300017792	Bacteria	1834
268	Ga0163161_10199719	3300017792	Unclassified	1541
269	Ga0163161_10260724	3300017792	Bacteria	1354
270	Ga0207656_10023421	3300025321	Unclassified	2487
271	Ga0207710_10000874	3300025900	Bacteria	16147
272	Ga0207710_10016035	3300025900	Bacteria	3170
273	Ga0207680_10000512	3300025903	Bacteria	18520
274	Ga0207680_10048623	3300025903	Bacteria	2521
275	Ga0207680_10269105	3300025903	Bacteria	1181
276	Ga0207647_10128449	3300025904	Bacteria	1491
277	Ga0207645_10038906	3300025907	Bacteria	3048
278	Ga0207643_10014673	3300025908	Bacteria	4259
279	Ga0207643_10146025	3300025908	Bacteria	1415
280	Ga0207705_10368148	3300025909	Unclassified	1109
281	Ga0207654_10006014	3300025911	Bacteria	6102
282	Ga0207654_10390907	3300025911	Bacteria	965
283	Ga0207707_10036687	3300025912	Bacteria	4285
284	Ga0207695_10213222	3300025913	Unclassified	1841
285	Ga0207671_10000521	3300025914	Bacteria	51898
286	Ga0207671_10004556	3300025914	Bacteria	13167
287	Ga0207660_10060856	3300025917	Bacteria	2716
288	Ga0207662_10031042	3300025918	Bacteria	3104
289	Ga0207657_10150392	3300025919	Bacteria	1897
290	Ga0207649_10002980	3300025920	Bacteria	9328
291	Ga0207652_10001622	3300025921	Bacteria	19775
292	Ga0207652_10510404	3300025921	Bacteria	1082
293	Ga0207646_10046301	3300025922	Unclassified	3902
294	Ga0207681_10073501	3300025923	Bacteria	2392
295	Ga0207681_10096833	3300025923	Bacteria	2119
296	Ga0207681_10259912	3300025923	Bacteria	1359
297	Ga0207681_10388886	3300025923	Bacteria	1124
298	Ga0207650_10082799	3300025925	Bacteria	2436
299	Ga0207650_10360583	3300025925	Bacteria	1197
300	Ga0207659_10004312	3300025926	Bacteria	8598
301	Ga0207659_10045925	3300025926	Bacteria	3082
302	Ga0207659_10070582	3300025926	Bacteria	2548
303	Ga0207690_10018793	3300025932	Bacteria	4243
304	Ga0207706_10025516	3300025933	Bacteria	5295
305	Ga0207706_10052951	3300025933	Bacteria	3583
306	Ga0207706_10112733	3300025933	Bacteria	2392
307	Ga0207706_10247474	3300025933	Bacteria	1558
308	Ga0207686_10000554	3300025934	Bacteria	24037
309	Ga0207686_10043302	3300025934	Bacteria	2757
310	Ga0207686_10044875	3300025934	Bacteria	2716
311	Ga0207670_10004053	3300025936	Bacteria	7839
312	Ga0207670_10006674	3300025936	Bacteria	6422
313	Ga0207670_10068385	3300025936	Bacteria	2447
314	Ga0207669_10047401	3300025937	Bacteria	2546
315	Ga0207704_10019507	3300025938	Unclassified	3563
316	Ga0207704_10133653	3300025938	Bacteria	1723
317	Ga0207691_10019542	3300025940	Bacteria	6409
318	Ga0207691_10037004	3300025940	Bacteria	4521
319	Ga0207691_10316030	3300025940	Bacteria	1340
320	Ga0207711_10334938	3300025941	Bacteria	1400
321	Ga0207689_10000782	3300025942	Bacteria	30527
322	Ga0207689_10004002	3300025942	Bacteria	13403
323	Ga0207689_10008139	3300025942	Bacteria	9144
324	Ga0207689_10020924	3300025942	Bacteria	5499
325	Ga0207689_10034466	3300025942	Bacteria	4205
326	Ga0207689_10048636	3300025942	Bacteria	3498
327	Ga0207689_10058454	3300025942	Bacteria	3172
328	Ga0207661_10000589	3300025944	Bacteria	23208
329	Ga0207661_10067379	3300025944	Bacteria	2911
330	Ga0207679_10001213	3300025945	Bacteria	16399
331	Ga0207679_10078585	3300025945	Bacteria	2514
332	Ga0207651_10002163	3300025960	Bacteria	9299
333	Ga0207651_10057594	3300025960	Bacteria	2681
334	Ga0207712_10000635	3300025961	Bacteria	27680
335	Ga0207712_10002164	3300025961	Bacteria	12842
336	Ga0207712_10003522	3300025961	Bacteria	9883
337	Ga0207712_10009863	3300025961	Bacteria	6054
338	Ga0207668_10170930	3300025972	Bacteria	1704
339	Ga0207640_10126585	3300025981	Bacteria	1840
340	Ga0207658_10011195	3300025986	Bacteria	6111
341	Ga0207658_10063087	3300025986	Bacteria	2776
342	Ga0207658_10154737	3300025986	Unclassified	1872
343	Ga0207677_10004870	3300026023	Bacteria	7243
344	Ga0207677_10032091	3300026023	Bacteria	3373
345	Ga0207677_10228498	3300026023	Bacteria	1497
346	Ga0207677_10260114	3300026023	Bacteria	1414
347	Ga0207703_10006469	3300026035	Bacteria	9355
348	Ga0207703_10058717	3300026035	Bacteria	3141
349	Ga0207703_10095467	3300026035	Bacteria	2508
350	Ga0207639_10007559	3300026041	Bacteria	7412
351	Ga0207639_10012272	3300026041	Bacteria	5966
352	Ga0207639_10054223	3300026041	Bacteria	3064
353	Ga0207639_10225606	3300026041	Bacteria	1621
354	Ga0207639_10374791	3300026041	Bacteria	1277
355	Ga0207708_10158070	3300026075	Bacteria	1788
356	Ga0207708_10165313	3300026075	Bacteria	1749
357	Ga0207708_10203389	3300026075	Bacteria	1581
358	Ga0207641_10002898	3300026088	Bacteria	15523
359	Ga0207641_10003127	3300026088	Bacteria	14880
360	Ga0207641_10135234	3300026088	Bacteria	2218
361	Ga0207641_10200213	3300026088	Bacteria	1841
362	Ga0207641_10780457	3300026088	Bacteria	944
363	Ga0207648_10001661	3300026089	Bacteria	24363
364	Ga0207648_10028165	3300026089	Bacteria	4983
365	Ga0207648_10043485	3300026089	Bacteria	3943
366	Ga0207648_10080831	3300026089	Bacteria	2835
367	Ga0207648_10334084	3300026089	Bacteria	1363
368	Ga0207676_10003002	3300026095	Bacteria	12032
369	Ga0207676_10042407	3300026095	Bacteria	3500
370	Ga0207676_10060511	3300026095	Bacteria	2996
371	Ga0207676_10154183	3300026095	Unclassified	1982
372	Ga0207676_10155082	3300026095	Bacteria	1977
373	Ga0207676_10193277	3300026095	Bacteria	1792
374	Ga0207676_10256693	3300026095	Bacteria	1576
375	Ga0207674_10007723	3300026116	Bacteria	12519
376	Ga0207674_10012956	3300026116	Bacteria	9300
377	Ga0207674_10079536	3300026116	Bacteria	3282
378	Ga0207674_10081002	3300026116	Bacteria	3249
379	Ga0207674_10378000	3300026116	Bacteria	1369
380	Ga0207675_100000272	3300026118	Bacteria	49071
381	Ga0207675_100052041	3300026118	Bacteria	3821
382	Ga0207675_100068327	3300026118	Bacteria	3321
383	Ga0207675_100116029	3300026118	Bacteria	2530
384	Ga0207675_100130503	3300026118	Bacteria	2383
385	Ga0207675_100165313	3300026118	Bacteria	2113
386	Ga0207675_100172420	3300026118	Bacteria	2068
387	Ga0207675_100173161	3300026118	Bacteria	2064
388	Ga0207675_100318400	3300026118	Bacteria	1518
389	Ga0207683_10009661	3300026121	Bacteria	8221
390	Ga0207698_10033631	3300026142	Bacteria	3728
391	Ga0207698_10040878	3300026142	Bacteria	3451
392	Ga0207698_10057018	3300026142	Bacteria	3019
393	Ga0207428_10207881	3300027907	Bacteria	1471
394	Ga0268266_10132102	3300028379	Bacteria	2234
395	Ga0268266_10214224	3300028379	Bacteria	1768
396	Ga0268265_10013806	3300028380	Bacteria	5497
397	Ga0268264_10001326	3300028381	Bacteria	23282
398	Ga0268264_10002002	3300028381	Bacteria	18301
399	Ga0268264_10136741	3300028381	Bacteria	2180
400	Ga0268264_10209641	3300028381	Unclassified	1788
401	Ga0268264_10354518	3300028381	Bacteria	1397
402	Ga0307517_10009936	3300028786	Bacteria	13404
403	Ga0307515_10000021	3300028794	Bacteria	406008
404	Ga0307511_10000104	3300030521	Bacteria	75069
405	Ga0307513_10054961	3300031456	Bacteria	4264
406	Ga0307509_10260494	3300031507	Bacteria	1510
407	Ga0307508_10000981	3300031616	Bacteria	33137
408	Ga0307508_10185726	3300031616	Bacteria	1681
409	Ga0307516_10000496	3300031730	Bacteria	52327
410	Ga0307409_100784745	3300031995	Unclassified	959
411	Ga0307510_10000165	3300033180	Bacteria	55957
412	Ga0373944_0023675	3300035089	Unclassified	1794
413	Ga0373925_0467481	3300037068	Bacteria	1034
414	Ga0451849_0799415	3300041505	Bacteria	1898
415	Ga0451577_0005807	3300042876	Bacteria	12503
416	Ga0451577_0419516	3300042876	Bacteria	1215
417	Ga0451576_0611163	3300045051	Bacteria	1146
418	Ga0495629_0094116	3300046459	Bacteria	2091
419	Ga0495638_0043082	3300046460	Bacteria	2848
420	Ga0495582_0208141	3300046473	Bacteria	1118
421	Ga0495630_0162375	3300046517	Bacteria	1701
422	Ga0495643_0040273	3300046522	Unclassified	2552
423	Ga0495648_0003175	3300046524	Bacteria	14631
424	Ga0495640_0260512	3300046533	Bacteria	1084
425	Ga0495587_0064904	3300046536	Bacteria	2133
426	Ga0495633_0115541	3300046558	Bacteria	1244
427	Ga0495668_0000099	3300046616	Bacteria	137915
428	Ga0495625_0048268	3300046660	Bacteria	3067
429	Ga0495599_0167239	3300046678	Bacteria	1358
430	Ga0495672_0009389	3300047320	Bacteria	7094
431	Ga0495672_0074698	3300047320	Bacteria	1908
432	Ga0495684_0301353	3300047471	Bacteria	1151
433	Ga0495686_0036477	3300047472	Bacteria	3155
434	Ga0496115_0180175	3300048918	Bacteria	1747
435	Ga0496115_0260654	3300048918	Bacteria	1426
436	Ga0501032_0319798	3300049569	Unclassified	1002
437	Ga0501043_0457755	3300049579	Unclassified	958
438	Ga0501068_0162512	3300049584	Bacteria	1408
439	Ga0501069_0033356	3300049585	Bacteria	2836
440	Ga0501070_0019099	3300049586	Bacteria	5749
441	Ga0501073_0106314	3300049589	Bacteria	1947
442	nmdc:mga0k408_141112_c1	3300050493	Unclassified	1433
443	nmdc:mga0k408_296013_c1	3300050493	Bacteria	966
444	nmdc:mga05p37_43835_c1	3300050507	Bacteria	5504
445	nmdc:mga05p37_785290_c1	3300050507	Unclassified	1044
446	nmdc:mga09592_13482_c1	3300050508	Bacteria	6675
447	nmdc:mga0qj67_214216_c1	3300050509	Bacteria	1564
448	nmdc:mga06r32_27334_c1	3300050510	Bacteria	5328
449	nmdc:mga06r32_9504_c1	3300050510	Bacteria	8778
450	nmdc:mga08y16_389898_c1	3300050511	Bacteria	1427
451	nmdc:mga0n895_133211_c1	3300050512	Bacteria	2511
452	Ga0500641_0055063	3300053096	Unclassified	1646
453	Ga0500628_036045	3300053129	Bacteria	1104
454	Ga0500588_0002638	3300053146	Bacteria	3684
455	Ga0500622_0002308	3300053156	Bacteria	13946
456	Ga0500611_000052	3300053727	Bacteria	50936
457	Ga0501084_0053118	3300054114	Bacteria	3389
458	Ga0501082_0005308	3300060353	Bacteria	11201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049579	Ga0501043_0457755	Ga0501043_0457755_28_828	218
2	3300049585	Ga0501069_0033356	Ga0501069_0033356_197_997	218
3	3300049589	Ga0501073_0106314	Ga0501073_0106314_798_1598	218
4	3300025908	Ga0207643_10146025	Ga0207643_101460252	225
5	3300025909	Ga0207705_10368148	Ga0207705_103681481	232
6	3300025921	Ga0207652_10510404	Ga0207652_105104042	232
7	3300026075	Ga0207708_10203389	Ga0207708_102033892	235
8	3300009553	Ga0105249_10136214	Ga0105249_101362142	237
9	3300031730	Ga0307516_10000496	Ga0307516_1000049615	240
10	3300009551	Ga0105238_10313987	Ga0105238_103139872	241
11	3300005456	Ga0070678_100004844	Ga0070678_1000048443	242
12	3300026121	Ga0207683_10009661	Ga0207683_100096615	242
13	3300017792	Ga0163161_10139649	Ga0163161_101396492	244
14	3300049569	Ga0501032_0319798	Ga0501032_0319798_37_918	244
15	3300049584	Ga0501068_0162512	Ga0501068_0162512_103_984	244
16	3300049586	Ga0501070_0019099	Ga0501070_0019099_2883_3764	244
17	3300054114	Ga0501084_0053118	Ga0501084_0053118_427_1308	244
18	3300060353	Ga0501082_0005308	Ga0501082_0005308_8839_9720	244
19	3300005331	Ga0070670_100196349	Ga0070670_1001963491	245
20	3300025925	Ga0207650_10360583	Ga0207650_103605831	245
21	3300042876	Ga0451577_0419516	Ga0451577_0419516_86_961	245
22	3300050507	nmdc:mga05p37_785290_c1	nmdc:mga05p37_785290_c1_34_1023	245
23	3300053727	Ga0500611_000052	Ga0500611_000052_822_1712	245
24	3300009545	Ga0105237_10343804	Ga0105237_103438042	247
25	3300053129	Ga0500628_036045	Ga0500628_036045_41_931	249
26	3300005365	Ga0070688_100001242	Ga0070688_1000012423	251
27	3300005457	Ga0070662_100003664	Ga0070662_1000036643	251
28	3300006844	Ga0075428_100001815	Ga0075428_1000018154	253
29	3300006846	Ga0075430_100007617	Ga0075430_1000076174	253
30	3300006847	Ga0075431_100024797	Ga0075431_1000247972	253
31	3300006880	Ga0075429_100028184	Ga0075429_1000281843	253
32	3300009147	Ga0114129_10099972	Ga0114129_100999722	253
33	3300050510	nmdc:mga06r32_9504_c1	nmdc:mga06r32_9504_c1_1963_2844	253
34	3300026075	Ga0207708_10165313	Ga0207708_101653132	254
35	3300013307	Ga0157372_11025043	Ga0157372_110250431	255
36	3300005329	Ga0070683_100000690	Ga0070683_10000069015	256
37	3300005337	Ga0070682_100015346	Ga0070682_1000153463	256
38	3300005344	Ga0070661_100000615	Ga0070661_10000061516	256
39	3300005354	Ga0070675_100026342	Ga0070675_1000263421	256
40	3300005366	Ga0070659_100008665	Ga0070659_1000086655	256
41	3300005535	Ga0070684_100000986	Ga0070684_10000098618	256
42	3300005539	Ga0068853_100037485	Ga0068853_1000374853	256
43	3300005564	Ga0070664_100001066	Ga0070664_10000106619	256
44	3300005577	Ga0068857_100001057	Ga0068857_10000105719	256
45	3300025920	Ga0207649_10002980	Ga0207649_100029808	256
46	3300025932	Ga0207690_10018793	Ga0207690_100187931	256
47	3300025937	Ga0207669_10047401	Ga0207669_100474013	256
48	3300025944	Ga0207661_10000589	Ga0207661_100005894	256
49	3300025945	Ga0207679_10001213	Ga0207679_100012132	256
50	3300026041	Ga0207639_10012272	Ga0207639_100122723	256
51	3300026116	Ga0207674_10007723	Ga0207674_100077233	256
52	3300005471	Ga0070698_100311866	Ga0070698_1003118662	257
53	3300005546	Ga0070696_100266038	Ga0070696_1002660382	257
54	3300005617	Ga0068859_100344535	Ga0068859_1003445352	257
55	3300005719	Ga0068861_100050381	Ga0068861_1000503814	257
56	3300006931	Ga0097620_100344500	Ga0097620_1003445002	257
57	3300026118	Ga0207675_100068327	Ga0207675_1000683274	257
58	3300030521	Ga0307511_10000104	Ga0307511_1000010433	257
59	3300037068	Ga0373925_0467481	Ga0373925_0467481_43_921	257
60	3300047320	Ga0495672_0009389	Ga0495672_0009389_815_1690	257
61	3300047472	Ga0495686_0036477	Ga0495686_0036477_1867_2754	257
62	3300050493	nmdc:mga0k408_141112_c1	nmdc:mga0k408_141112_c1_150_1037	257
63	2162886012	MBSR1b_contig_1361775	MBSR1b_0409.00005020	258
64	3300003316	rootH1_10028407	rootH1_100284074	258
65	3300003322	rootL2_10318608	rootL2_103186082	258
66	3300003323	rootH1_10332763	rootH1_103327632	258
67	3300005289	Ga0065704_10178962	Ga0065704_101789621	258
68	3300005290	Ga0065712_10000551	Ga0065712_100005513	258
69	3300005293	Ga0065715_10002371	Ga0065715_100023713	258
70	3300005293	Ga0065715_10019395	Ga0065715_100193952	258
71	3300005295	Ga0065707_10094407	Ga0065707_100944072	258
72	3300005295	Ga0065707_10127714	Ga0065707_101277142	258
73	3300005295	Ga0065707_10146744	Ga0065707_101467442	258
74	3300005327	Ga0070658_10473968	Ga0070658_104739682	258
75	3300005328	Ga0070676_10018110	Ga0070676_100181103	258
76	3300005329	Ga0070683_100008953	Ga0070683_1000089532	258
77	3300005329	Ga0070683_100142409	Ga0070683_1001424091	258
78	3300005329	Ga0070683_100397566	Ga0070683_1003975661	258
79	3300005330	Ga0070690_100083138	Ga0070690_1000831382	258
80	3300005331	Ga0070670_100019856	Ga0070670_1000198565	258
81	3300005331	Ga0070670_100027295	Ga0070670_1000272953	258
82	3300005331	Ga0070670_100072666	Ga0070670_1000726662	258
83	3300005331	Ga0070670_100087636	Ga0070670_1000876363	258
84	3300005333	Ga0070677_10074045	Ga0070677_100740452	258
85	3300005334	Ga0068869_100012104	Ga0068869_1000121041	258
86	3300005334	Ga0068869_100057491	Ga0068869_1000574912	258
87	3300005334	Ga0068869_100063385	Ga0068869_1000633853	258
88	3300005334	Ga0068869_100070786	Ga0068869_1000707862	258
89	3300005334	Ga0068869_100077457	Ga0068869_1000774572	258
90	3300005334	Ga0068869_100214071	Ga0068869_1002140711	258
91	3300005335	Ga0070666_10000019	Ga0070666_1000001943	258
92	3300005335	Ga0070666_10014374	Ga0070666_100143744	258
93	3300005335	Ga0070666_10049353	Ga0070666_100493533	258
94	3300005335	Ga0070666_10064304	Ga0070666_100643043	258
95	3300005335	Ga0070666_10430056	Ga0070666_104300561	258
96	3300005336	Ga0070680_100077668	Ga0070680_1000776683	258
97	3300005337	Ga0070682_100001035	Ga0070682_1000010358	258
98	3300005338	Ga0068868_100012971	Ga0068868_1000129714	258
99	3300005338	Ga0068868_100213197	Ga0068868_1002131972	258
100	3300005338	Ga0068868_100217111	Ga0068868_1002171112	258
101	3300005339	Ga0070660_100034424	Ga0070660_1000344243	258
102	3300005339	Ga0070660_100134682	Ga0070660_1001346822	258
103	3300005340	Ga0070689_100008203	Ga0070689_1000082034	258
104	3300005340	Ga0070689_100026726	Ga0070689_1000267263	258
105	3300005340	Ga0070689_100058863	Ga0070689_1000588633	258
106	3300005341	Ga0070691_10067959	Ga0070691_100679592	258
107	3300005343	Ga0070687_100019693	Ga0070687_1000196933	258
108	3300005347	Ga0070668_100008223	Ga0070668_1000082237	258
109	3300005347	Ga0070668_100248923	Ga0070668_1002489232	258
110	3300005353	Ga0070669_100012757	Ga0070669_1000127573	258
111	3300005353	Ga0070669_100107857	Ga0070669_1001078572	258
112	3300005353	Ga0070669_100108453	Ga0070669_1001084532	258
113	3300005354	Ga0070675_100000570	Ga0070675_1000005702	258
114	3300005354	Ga0070675_100065034	Ga0070675_1000650343	258
115	3300005354	Ga0070675_100068384	Ga0070675_1000683842	258
116	3300005354	Ga0070675_100144610	Ga0070675_1001446102	258
117	3300005355	Ga0070671_100042666	Ga0070671_1000426662	258
118	3300005355	Ga0070671_100069493	Ga0070671_1000694932	258
119	3300005355	Ga0070671_100185383	Ga0070671_1001853831	258
120	3300005364	Ga0070673_100002308	Ga0070673_1000023083	258
121	3300005364	Ga0070673_100015161	Ga0070673_1000151612	258
122	3300005364	Ga0070673_100025247	Ga0070673_1000252473	258
123	3300005364	Ga0070673_100103543	Ga0070673_1001035433	258
124	3300005364	Ga0070673_100230159	Ga0070673_1002301591	258
125	3300005365	Ga0070688_100004531	Ga0070688_1000045318	258
126	3300005365	Ga0070688_100018463	Ga0070688_1000184633	258
127	3300005367	Ga0070667_100003997	Ga0070667_1000039978	258
128	3300005367	Ga0070667_100105235	Ga0070667_1001052352	258
129	3300005438	Ga0070701_10043427	Ga0070701_100434272	258
130	3300005457	Ga0070662_100054538	Ga0070662_1000545382	258
131	3300005457	Ga0070662_100055167	Ga0070662_1000551674	258
132	3300005457	Ga0070662_100056771	Ga0070662_1000567713	258
133	3300005457	Ga0070662_100186431	Ga0070662_1001864312	258
134	3300005458	Ga0070681_10162716	Ga0070681_101627162	258
135	3300005459	Ga0068867_100037534	Ga0068867_1000375343	258
136	3300005459	Ga0068867_100048238	Ga0068867_1000482383	258
137	3300005459	Ga0068867_100050207	Ga0068867_1000502072	258
138	3300005459	Ga0068867_100105614	Ga0068867_1001056142	258
139	3300005459	Ga0068867_100206463	Ga0068867_1002064632	258
140	3300005466	Ga0070685_10004817	Ga0070685_100048173	258
141	3300005466	Ga0070685_10007675	Ga0070685_100076753	258
142	3300005466	Ga0070685_10011838	Ga0070685_100118382	258
143	3300005466	Ga0070685_10239303	Ga0070685_102393032	258
144	3300005471	Ga0070698_100006625	Ga0070698_10000662511	258
145	3300005471	Ga0070698_100165567	Ga0070698_1001655672	258
146	3300005530	Ga0070679_100066554	Ga0070679_1000665546	258
147	3300005530	Ga0070679_100485976	Ga0070679_1004859762	258
148	3300005535	Ga0070684_100044373	Ga0070684_1000443733	258
149	3300005535	Ga0070684_100098263	Ga0070684_1000982632	258
150	3300005539	Ga0068853_100013072	Ga0068853_1000130727	258
151	3300005539	Ga0068853_100063734	Ga0068853_1000637342	258
152	3300005539	Ga0068853_100076208	Ga0068853_1000762083	258
153	3300005539	Ga0068853_100307974	Ga0068853_1003079741	258
154	3300005543	Ga0070672_100021870	Ga0070672_1000218703	258
155	3300005544	Ga0070686_100021601	Ga0070686_1000216013	258
156	3300005544	Ga0070686_100260102	Ga0070686_1002601021	258
157	3300005548	Ga0070665_100000018	Ga0070665_100000018302	258
158	3300005563	Ga0068855_100155875	Ga0068855_1001558753	258
159	3300005563	Ga0068855_100166222	Ga0068855_1001662222	258
160	3300005564	Ga0070664_100085866	Ga0070664_1000858662	258
161	3300005564	Ga0070664_100158746	Ga0070664_1001587462	258
162	3300005577	Ga0068857_100022395	Ga0068857_1000223958	258
163	3300005577	Ga0068857_100023982	Ga0068857_1000239825	258
164	3300005577	Ga0068857_100025645	Ga0068857_1000256454	258
165	3300005577	Ga0068857_100368143	Ga0068857_1003681432	258
166	3300005578	Ga0068854_100105695	Ga0068854_1001056952	258
167	3300005578	Ga0068854_100413881	Ga0068854_1004138811	258
168	3300005616	Ga0068852_100009554	Ga0068852_1000095545	258
169	3300005616	Ga0068852_100159366	Ga0068852_1001593662	258
170	3300005616	Ga0068852_100176706	Ga0068852_1001767061	258
171	3300005617	Ga0068859_100000013	Ga0068859_10000001382	258
172	3300005617	Ga0068859_100016151	Ga0068859_1000161515	258
173	3300005617	Ga0068859_100097112	Ga0068859_1000971124	258
174	3300005617	Ga0068859_100220681	Ga0068859_1002206812	258
175	3300005618	Ga0068864_100004091	Ga0068864_1000040916	258
176	3300005618	Ga0068864_100043410	Ga0068864_1000434102	258
177	3300005618	Ga0068864_100112929	Ga0068864_1001129292	258
178	3300005718	Ga0068866_10069488	Ga0068866_100694882	258
179	3300005719	Ga0068861_100014667	Ga0068861_1000146673	258
180	3300005719	Ga0068861_100041153	Ga0068861_1000411533	258
181	3300005719	Ga0068861_100230344	Ga0068861_1002303442	258
182	3300005840	Ga0068870_10085570	Ga0068870_100855702	258
183	3300005841	Ga0068863_100017465	Ga0068863_1000174655	258
184	3300005841	Ga0068863_100095693	Ga0068863_1000956932	258
185	3300005841	Ga0068863_100147933	Ga0068863_1001479331	258
186	3300005841	Ga0068863_100388354	Ga0068863_1003883541	258
187	3300005841	Ga0068863_100487270	Ga0068863_1004872702	258
188	3300005842	Ga0068858_100005907	Ga0068858_10000590713	258
189	3300005842	Ga0068858_100064670	Ga0068858_1000646703	258
190	3300005842	Ga0068858_100110180	Ga0068858_1001101803	258
191	3300005843	Ga0068860_100000983	Ga0068860_10000098316	258
192	3300005843	Ga0068860_100003160	Ga0068860_10000316010	258
193	3300005843	Ga0068860_100084921	Ga0068860_1000849212	258
194	3300005843	Ga0068860_100183562	Ga0068860_1001835622	258
195	3300005843	Ga0068860_100295745	Ga0068860_1002957452	258
196	3300005844	Ga0068862_100041057	Ga0068862_1000410573	258
197	3300005844	Ga0068862_100103452	Ga0068862_1001034522	258
198	3300006163	Ga0070715_10021239	Ga0070715_100212393	258
199	3300006195	Ga0075366_10003142	Ga0075366_100031424	258
200	3300006195	Ga0075366_10045288	Ga0075366_100452882	258
201	3300006237	Ga0097621_100021201	Ga0097621_1000212013	258
202	3300006237	Ga0097621_100034636	Ga0097621_1000346364	258
203	3300006237	Ga0097621_100071274	Ga0097621_1000712743	258
204	3300006237	Ga0097621_100304743	Ga0097621_1003047432	258
205	3300006237	Ga0097621_100400083	Ga0097621_1004000832	258
206	3300006358	Ga0068871_100016275	Ga0068871_1000162753	258
207	3300006358	Ga0068871_100022431	Ga0068871_1000224315	258
208	3300006358	Ga0068871_100038051	Ga0068871_1000380512	258
209	3300006358	Ga0068871_100064884	Ga0068871_1000648843	258
210	3300006358	Ga0068871_100244047	Ga0068871_1002440472	258
211	3300006358	Ga0068871_100581258	Ga0068871_1005812581	258
212	3300006844	Ga0075428_100002594	Ga0075428_10000259413	258
213	3300006846	Ga0075430_100097687	Ga0075430_1000976871	258
214	3300006847	Ga0075431_100035835	Ga0075431_1000358353	258
215	3300006871	Ga0075434_100137119	Ga0075434_1001371192	258
216	3300006880	Ga0075429_100001013	Ga0075429_1000010134	258
217	3300006881	Ga0068865_100012800	Ga0068865_1000128006	258
218	3300006881	Ga0068865_100049974	Ga0068865_1000499742	258
219	3300006931	Ga0097620_100000013	Ga0097620_10000001382	258
220	3300006931	Ga0097620_100016151	Ga0097620_1000161513	258
221	3300006931	Ga0097620_100087076	Ga0097620_1000870764	258
222	3300006931	Ga0097620_100097101	Ga0097620_1000971014	258
223	3300006931	Ga0097620_100220703	Ga0097620_1002207032	258
224	3300009011	Ga0105251_10076876	Ga0105251_100768762	258
225	3300009093	Ga0105240_10111072	Ga0105240_101110722	258
226	3300009094	Ga0111539_10009424	Ga0111539_100094243	258
227	3300009094	Ga0111539_10233291	Ga0111539_102332912	258
228	3300009094	Ga0111539_10247096	Ga0111539_102470963	258
229	3300009101	Ga0105247_10001711	Ga0105247_1000171110	258
230	3300009101	Ga0105247_10010653	Ga0105247_100106534	258
231	3300009147	Ga0114129_10038739	Ga0114129_100387394	258
232	3300009174	Ga0105241_10002606	Ga0105241_1000260615	258
233	3300009174	Ga0105241_10023950	Ga0105241_100239507	258
234	3300009176	Ga0105242_10032727	Ga0105242_100327273	258
235	3300009177	Ga0105248_10534895	Ga0105248_105348952	258
236	3300009545	Ga0105237_10000186	Ga0105237_1000018639	258
237	3300009545	Ga0105237_10008863	Ga0105237_100088633	258
238	3300009545	Ga0105237_10126904	Ga0105237_101269043	258
239	3300009551	Ga0105238_10435747	Ga0105238_104357472	258
240	3300009553	Ga0105249_10001305	Ga0105249_100013053	258
241	3300009553	Ga0105249_10002125	Ga0105249_1000212513	258
242	3300009553	Ga0105249_10004589	Ga0105249_100045898	258
243	3300009553	Ga0105249_10017591	Ga0105249_100175913	258
244	3300009553	Ga0105249_10066289	Ga0105249_100662892	258
245	3300009553	Ga0105249_10153255	Ga0105249_101532553	258
246	3300009553	Ga0105249_10328861	Ga0105249_103288612	258
247	3300009553	Ga0105249_10520721	Ga0105249_105207212	258
248	3300009553	Ga0105249_10742354	Ga0105249_107423542	258
249	3300013104	Ga0157370_10058730	Ga0157370_100587306	258
250	3300013104	Ga0157370_10275811	Ga0157370_102758111	258
251	3300013296	Ga0157374_10045341	Ga0157374_100453412	258
252	3300013296	Ga0157374_10053269	Ga0157374_100532695	258
253	3300013296	Ga0157374_10112049	Ga0157374_101120492	258
254	3300013297	Ga0157378_10008006	Ga0157378_100080062	258
255	3300013297	Ga0157378_10111771	Ga0157378_101117713	258
256	3300013297	Ga0157378_10170276	Ga0157378_101702762	258
257	3300013297	Ga0157378_10290406	Ga0157378_102904062	258
258	3300013306	Ga0163162_10008657	Ga0163162_100086579	258
259	3300013306	Ga0163162_10009101	Ga0163162_100091017	258
260	3300013306	Ga0163162_10026861	Ga0163162_100268615	258
261	3300013306	Ga0163162_10083143	Ga0163162_100831433	258
262	3300013306	Ga0163162_10121898	Ga0163162_101218983	258
263	3300013306	Ga0163162_10360163	Ga0163162_103601631	258
264	3300013307	Ga0157372_10286234	Ga0157372_102862342	258
265	3300013308	Ga0157375_10009353	Ga0157375_100093533	258
266	3300013308	Ga0157375_10041368	Ga0157375_100413682	258
267	3300013308	Ga0157375_10063960	Ga0157375_100639602	258
268	3300013308	Ga0157375_10074839	Ga0157375_100748393	258
269	3300013308	Ga0157375_10084502	Ga0157375_100845023	258
270	3300013308	Ga0157375_10094282	Ga0157375_100942822	258
271	3300013308	Ga0157375_10120369	Ga0157375_101203693	258
272	3300013308	Ga0157375_10368231	Ga0157375_103682312	258
273	3300014325	Ga0163163_10000057	Ga0163163_1000005724	258
274	3300014325	Ga0163163_10168240	Ga0163163_101682402	258
275	3300014325	Ga0163163_10225243	Ga0163163_102252432	258
276	3300014325	Ga0163163_10237635	Ga0163163_102376352	258
277	3300014325	Ga0163163_10290436	Ga0163163_102904362	258
278	3300014325	Ga0163163_10309748	Ga0163163_103097483	258
279	3300014325	Ga0163163_10420332	Ga0163163_104203322	258
280	3300014325	Ga0163163_10472161	Ga0163163_104721612	258
281	3300014326	Ga0157380_10006905	Ga0157380_100069053	258
282	3300014326	Ga0157380_10048001	Ga0157380_100480013	258
283	3300014326	Ga0157380_10165884	Ga0157380_101658842	258
284	3300014745	Ga0157377_10002222	Ga0157377_100022228	258
285	3300014745	Ga0157377_10002409	Ga0157377_100024096	258
286	3300014745	Ga0157377_10018966	Ga0157377_100189663	258
287	3300014745	Ga0157377_10020120	Ga0157377_100201203	258
288	3300014968	Ga0157379_10069223	Ga0157379_100692232	258
289	3300014968	Ga0157379_10097793	Ga0157379_100977932	258
290	3300014968	Ga0157379_10217547	Ga0157379_102175472	258
291	3300014968	Ga0157379_10257809	Ga0157379_102578092	258
292	3300014968	Ga0157379_10281073	Ga0157379_102810732	258
293	3300014969	Ga0157376_10004238	Ga0157376_100042383	258
294	3300014969	Ga0157376_10004626	Ga0157376_100046268	258
295	3300014969	Ga0157376_10119623	Ga0157376_101196232	258
296	3300014969	Ga0157376_10142924	Ga0157376_101429242	258
297	3300014969	Ga0157376_10219966	Ga0157376_102199662	258
298	3300014969	Ga0157376_10221325	Ga0157376_102213252	258
299	3300014969	Ga0157376_10282503	Ga0157376_102825032	258
300	3300017792	Ga0163161_10003529	Ga0163161_100035295	258
301	3300017792	Ga0163161_10049038	Ga0163161_100490382	258
302	3300017792	Ga0163161_10199719	Ga0163161_101997192	258
303	3300017792	Ga0163161_10260724	Ga0163161_102607241	258
304	3300025321	Ga0207656_10023421	Ga0207656_100234212	258
305	3300025900	Ga0207710_10000874	Ga0207710_100008742	258
306	3300025900	Ga0207710_10016035	Ga0207710_100160353	258
307	3300025903	Ga0207680_10000512	Ga0207680_100005124	258
308	3300025903	Ga0207680_10048623	Ga0207680_100486233	258
309	3300025903	Ga0207680_10269105	Ga0207680_102691052	258
310	3300025904	Ga0207647_10128449	Ga0207647_101284492	258
311	3300025907	Ga0207645_10038906	Ga0207645_100389062	258
312	3300025908	Ga0207643_10014673	Ga0207643_100146732	258
313	3300025911	Ga0207654_10006014	Ga0207654_100060143	258
314	3300025911	Ga0207654_10390907	Ga0207654_103909071	258
315	3300025912	Ga0207707_10036687	Ga0207707_100366876	258
316	3300025913	Ga0207695_10213222	Ga0207695_102132222	258
317	3300025914	Ga0207671_10000521	Ga0207671_1000052118	258
318	3300025914	Ga0207671_10004556	Ga0207671_100045564	258
319	3300025917	Ga0207660_10060856	Ga0207660_100608561	258
320	3300025918	Ga0207662_10031042	Ga0207662_100310422	258
321	3300025919	Ga0207657_10150392	Ga0207657_101503922	258
322	3300025921	Ga0207652_10001622	Ga0207652_100016222	258
323	3300025922	Ga0207646_10046301	Ga0207646_100463013	258
324	3300025923	Ga0207681_10073501	Ga0207681_100735012	258
325	3300025923	Ga0207681_10096833	Ga0207681_100968332	258
326	3300025923	Ga0207681_10259912	Ga0207681_102599121	258
327	3300025923	Ga0207681_10388886	Ga0207681_103888861	258
328	3300025925	Ga0207650_10082799	Ga0207650_100827992	258
329	3300025926	Ga0207659_10004312	Ga0207659_100043128	258
330	3300025926	Ga0207659_10045925	Ga0207659_100459252	258
331	3300025926	Ga0207659_10070582	Ga0207659_100705822	258
332	3300025933	Ga0207706_10025516	Ga0207706_100255164	258
333	3300025933	Ga0207706_10052951	Ga0207706_100529513	258
334	3300025933	Ga0207706_10112733	Ga0207706_101127332	258
335	3300025933	Ga0207706_10247474	Ga0207706_102474742	258
336	3300025934	Ga0207686_10000554	Ga0207686_100005546	258
337	3300025934	Ga0207686_10043302	Ga0207686_100433022	258
338	3300025934	Ga0207686_10044875	Ga0207686_100448753	258
339	3300025936	Ga0207670_10004053	Ga0207670_100040536	258
340	3300025936	Ga0207670_10006674	Ga0207670_100066745	258
341	3300025936	Ga0207670_10068385	Ga0207670_100683852	258
342	3300025938	Ga0207704_10019507	Ga0207704_100195074	258
343	3300025938	Ga0207704_10133653	Ga0207704_101336532	258
344	3300025940	Ga0207691_10019542	Ga0207691_100195422	258
345	3300025940	Ga0207691_10037004	Ga0207691_100370043	258
346	3300025940	Ga0207691_10316030	Ga0207691_103160302	258
347	3300025941	Ga0207711_10334938	Ga0207711_103349381	258
348	3300025942	Ga0207689_10000782	Ga0207689_1000078226	258
349	3300025942	Ga0207689_10004002	Ga0207689_100040027	258
350	3300025942	Ga0207689_10008139	Ga0207689_100081396	258
351	3300025942	Ga0207689_10020924	Ga0207689_100209248	258
352	3300025942	Ga0207689_10034466	Ga0207689_100344665	258
353	3300025942	Ga0207689_10048636	Ga0207689_100486363	258
354	3300025942	Ga0207689_10058454	Ga0207689_100584542	258
355	3300025944	Ga0207661_10067379	Ga0207661_100673791	258
356	3300025945	Ga0207679_10078585	Ga0207679_100785853	258
357	3300025960	Ga0207651_10002163	Ga0207651_100021633	258
358	3300025960	Ga0207651_10057594	Ga0207651_100575943	258
359	3300025961	Ga0207712_10000635	Ga0207712_100006356	258
360	3300025961	Ga0207712_10002164	Ga0207712_100021648	258
361	3300025961	Ga0207712_10003522	Ga0207712_100035226	258
362	3300025961	Ga0207712_10009863	Ga0207712_100098634	258
363	3300025972	Ga0207668_10170930	Ga0207668_101709302	258
364	3300025981	Ga0207640_10126585	Ga0207640_101265852	258
365	3300025986	Ga0207658_10011195	Ga0207658_100111953	258
366	3300025986	Ga0207658_10063087	Ga0207658_100630873	258
367	3300025986	Ga0207658_10154737	Ga0207658_101547372	258
368	3300026023	Ga0207677_10004870	Ga0207677_100048707	258
369	3300026023	Ga0207677_10032091	Ga0207677_100320912	258
370	3300026023	Ga0207677_10228498	Ga0207677_102284982	258
371	3300026023	Ga0207677_10260114	Ga0207677_102601142	258
372	3300026035	Ga0207703_10006469	Ga0207703_100064695	258
373	3300026035	Ga0207703_10058717	Ga0207703_100587173	258
374	3300026035	Ga0207703_10095467	Ga0207703_100954672	258
375	3300026041	Ga0207639_10007559	Ga0207639_100075593	258
376	3300026041	Ga0207639_10054223	Ga0207639_100542232	258
377	3300026041	Ga0207639_10225606	Ga0207639_102256062	258
378	3300026041	Ga0207639_10374791	Ga0207639_103747912	258
379	3300026075	Ga0207708_10158070	Ga0207708_101580702	258
380	3300026088	Ga0207641_10002898	Ga0207641_100028988	258
381	3300026088	Ga0207641_10003127	Ga0207641_1000312710	258
382	3300026088	Ga0207641_10135234	Ga0207641_101352342	258
383	3300026088	Ga0207641_10200213	Ga0207641_102002132	258
384	3300026088	Ga0207641_10780457	Ga0207641_107804571	258
385	3300026089	Ga0207648_10001661	Ga0207648_100016615	258
386	3300026089	Ga0207648_10028165	Ga0207648_100281654	258
387	3300026089	Ga0207648_10043485	Ga0207648_100434854	258
388	3300026089	Ga0207648_10080831	Ga0207648_100808312	258
389	3300026089	Ga0207648_10334084	Ga0207648_103340842	258
390	3300026095	Ga0207676_10003002	Ga0207676_100030026	258
391	3300026095	Ga0207676_10042407	Ga0207676_100424073	258
392	3300026095	Ga0207676_10060511	Ga0207676_100605113	258
393	3300026095	Ga0207676_10154183	Ga0207676_101541832	258
394	3300026095	Ga0207676_10155082	Ga0207676_101550822	258
395	3300026095	Ga0207676_10193277	Ga0207676_101932772	258
396	3300026095	Ga0207676_10256693	Ga0207676_102566932	258
397	3300026116	Ga0207674_10012956	Ga0207674_100129564	258
398	3300026116	Ga0207674_10079536	Ga0207674_100795366	258
399	3300026116	Ga0207674_10081002	Ga0207674_100810023	258
400	3300026116	Ga0207674_10378000	Ga0207674_103780002	258
401	3300026118	Ga0207675_100000272	Ga0207675_1000002724	258
402	3300026118	Ga0207675_100052041	Ga0207675_1000520413	258
403	3300026118	Ga0207675_100116029	Ga0207675_1001160293	258
404	3300026118	Ga0207675_100130503	Ga0207675_1001305032	258
405	3300026118	Ga0207675_100165313	Ga0207675_1001653132	258
406	3300026118	Ga0207675_100172420	Ga0207675_1001724202	258
407	3300026118	Ga0207675_100173161	Ga0207675_1001731612	258
408	3300026118	Ga0207675_100318400	Ga0207675_1003184001	258
409	3300026142	Ga0207698_10033631	Ga0207698_100336312	258
410	3300026142	Ga0207698_10040878	Ga0207698_100408783	258
411	3300026142	Ga0207698_10057018	Ga0207698_100570183	258
412	3300027907	Ga0207428_10207881	Ga0207428_102078811	258
413	3300028379	Ga0268266_10132102	Ga0268266_101321022	258
414	3300028379	Ga0268266_10214224	Ga0268266_102142241	258
415	3300028380	Ga0268265_10013806	Ga0268265_100138063	258
416	3300028381	Ga0268264_10001326	Ga0268264_1000132623	258
417	3300028381	Ga0268264_10002002	Ga0268264_1000200215	258
418	3300028381	Ga0268264_10136741	Ga0268264_101367412	258
419	3300028381	Ga0268264_10209641	Ga0268264_102096412	258
420	3300028381	Ga0268264_10354518	Ga0268264_103545181	258
421	3300028786	Ga0307517_10009936	Ga0307517_100099363	258
422	3300028794	Ga0307515_10000021	Ga0307515_10000021346	258
423	3300031456	Ga0307513_10054961	Ga0307513_100549613	258
424	3300031507	Ga0307509_10260494	Ga0307509_102604942	258
425	3300031616	Ga0307508_10000981	Ga0307508_1000098112	258
426	3300031616	Ga0307508_10185726	Ga0307508_101857261	258
427	3300031995	Ga0307409_100784745	Ga0307409_1007847451	258
428	3300033180	Ga0307510_10000165	Ga0307510_1000016534	258
429	3300035089	Ga0373944_0023675	Ga0373944_0023675_834_1724	258
430	3300041505	Ga0451849_0799415	Ga0451849_0799415_796_1677	258
431	3300042876	Ga0451577_0005807	Ga0451577_0005807_7401_8282	258
432	3300045051	Ga0451576_0611163	Ga0451576_0611163_165_1055	258
433	3300046459	Ga0495629_0094116	Ga0495629_0094116_325_1206	258
434	3300046460	Ga0495638_0043082	Ga0495638_0043082_116_997	258
435	3300046473	Ga0495582_0208141	Ga0495582_0208141_164_1045	258
436	3300046517	Ga0495630_0162375	Ga0495630_0162375_309_1199	258
437	3300046522	Ga0495643_0040273	Ga0495643_0040273_722_1600	258
438	3300046524	Ga0495648_0003175	Ga0495648_0003175_7920_8801	258
439	3300046533	Ga0495640_0260512	Ga0495640_0260512_177_1067	258
440	3300046536	Ga0495587_0064904	Ga0495587_0064904_792_1682	258
441	3300046558	Ga0495633_0115541	Ga0495633_0115541_21_902	258
442	3300046616	Ga0495668_0000099	Ga0495668_0000099_14161_15054	258
443	3300046660	Ga0495625_0048268	Ga0495625_0048268_347_1228	258
444	3300046678	Ga0495599_0167239	Ga0495599_0167239_288_1178	258
445	3300047320	Ga0495672_0074698	Ga0495672_0074698_14_895	258
446	3300047471	Ga0495684_0301353	Ga0495684_0301353_238_1128	258
447	3300048918	Ga0496115_0180175	Ga0496115_0180175_117_998	258
448	3300048918	Ga0496115_0260654	Ga0496115_0260654_334_1215	258
449	3300050493	nmdc:mga0k408_296013_c1	nmdc:mga0k408_296013_c1_35_913	258
450	3300050507	nmdc:mga05p37_43835_c1	nmdc:mga05p37_43835_c1_4387_5265	258
451	3300050508	nmdc:mga09592_13482_c1	nmdc:mga09592_13482_c1_2113_2994	258
452	3300050509	nmdc:mga0qj67_214216_c1	nmdc:mga0qj67_214216_c1_447_1328	258
453	3300050510	nmdc:mga06r32_27334_c1	nmdc:mga06r32_27334_c1_2026_2907	258
454	3300050511	nmdc:mga08y16_389898_c1	nmdc:mga08y16_389898_c1_48_929	258
455	3300050512	nmdc:mga0n895_133211_c1	nmdc:mga0n895_133211_c1_564_1442	258
456	3300053096	Ga0500641_0055063	Ga0500641_0055063_153_1040	258
457	3300053146	Ga0500588_0002638	Ga0500588_0002638_212_1093	258
458	3300053156	Ga0500622_0002308	Ga0500622_0002308_7091_7972	258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

30

314

0.71 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8i3a-assembly1.cif.gz_B	cryo-em structure of abscisic acid transporter atabcg25 in outward conformation	0.6934	133	253
8i3b-assembly1.cif.gz_B	cryo-em structure of abscisic acid transporter atabcg25 in nanodisc	0.6811	133	253
8i3d-assembly1.cif.gz_B	cryo-em structure of abscisic acid transporter atabcg25	0.6794	133	254
5do7-assembly1.cif.gz_A	crystal structure of the human sterol transporter abcg5/abcg8	0.5873	137	258
5do7-assembly2.cif.gz_C	crystal structure of the human sterol transporter abcg5/abcg8	0.5834	137	258

ID	Description	Score	Start	End	Superfamily
af_Q9VMM9_322_706_3.40.1710.10	Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain	0.4696	32	248	3.40.1710.10
af_Q9VSE7_222_481_1.20.1070.10	Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins	0.4511	139	253	1.20.1070.10
af_Q9UPN3_4415_4574_1.20.58.60	Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;	0.4325	130	253	1.20.58.60
af_Q86P18_394_773_3.40.1710.10	Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain	0.43	22	251	3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10	Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain	0.4218	29	250	3.40.1710.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2H0YZ92-F1-model_v4	ABC transporter permease	0.8794	112	258	GO:0016020
AF-A0A2H0YZ92-F1-model_v4	ABC transporter permease	0.8733	112	258	GO:0016020
AF-A0A6B3HHE6-F1-model_v4	ABC transporter permease	0.8447	127	258	GO:0016020
AF-A0A520EBT3-F1-model_v4	ABC transporter permease	0.8411	125	258	GO:0016020
AF-A0A357Z6T5-F1-model_v4	ABC transporter permease	0.8269	2	258	GO:0005886 GO:0140359

Feature Viewer

pLDDT	pTM	Quality
61.66	0.6	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448272

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

30

314

0.71

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map