F447952

General Info

Members Datasets Scaffolds Average Seq Length
457 156 457 188

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100024083|Ga0070708_1000240835
Length 188
Sequence MGSMRWMRWWPVIVLVALAVWAAPVSDPVWEALRAPGSVIVLRHSHVPGASDPPGAKLDDCSTQRNLDEDGRAQARRIGQAFRKYGIVVGAVLSSPRCRCLDTARLAFGRAQAWGPLQGSLDAEARRREVVEIRKAIAEHRSGALLVLVTHGNVITDLAGPRVPMGSLVVLRRSPNGRHTVAGQLHVN

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.31
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10050061 3300003203 Unclassified 1405
2 Ga0065707_10031291 3300005295 Bacteria 1160
3 Ga0065707_10536834 3300005295 Unclassified 731
4 Ga0070690_100152787 3300005330 Bacteria 1576
5 Ga0070690_100342551 3300005330 Unclassified 1083
6 Ga0070670_100564788 3300005331 Bacteria 1016
7 Ga0070680_100008143 3300005336 Bacteria 8008
8 Ga0070680_100386999 3300005336 Bacteria 1191
9 Ga0070680_100413226 3300005336 Bacteria 1151
10 Ga0070691_10025599 3300005341 Bacteria 2748
11 Ga0070692_10212165 3300005345 Unclassified 1140
12 Ga0070668_100195359 3300005347 Bacteria 1659
13 Ga0070669_100033913 3300005353 Bacteria 3694
14 Ga0070669_100261889 3300005353 Unclassified 1380
15 Ga0070688_100669817 3300005365 Bacteria 801
16 Ga0070703_10149011 3300005406 Unclassified 877
17 Ga0070701_10034435 3300005438 Unclassified 2536
18 Ga0070705_100004854 3300005440 Bacteria 6543
19 Ga0070705_100402229 3300005440 Unclassified 1014
20 Ga0070705_100535628 3300005440 Unclassified 895
21 Ga0070694_100037582 3300005444 Bacteria 3211
22 Ga0070694_100072480 3300005444 Bacteria 2376
23 Ga0070694_100452738 3300005444 Bacteria 1014
24 Ga0070694_100563193 3300005444 Unclassified 914
25 Ga0070708_100024083 3300005445 Bacteria 5185
26 Ga0070708_100055011 3300005445 Bacteria 3537
27 Ga0070708_100087518 3300005445 Bacteria 2831
28 Ga0070681_10018073 3300005458 Bacteria 7048
29 Ga0070681_10995225 3300005458 Bacteria 758
30 Ga0068867_100282741 3300005459 Unclassified 1361
31 Ga0070706_100079715 3300005467 Unclassified 3031
32 Ga0070706_100142571 3300005467 Bacteria 2236
33 Ga0070706_100257975 3300005467 Bacteria 1627
34 Ga0070707_100013325 3300005468 Bacteria 7691
35 Ga0070707_100331388 3300005468 Bacteria 1479
36 Ga0070707_100587067 3300005468 Bacteria 1076
37 Ga0070707_100587632 3300005468 Bacteria 1076
38 Ga0070698_100070498 3300005471 Bacteria 3507
39 Ga0070698_100268468 3300005471 Bacteria 1638
40 Ga0070698_100525579 3300005471 Bacteria 1122
41 Ga0070699_100004599 3300005518 Bacteria 12206
42 Ga0070699_100081165 3300005518 Bacteria 2827
43 Ga0070699_100190298 3300005518 Bacteria 1823
44 Ga0070699_100293943 3300005518 Bacteria 1457
45 Ga0070699_100305979 3300005518 Bacteria 1426
46 Ga0070699_100369890 3300005518 Bacteria 1293
47 Ga0070699_100388138 3300005518 Bacteria 1261
48 Ga0070699_101079916 3300005518 Unclassified 736
49 Ga0070699_101226416 3300005518 Unclassified 688
50 Ga0070679_100095359 3300005530 Bacteria 2963
51 Ga0070697_100142228 3300005536 Bacteria 2018
52 Ga0070697_100521233 3300005536 Bacteria 1040
53 Ga0070686_100109446 3300005544 Unclassified 1880
54 Ga0070686_100240468 3300005544 Bacteria 1318
55 Ga0070695_100048473 3300005545 Unclassified 2716
56 Ga0070695_100119805 3300005545 Bacteria 1799
57 Ga0070696_100059223 3300005546 Bacteria 2676
58 Ga0070696_100111725 3300005546 Bacteria 1968
59 Ga0070696_100792802 3300005546 Unclassified 779
60 Ga0070693_100515568 3300005547 Unclassified 850
61 Ga0070704_100263406 3300005549 Bacteria 1421
62 Ga0070704_100473237 3300005549 Bacteria 1083
63 Ga0070704_100513047 3300005549 Bacteria 1042
64 Ga0070704_100534036 3300005549 Unclassified 1023
65 Ga0068855_101187353 3300005563 Unclassified 794
66 Ga0068857_100068023 3300005577 Bacteria 3171
67 Ga0068859_100333347 3300005617 Bacteria 1611
68 Ga0068859_100363783 3300005617 Unclassified 1542
69 Ga0068859_100424180 3300005617 Bacteria 1426
70 Ga0068859_100653015 3300005617 Bacteria 1144
71 Ga0068864_100822820 3300005618 Bacteria 914
72 Ga0068866_10204479 3300005718 Unclassified 1182
73 Ga0068861_100328869 3300005719 Bacteria 1333
74 Ga0068858_101085940 3300005842 Bacteria 785
75 Ga0068860_100538670 3300005843 Bacteria 1169
76 Ga0068860_101026497 3300005843 Bacteria 843
77 Ga0068862_100070575 3300005844 Bacteria 3016
78 Ga0068862_100109472 3300005844 Bacteria 2423
79 Ga0068862_100835629 3300005844 Bacteria 902
80 Ga0081455_10126881 3300005937 Bacteria 2001
81 Ga0081540_1035467 3300005983 Bacteria 2674
82 Ga0081539_10000792 3300005985 Bacteria 61415
83 Ga0075432_10037371 3300006058 Unclassified 1690
84 Ga0075428_100000358 3300006844 Bacteria 45303
85 Ga0075428_100024084 3300006844 Bacteria 6736
86 Ga0075428_100038213 3300006844 Bacteria 5282
87 Ga0075428_100085532 3300006844 Bacteria 3439
88 Ga0075428_100130675 3300006844 Bacteria 2732
89 Ga0075428_100462570 3300006844 Bacteria 1358
90 Ga0075428_100532386 3300006844 Unclassified 1256
91 Ga0075428_100936200 3300006844 Bacteria 918
92 Ga0075428_101809841 3300006844 Bacteria 636
93 Ga0075430_100041128 3300006846 Bacteria 3911
94 Ga0075430_100116775 3300006846 Unclassified 2224
95 Ga0075430_100173989 3300006846 Bacteria 1791
96 Ga0075430_100213438 3300006846 Bacteria 1601
97 Ga0075430_100236133 3300006846 Unclassified 1515
98 Ga0075430_100344383 3300006846 Bacteria 1231
99 Ga0075430_100555919 3300006846 Unclassified 947
100 Ga0075431_100000329 3300006847 Bacteria 37637
101 Ga0075431_100002330 3300006847 Bacteria 18257
102 Ga0075431_100013329 3300006847 Bacteria 8310
103 Ga0075431_100019893 3300006847 Bacteria 6855
104 Ga0075431_100040124 3300006847 Bacteria 4824
105 Ga0075431_100060700 3300006847 Bacteria 3901
106 Ga0075431_100188917 3300006847 Unclassified 2111
107 Ga0075431_100249983 3300006847 Bacteria 1802
108 Ga0075431_100267648 3300006847 Bacteria 1733
109 Ga0075431_100273410 3300006847 Bacteria 1711
110 Ga0075431_100447168 3300006847 Bacteria 1288
111 Ga0075433_10076942 3300006852 Unclassified 2939
112 Ga0075433_10100229 3300006852 Bacteria 2564
113 Ga0075433_10101213 3300006852 Bacteria 2551
114 Ga0075433_10137189 3300006852 Bacteria 2174
115 Ga0075433_10141582 3300006852 Unclassified 2137
116 Ga0075433_10167871 3300006852 Unclassified 1953
117 Ga0075433_10225435 3300006852 Unclassified 1665
118 Ga0075433_10426447 3300006852 Bacteria 1169
119 Ga0075433_10437323 3300006852 Unclassified 1153
120 Ga0075433_10531938 3300006852 Bacteria 1034
121 Ga0075433_10658124 3300006852 Bacteria 918
122 Ga0075434_100024207 3300006871 Bacteria 5934
123 Ga0075434_100067906 3300006871 Bacteria 3551
124 Ga0075434_100179444 3300006871 Bacteria 2137
125 Ga0075434_100192242 3300006871 Bacteria 2061
126 Ga0075434_100193638 3300006871 Bacteria 2053
127 Ga0075434_100379010 3300006871 Bacteria 1435
128 Ga0075434_100415461 3300006871 Bacteria 1366
129 Ga0075434_100467971 3300006871 Bacteria 1282
130 Ga0075429_100000600 3300006880 Bacteria 27654
131 Ga0075429_100001808 3300006880 Bacteria 17714
132 Ga0075429_100012391 3300006880 Bacteria 7397
133 Ga0075429_100015527 3300006880 Bacteria 6598
134 Ga0075429_100026527 3300006880 Bacteria 5032
135 Ga0075429_100097537 3300006880 Unclassified 2564
136 Ga0075429_100098054 3300006880 Bacteria 2557
137 Ga0075429_100166358 3300006880 Bacteria 1932
138 Ga0075429_100979505 3300006880 Unclassified 739
139 Ga0068865_101089564 3300006881 Unclassified 703
140 Ga0075436_100013261 3300006914 Bacteria 5648
141 Ga0075436_100049624 3300006914 Bacteria 2896
142 Ga0075436_100062064 3300006914 Bacteria 2583
143 Ga0075436_100206327 3300006914 Bacteria 1393
144 Ga0075436_100322997 3300006914 Unclassified 1109
145 Ga0097620_100333353 3300006931 Bacteria 1611
146 Ga0097620_100363779 3300006931 Unclassified 1542
147 Ga0097620_100424159 3300006931 Bacteria 1426
148 Ga0097620_100652914 3300006931 Bacteria 1144
149 Ga0075435_100011295 3300007076 Bacteria 6561
150 Ga0075435_100025472 3300007076 Bacteria 4605
151 Ga0075435_100037488 3300007076 Bacteria 3860
152 Ga0075435_100054786 3300007076 Bacteria 3219
153 Ga0075435_100131581 3300007076 Bacteria 2094
154 Ga0075435_100148363 3300007076 Unclassified 1971
155 Ga0075435_100292363 3300007076 Bacteria 1392
156 Ga0075435_100303188 3300007076 Bacteria 1366
157 Ga0099794_10060663 3300007265 Bacteria 1837
158 Ga0099794_10155736 3300007265 Unclassified 1161
159 Ga0111539_10002746 3300009094 Bacteria 23359
160 Ga0111539_10004956 3300009094 Bacteria 17321
161 Ga0111539_11925526 3300009094 Unclassified 685
162 Ga0114129_10000042 3300009147 Bacteria 107385
163 Ga0114129_10001581 3300009147 Bacteria 30943
164 Ga0114129_10004909 3300009147 Bacteria 18875
165 Ga0114129_10007626 3300009147 Bacteria 15396
166 Ga0114129_10013451 3300009147 Bacteria 11661
167 Ga0114129_10085235 3300009147 Bacteria 4383
168 Ga0114129_10130918 3300009147 Bacteria 3446
169 Ga0114129_10214439 3300009147 Bacteria 2600
170 Ga0114129_10263824 3300009147 Bacteria 2307
171 Ga0114129_10264334 3300009147 Unclassified 2304
172 Ga0114129_10325154 3300009147 Bacteria 2044
173 Ga0114129_10339173 3300009147 Bacteria 1994
174 Ga0114129_10452276 3300009147 Bacteria 1684
175 Ga0114129_10605244 3300009147 Bacteria 1419
176 Ga0114129_10754911 3300009147 Unclassified 1245
177 Ga0114129_10781677 3300009147 Unclassified 1220
178 Ga0114129_10923033 3300009147 Bacteria 1105
179 Ga0105243_10516591 3300009148 Unclassified 1135
180 Ga0105243_10995960 3300009148 Bacteria 840
181 Ga0105241_10041334 3300009174 Bacteria 3483
182 Ga0105241_10125233 3300009174 Bacteria 2074
183 Ga0105242_10066701 3300009176 Unclassified 2973
184 Ga0105242_10575359 3300009176 Bacteria 1084
185 Ga0105248_10061602 3300009177 Bacteria 4213
186 Ga0105249_10096287 3300009553 Bacteria 2776
187 Ga0105249_10151005 3300009553 Bacteria 2237
188 Ga0105249_10309827 3300009553 Unclassified 1587
189 Ga0105249_10410091 3300009553 Unclassified 1387
190 Ga0105249_10443570 3300009553 Bacteria 1336
191 Ga0105249_10639594 3300009553 Unclassified 1121
192 Ga0105249_10906382 3300009553 Bacteria 949
193 Ga0157378_10269241 3300013297 Unclassified 1638
194 Ga0157378_11045728 3300013297 Bacteria 852
195 Ga0163162_10039807 3300013306 Bacteria 4697
196 Ga0163162_10761904 3300013306 Unclassified 1087
197 Ga0157375_10219690 3300013308 Bacteria 2059
198 Ga0157375_11175185 3300013308 Unclassified 899
199 Ga0157380_10417877 3300014326 Bacteria 1278
200 Ga0207653_10004662 3300025885 Bacteria 4295
201 Ga0207684_10005261 3300025910 Bacteria 12002
202 Ga0207684_10014903 3300025910 Bacteria 6690
203 Ga0207684_10122513 3300025910 Bacteria 2230
204 Ga0207684_10134149 3300025910 Bacteria 2125
205 Ga0207684_10297851 3300025910 Bacteria 1390
206 Ga0207684_10412439 3300025910 Bacteria 1161
207 Ga0207662_10117551 3300025918 Bacteria 1664
208 Ga0207652_10077205 3300025921 Bacteria 2906
209 Ga0207646_10013815 3300025922 Bacteria 7700
210 Ga0207646_10021610 3300025922 Bacteria 5941
211 Ga0207646_10024755 3300025922 Bacteria 5495
212 Ga0207646_10029245 3300025922 Bacteria 5010
213 Ga0207646_10266193 3300025922 Bacteria 1549
214 Ga0207681_10227914 3300025923 Unclassified 1445
215 Ga0207650_10386886 3300025925 Bacteria 1156
216 Ga0207690_10101606 3300025932 Bacteria 2055
217 Ga0207706_10068401 3300025933 Unclassified 3125
218 Ga0207686_10011003 3300025934 Unclassified 4939
219 Ga0207670_10549215 3300025936 Unclassified 944
220 Ga0207704_10227705 3300025938 Bacteria 1384
221 Ga0207704_10568094 3300025938 Unclassified 924
222 Ga0207711_10085904 3300025941 Bacteria 2757
223 Ga0207689_10085903 3300025942 Unclassified 2586
224 Ga0207712_10067436 3300025961 Bacteria 2561
225 Ga0207712_10128862 3300025961 Bacteria 1925
226 Ga0207712_10215393 3300025961 Bacteria 1532
227 Ga0207712_10498629 3300025961 Bacteria 1040
228 Ga0207712_10762659 3300025961 Bacteria 848
229 Ga0207668_10176914 3300025972 Bacteria 1679
230 Ga0207668_10242230 3300025972 Bacteria 1460
231 Ga0207708_10098286 3300026075 Bacteria 2263
232 Ga0207648_10082000 3300026089 Bacteria 2812
233 Ga0207648_10126433 3300026089 Bacteria 2249
234 Ga0207648_10158188 3300026089 Bacteria 2000
235 Ga0207676_10234111 3300026095 Bacteria 1644
236 Ga0207676_11031706 3300026095 Bacteria 811
237 Ga0207674_10108854 3300026116 Bacteria 2747
238 Ga0207674_10550887 3300026116 Bacteria 1114
239 Ga0207675_100157836 3300026118 Bacteria 2162
240 Ga0209588_1036688 3300027671 Bacteria 1578
241 Ga0209588_1075755 3300027671 Unclassified 1087
242 Ga0209998_10144976 3300027717 Bacteria 608
243 Ga0207428_10000213 3300027907 Bacteria 80079
244 Ga0207428_10005402 3300027907 Bacteria 11920
245 Ga0268265_10315652 3300028380 Bacteria 1413
246 Ga0268265_10457476 3300028380 Bacteria 1193
247 Ga0268265_10642718 3300028380 Unclassified 1019
248 Ga0268264_10075014 3300028381 Bacteria 2875
249 Ga0268264_10148745 3300028381 Bacteria 2097
250 Ga0268264_10258702 3300028381 Bacteria 1620
251 Ga0268264_10483311 3300028381 Bacteria 1205
252 Ga0268264_11267627 3300028381 Bacteria 747
253 Ga0307408_100027980 3300031548 Bacteria 3891
254 Ga0307416_100171496 3300032002 Bacteria 2020
255 Ga0307411_10076040 3300032005 Bacteria 2294
256 Ga0373928_0124207 3300035084 Bacteria 694
257 Ga0373940_0009623 3300035088 Bacteria 2251
258 Ga0373952_0057159 3300035092 Unclassified 945
259 Ga0373932_0094125 3300035112 Bacteria 966
260 Ga0373941_0001864 3300035115 Bacteria 4556
261 Ga0373960_0064470 3300035121 Bacteria 1119
262 Ga0373962_0013747 3300035242 Bacteria 2054
263 Ga0395899_0053967 3300037312 Bacteria 2975
264 Ga0395899_0310026 3300037312 Bacteria 1066
265 Ga0395900_0001971 3300037418 Bacteria 23170
266 Ga0395900_0142867 3300037418 Bacteria 2450
267 Ga0395898_0008700 3300037466 Bacteria 10711
268 Ga0395901_0011681 3300038443 Bacteria 8898
269 Ga0451577_0087533 3300042876 Bacteria 2779
270 Ga0451576_0286434 3300045051 Bacteria 1722
271 Ga0451576_0501211 3300045051 Bacteria 1276
272 Ga0495603_0088528 3300046455 Bacteria 1812
273 Ga0495580_0001345 3300046472 Bacteria 21647
274 Ga0495642_0011028 3300046528 Bacteria 3467
275 Ga0495670_0219724 3300046691 Bacteria 1009
276 Ga0495636_0159032 3300047318 Bacteria 1017
277 Ga0496102_0193940 3300048905 Bacteria 1914
278 Ga0496103_0017323 3300048906 Bacteria 4312
279 Ga0496106_0111110 3300048909 Bacteria 2134
280 Ga0496106_0337618 3300048909 Bacteria 1210
281 Ga0496106_0429462 3300048909 Unclassified 1062
282 Ga0496107_0327638 3300048910 Bacteria 1140
283 Ga0501031_0006928 3300049568 Bacteria 7399
284 Ga0501033_0272117 3300049570 Bacteria 1197
285 Ga0501034_0257441 3300049571 Unclassified 1689
286 Ga0501036_0001299 3300049572 Bacteria 19129
287 Ga0501036_0029098 3300049572 Bacteria 4670
288 Ga0501037_0083957 3300049573 Eukaryota 2307
289 Ga0501038_0001040 3300049574 Bacteria 25051
290 Ga0501038_0050249 3300049574 Bacteria 3603
291 Ga0501039_0001181 3300049575 Bacteria 19129
292 Ga0501039_0016839 3300049575 Bacteria 5603
293 Ga0501039_0182739 3300049575 Bacteria 1649
294 Ga0501039_0585933 3300049575 Bacteria 874
295 Ga0501040_0002124 3300049576 Bacteria 12779
296 Ga0501040_0021372 3300049576 Bacteria 4322
297 Ga0501040_0149087 3300049576 Bacteria 1649
298 Ga0501040_0202579 3300049576 Bacteria 1409
299 Ga0501040_0345333 3300049576 Bacteria 1066
300 Ga0501041_0001037 3300049577 Bacteria 15209
301 Ga0501041_0001659 3300049577 Bacteria 12455
302 Ga0501041_0005941 3300049577 Bacteria 7142
303 Ga0501041_0013692 3300049577 Bacteria 4811
304 Ga0501042_0000469 3300049578 Bacteria 20886
305 Ga0501042_0001126 3300049578 Bacteria 15404
306 Ga0501042_0056717 3300049578 Unclassified 2795
307 Ga0501042_0200925 3300049578 Bacteria 1437
308 Ga0501043_0018672 3300049579 Bacteria 5443
309 Ga0501043_0829220 3300049579 Bacteria 667
310 Ga0501046_0003123 3300049580 Bacteria 15290
311 Ga0501046_0017334 3300049580 Bacteria 6013
312 Ga0501046_0071485 3300049580 Bacteria 2696
313 Ga0501046_0301964 3300049580 Bacteria 1169
314 Ga0501048_0005244 3300049582 Bacteria 9874
315 Ga0501048_0037523 3300049582 Bacteria 3480
316 Ga0501067_0034204 3300049583 Bacteria 2820
317 Ga0501068_0025052 3300049584 Bacteria 3507
318 Ga0501068_0115432 3300049584 Bacteria 1672
319 Ga0501068_0121407 3300049584 Bacteria 1629
320 Ga0501068_0172767 3300049584 Bacteria 1364
321 Ga0501069_0009457 3300049585 Bacteria 5144
322 Ga0501069_0361052 3300049585 Unclassified 857
323 Ga0501069_0586259 3300049585 Bacteria 668
324 Ga0501070_0077688 3300049586 Eukaryota 2747
325 Ga0501070_0625004 3300049586 Bacteria 857
326 Ga0501071_0002392 3300049587 Bacteria 11368
327 Ga0501071_0013960 3300049587 Bacteria 5488
328 Ga0501071_0015685 3300049587 Bacteria 5203
329 Ga0501072_0004123 3300049588 Bacteria 11000
330 Ga0501072_0013240 3300049588 Bacteria 6317
331 Ga0501072_0016666 3300049588 Bacteria 5644
332 Ga0501072_0056904 3300049588 Bacteria 3081
333 Ga0501072_0059342 3300049588 Bacteria 3016
334 Ga0501074_0001367 3300049590 Bacteria 16187
335 Ga0501074_0114172 3300049590 Bacteria 1932
336 Ga0501074_0168275 3300049590 Bacteria 1565
337 Ga0501074_0195928 3300049590 Bacteria 1440
338 Ga0501075_0000021 3300049591 Bacteria 66125
339 Ga0501075_0000050 3300049591 Bacteria 49555
340 Ga0501075_0014584 3300049591 Bacteria 5633
341 Ga0501075_0045073 3300049591 Bacteria 3310
342 Ga0501075_0291425 3300049591 Bacteria 1243
343 Ga0501076_0000008 3300049592 Bacteria 121885
344 Ga0501076_0001180 3300049592 Bacteria 17294
345 Ga0501076_0002521 3300049592 Bacteria 12606
346 Ga0501076_0041275 3300049592 Unclassified 3629
347 Ga0501076_0080883 3300049592 Bacteria 2608
348 Ga0501076_0327870 3300049592 Bacteria 1256
349 Ga0501077_0000022 3300049593 Bacteria 77945
350 Ga0501077_0027492 3300049593 Bacteria 3612
351 Ga0501077_0093064 3300049593 Bacteria 1910
352 Ga0501077_0144751 3300049593 Bacteria 1508
353 Ga0501077_0229375 3300049593 Bacteria 1180
354 Ga0501079_0003078 3300049741 Bacteria 12208
355 Ga0501079_0034558 3300049741 Bacteria 3890
356 Ga0501079_0069895 3300049741 Bacteria 2710
357 Ga0501079_0098135 3300049741 Bacteria 2271
358 Ga0501079_0795450 3300049741 Bacteria 744
359 Ga0501080_0001332 3300049742 Bacteria 20587
360 Ga0501080_0219369 3300049742 Bacteria 1741
361 Ga0501080_0238259 3300049742 Bacteria 1661
362 Ga0501081_0000039 3300049743 Bacteria 48570
363 Ga0501081_0002948 3300049743 Bacteria 10799
364 Ga0501081_0005816 3300049743 Bacteria 7985
365 Ga0501081_0010735 3300049743 Bacteria 5980
366 Ga0501081_0102552 3300049743 Bacteria 2024
367 Ga0501081_0132845 3300049743 Bacteria 1779
368 Ga0501083_0058566 3300049744 Eukaryota 2577
369 Ga0501083_0479747 3300049744 Bacteria 809
370 Ga0501035_0015423 3300049822 Bacteria 7048
371 Ga0501044_0553842 3300049823 Unclassified 1047
372 Ga0501045_0001097 3300049824 Bacteria 17895
373 Ga0501045_0077006 3300049824 Bacteria 2458
374 nmdc:mga05p37_113091_c1 3300050507 Bacteria 3338
375 nmdc:mga05p37_200559_c1 3300050507 Bacteria 2417
376 nmdc:mga05p37_218808_c1 3300050507 Unclassified 2299
377 nmdc:mga05p37_234478_c1 3300050507 Bacteria 2210
378 nmdc:mga05p37_26294_c1 3300050507 Bacteria 7079
379 nmdc:mga05p37_267531_c1 3300050507 Bacteria 2044
380 nmdc:mga05p37_282303_c1 3300050507 Bacteria 1980
381 nmdc:mga05p37_42911_c1 3300050507 Bacteria 5560
382 nmdc:mga05p37_45726_c1 3300050507 Bacteria 5383
383 nmdc:mga05p37_5167_c1 3300050507 Bacteria 15302
384 nmdc:mga05p37_549174_c1 3300050507 Bacteria 1315
385 nmdc:mga05p37_57321_c1 3300050507 Bacteria 4798
386 nmdc:mga05p37_603938_c1 3300050507 Bacteria 1238
387 nmdc:mga05p37_606203_c1 3300050507 Bacteria 1235
388 nmdc:mga05p37_666_c1 3300050507 Bacteria 37899
389 nmdc:mga05p37_67945_c1 3300050507 Bacteria 4384
390 nmdc:mga05p37_896382_c1 3300050507 Unclassified 957
391 nmdc:mga05p37_94835_c1 3300050507 Bacteria 3676
392 nmdc:mga05p37_96961_c1 3300050507 Bacteria 3633
393 nmdc:mga09592_1252_c1 3300050508 Bacteria 20384
394 nmdc:mga09592_14410_c1 3300050508 Bacteria 6452
395 nmdc:mga09592_170731_c1 3300050508 Bacteria 1881
396 nmdc:mga09592_2617_c1 3300050508 Bacteria 14569
397 nmdc:mga09592_315846_c1 3300050508 Unclassified 1354
398 nmdc:mga09592_4997_c1 3300050508 Bacteria 10750
399 nmdc:mga09592_832732_c1 3300050508 Unclassified 779
400 nmdc:mga0qj67_1303_c1 3300050509 Bacteria 17496
401 nmdc:mga0qj67_142346_c1 3300050509 Bacteria 1944
402 nmdc:mga0qj67_28468_c1 3300050509 Bacteria 4336
403 nmdc:mga0qj67_323648_c1 3300050509 Unclassified 1248
404 nmdc:mga0qj67_68352_c1 3300050509 Bacteria 2831
405 nmdc:mga0qj67_7924_c1 3300050509 Bacteria 7849
406 nmdc:mga06r32_10130_c1 3300050510 Bacteria 8509
407 nmdc:mga06r32_1162_c1 3300050510 Bacteria 23687
408 nmdc:mga06r32_146049_c1 3300050510 Bacteria 2342
409 nmdc:mga06r32_23532_c1 3300050510 Bacteria 5701
410 nmdc:mga06r32_292623_c1 3300050510 Bacteria 1615
411 nmdc:mga06r32_3777_c1 3300050510 Bacteria 13546
412 nmdc:mga06r32_384926_c1 3300050510 Unclassified 1385
413 nmdc:mga06r32_40662_c1 3300050510 Bacteria 4416
414 nmdc:mga06r32_429119_c1 3300050510 Bacteria 1303
415 nmdc:mga06r32_477366_c1 3300050510 Bacteria 1225
416 nmdc:mga06r32_559840_c1 3300050510 Bacteria 1116
417 nmdc:mga06r32_58075_c1 3300050510 Bacteria 3718
418 nmdc:mga08y16_11703_c1 3300050511 Bacteria 9219
419 nmdc:mga08y16_148613_c1 3300050511 Bacteria 2436
420 nmdc:mga08y16_54850_c1 3300050511 Bacteria 4165
421 nmdc:mga08y16_569_c1 3300050511 Bacteria 34274
422 nmdc:mga0n895_105920_c1 3300050512 Bacteria 2825
423 nmdc:mga0n895_120495_c1 3300050512 Bacteria 2645
424 nmdc:mga0n895_177413_c1 3300050512 Bacteria 2162
425 nmdc:mga0n895_314733_c1 3300050512 Bacteria 1586
426 nmdc:mga0n895_35279_c1 3300050512 Bacteria 4821
427 nmdc:mga0n895_364078_c1 3300050512 Bacteria 1464
428 nmdc:mga0n895_455353_c1 3300050512 Bacteria 1292
429 nmdc:mga0rr50_143380_c1 3300050513 Bacteria 1924
430 nmdc:mga0rr50_157138_c1 3300050513 Unclassified 1843
431 nmdc:mga0rr50_202494_c1 3300050513 Bacteria 1632
432 nmdc:mga0rr50_260368_c1 3300050513 Bacteria 1443
433 nmdc:mga0rr50_33349_c1 3300050513 Bacteria 3677
434 nmdc:mga0rr50_686795_c1 3300050513 Unclassified 874
435 nmdc:mga08x19_153991_c1 3300050514 Bacteria 1558
436 nmdc:mga08x19_30888_c1 3300050514 Bacteria 3367
437 nmdc:mga08x19_33256_c1 3300050514 Bacteria 3255
438 nmdc:mga0a205_209888_c1 3300050515 Unclassified 1836
439 nmdc:mga0a205_294230_c1 3300050515 Bacteria 1498
440 nmdc:mga0a205_411679_c1 3300050515 Unclassified 1215
441 nmdc:mga0a205_412648_c1 3300050515 Unclassified 1213
442 nmdc:mga0a205_524293_c1 3300050515 Unclassified 1041
443 nmdc:mga0a205_552230_c1 3300050515 Bacteria 1007
444 nmdc:mga0a205_67288_c1 3300050515 Bacteria 3461
445 Ga0501084_0004936 3300054114 Bacteria 10902
446 Ga0501084_0015452 3300054114 Bacteria 6330
447 Ga0501084_0726812 3300054114 Bacteria 837
448 Ga0501082_0003409 3300060353 Bacteria 13875
449 Ga0501082_0004191 3300060353 Bacteria 12599
450 Ga0501082_0004811 3300060353 Bacteria 11776
451 Ga0501082_0083314 3300060353 Bacteria 2759
452 Ga0501082_0178649 3300060353 Bacteria 1846
453 Ga0530510_0000012 3300061734 Bacteria 115789
454 Ga0530510_0005580 3300061734 Bacteria 8718
455 Ga0530510_0009418 3300061734 Bacteria 6848
456 Ga0530510_0066748 3300061734 Bacteria 2609
457 Ga0530510_0083157 3300061734 Bacteria 2331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_146049_c1 nmdc:mga06r32_146049_c1_867_1505 166
2 3300009147 Ga0114129_10007626 Ga0114129_1000762610 175
3 3300006846 Ga0075430_100236133 Ga0075430_1002361333 176
4 3300006852 Ga0075433_10101213 Ga0075433_101012132 176
5 3300006871 Ga0075434_100024207 Ga0075434_1000242075 176
6 3300006880 Ga0075429_100026527 Ga0075429_1000265272 176
7 3300050509 nmdc:mga0qj67_323648_c1 nmdc:mga0qj67_323648_c1_64_660 176
8 3300005549 Ga0070704_100473237 Ga0070704_1004732372 177
9 3300006852 Ga0075433_10141582 Ga0075433_101415822 178
10 3300006871 Ga0075434_100179444 Ga0075434_1001794443 178
11 3300006914 Ga0075436_100206327 Ga0075436_1002063272 178
12 3300007076 Ga0075435_100025472 Ga0075435_1000254725 178
13 3300009553 Ga0105249_10309827 Ga0105249_103098272 178
14 3300048909 Ga0496106_0429462 Ga0496106_0429462_385_924 178
15 3300048910 Ga0496107_0327638 Ga0496107_0327638_489_1028 178
16 3300050512 nmdc:mga0n895_105920_c1 nmdc:mga0n895_105920_c1_1161_1700 178
17 3300050513 nmdc:mga0rr50_143380_c1 nmdc:mga0rr50_143380_c1_402_941 178
18 3300050513 nmdc:mga0rr50_157138_c1 nmdc:mga0rr50_157138_c1_741_1280 178
19 3300050513 nmdc:mga0rr50_33349_c1 nmdc:mga0rr50_33349_c1_1764_2306 178
20 3300050515 nmdc:mga0a205_209888_c1 nmdc:mga0a205_209888_c1_436_975 178
21 3300050515 nmdc:mga0a205_412648_c1 nmdc:mga0a205_412648_c1_237_776 178
22 3300005330 Ga0070690_100342551 Ga0070690_1003425512 179
23 3300005440 Ga0070705_100535628 Ga0070705_1005356281 179
24 3300005444 Ga0070694_100563193 Ga0070694_1005631932 179
25 3300005445 Ga0070708_100055011 Ga0070708_1000550112 179
26 3300005458 Ga0070681_10995225 Ga0070681_109952251 179
27 3300005459 Ga0068867_100282741 Ga0068867_1002827411 179
28 3300005467 Ga0070706_100079715 Ga0070706_1000797152 179
29 3300005471 Ga0070698_100268468 Ga0070698_1002684682 179
30 3300005546 Ga0070696_100111725 Ga0070696_1001117252 179
31 3300005547 Ga0070693_100515568 Ga0070693_1005155681 179
32 3300005617 Ga0068859_100363783 Ga0068859_1003637832 179
33 3300005718 Ga0068866_10204479 Ga0068866_102044792 179
34 3300006844 Ga0075428_100024084 Ga0075428_1000240849 179
35 3300006844 Ga0075428_101809841 Ga0075428_1018098411 179
36 3300006852 Ga0075433_10426447 Ga0075433_104264472 179
37 3300006852 Ga0075433_10658124 Ga0075433_106581241 179
38 3300006871 Ga0075434_100193638 Ga0075434_1001936382 179
39 3300006931 Ga0097620_100363779 Ga0097620_1003637792 179
40 3300007076 Ga0075435_100148363 Ga0075435_1001483632 179
41 3300009147 Ga0114129_10264334 Ga0114129_102643343 179
42 3300025910 Ga0207684_10412439 Ga0207684_104124392 179
43 3300026089 Ga0207648_10082000 Ga0207648_100820004 179
44 3300045051 Ga0451576_0501211 Ga0451576_0501211_326_868 179
45 3300049585 Ga0501069_0586259 Ga0501069_0586259_13_585 179
46 3300049823 Ga0501044_0553842 Ga0501044_0553842_16_558 179
47 3300050507 nmdc:mga05p37_218808_c1 nmdc:mga05p37_218808_c1_271_825 179
48 3300050510 nmdc:mga06r32_384926_c1 nmdc:mga06r32_384926_c1_198_752 179
49 3300050511 nmdc:mga08y16_54850_c1 nmdc:mga08y16_54850_c1_1947_2498 179
50 3300050512 nmdc:mga0n895_120495_c1 nmdc:mga0n895_120495_c1_684_1235 179
51 3300050515 nmdc:mga0a205_552230_c1 nmdc:mga0a205_552230_c1_127_678 179
52 3300006846 Ga0075430_100116775 Ga0075430_1001167754 180
53 3300006847 Ga0075431_100013329 Ga0075431_1000133296 180
54 3300006880 Ga0075429_100166358 Ga0075429_1001663583 180
55 3300007265 Ga0099794_10155736 Ga0099794_101557362 180
56 3300035084 Ga0373928_0124207 Ga0373928_0124207_24_566 180
57 3300009147 Ga0114129_10000042 Ga0114129_1000004268 181
58 3300050507 nmdc:mga05p37_282303_c1 nmdc:mga05p37_282303_c1_804_1382 181
59 3300050508 nmdc:mga09592_14410_c1 nmdc:mga09592_14410_c1_5502_6080 181
60 3300050509 nmdc:mga0qj67_28468_c1 nmdc:mga0qj67_28468_c1_356_934 181
61 3300050510 nmdc:mga06r32_10130_c1 nmdc:mga06r32_10130_c1_1456_2034 181
62 3300006846 Ga0075430_100213438 Ga0075430_1002134382 182
63 3300006847 Ga0075431_100267648 Ga0075431_1002676482 182
64 3300009147 Ga0114129_10013451 Ga0114129_1001345111 182
65 3300009147 Ga0114129_10085235 Ga0114129_100852354 182
66 3300050507 nmdc:mga05p37_96961_c1 nmdc:mga05p37_96961_c1_2536_3126 182
67 3300050509 nmdc:mga0qj67_68352_c1 nmdc:mga0qj67_68352_c1_496_1086 182
68 3300050510 nmdc:mga06r32_292623_c1 nmdc:mga06r32_292623_c1_660_1250 182
69 3300005295 Ga0065707_10536834 Ga0065707_105368341 183
70 3300005444 Ga0070694_100452738 Ga0070694_1004527382 183
71 3300005518 Ga0070699_100369890 Ga0070699_1003698902 183
72 3300006844 Ga0075428_100130675 Ga0075428_1001306753 183
73 3300006847 Ga0075431_100002330 Ga0075431_1000023308 183
74 3300006847 Ga0075431_100188917 Ga0075431_1001889173 183
75 3300006871 Ga0075434_100379010 Ga0075434_1003790102 183
76 3300006871 Ga0075434_100467971 Ga0075434_1004679712 183
77 3300006880 Ga0075429_100015527 Ga0075429_1000155272 183
78 3300006914 Ga0075436_100013261 Ga0075436_1000132615 183
79 3300009147 Ga0114129_10130918 Ga0114129_101309182 183
80 3300009147 Ga0114129_10754911 Ga0114129_107549112 183
81 3300009147 Ga0114129_10923033 Ga0114129_109230332 183
82 3300009553 Ga0105249_10410091 Ga0105249_104100912 183
83 3300027717 Ga0209998_10144976 Ga0209998_101449761 183
84 3300028381 Ga0268264_10483311 Ga0268264_104833112 183
85 3300031548 Ga0307408_100027980 Ga0307408_1000279802 183
86 3300032002 Ga0307416_100171496 Ga0307416_1001714962 183
87 3300032005 Ga0307411_10076040 Ga0307411_100760402 183
88 3300049583 Ga0501067_0034204 Ga0501067_0034204_470_1027 183
89 3300049584 Ga0501068_0172767 Ga0501068_0172767_407_964 183
90 3300049585 Ga0501069_0009457 Ga0501069_0009457_467_1024 183
91 3300049586 Ga0501070_0625004 Ga0501070_0625004_92_649 183
92 3300050507 nmdc:mga05p37_113091_c1 nmdc:mga05p37_113091_c1_2683_3249 183
93 3300050507 nmdc:mga05p37_200559_c1 nmdc:mga05p37_200559_c1_1216_1773 183
94 3300050507 nmdc:mga05p37_42911_c1 nmdc:mga05p37_42911_c1_2221_2772 183
95 3300050507 nmdc:mga05p37_549174_c1 nmdc:mga05p37_549174_c1_280_831 183
96 3300050507 nmdc:mga05p37_94835_c1 nmdc:mga05p37_94835_c1_2120_2671 183
97 3300050508 nmdc:mga09592_4997_c1 nmdc:mga09592_4997_c1_10116_10682 183
98 3300050509 nmdc:mga0qj67_7924_c1 nmdc:mga0qj67_7924_c1_4130_4696 183
99 3300050510 nmdc:mga06r32_3777_c1 nmdc:mga06r32_3777_c1_1518_2084 183
100 3300050512 nmdc:mga0n895_314733_c1 nmdc:mga0n895_314733_c1_718_1269 183
101 3300050512 nmdc:mga0n895_364078_c1 nmdc:mga0n895_364078_c1_272_829 183
102 3300050514 nmdc:mga08x19_30888_c1 nmdc:mga08x19_30888_c1_242_793 183
103 3300050515 nmdc:mga0a205_524293_c1 nmdc:mga0a205_524293_c1_20_571 183
104 3300005467 Ga0070706_100142571 Ga0070706_1001425712 184
105 3300006844 Ga0075428_100038213 Ga0075428_1000382135 184
106 3300006846 Ga0075430_100041128 Ga0075430_1000411283 184
107 3300006847 Ga0075431_100060700 Ga0075431_1000607003 184
108 3300006880 Ga0075429_100000600 Ga0075429_1000006003 184
109 3300025910 Ga0207684_10122513 Ga0207684_101225133 184
110 3300050507 nmdc:mga05p37_57321_c1 nmdc:mga05p37_57321_c1_1421_1978 184
111 3300050508 nmdc:mga09592_1252_c1 nmdc:mga09592_1252_c1_19062_19619 184
112 3300050509 nmdc:mga0qj67_1303_c1 nmdc:mga0qj67_1303_c1_13025_13582 184
113 3300050510 nmdc:mga06r32_40662_c1 nmdc:mga06r32_40662_c1_1711_2268 184
114 3300005330 Ga0070690_100152787 Ga0070690_1001527873 185
115 3300005440 Ga0070705_100004854 Ga0070705_1000048542 185
116 3300005445 Ga0070708_100024083 Ga0070708_1000240835 185
117 3300005467 Ga0070706_100257975 Ga0070706_1002579752 185
118 3300005468 Ga0070707_100013325 Ga0070707_1000133252 185
119 3300005468 Ga0070707_100331388 Ga0070707_1003313882 185
120 3300005468 Ga0070707_100587067 Ga0070707_1005870672 185
121 3300005471 Ga0070698_100070498 Ga0070698_1000704983 185
122 3300005518 Ga0070699_100004599 Ga0070699_1000045992 185
123 3300005518 Ga0070699_100305979 Ga0070699_1003059792 185
124 3300005518 Ga0070699_100388138 Ga0070699_1003881381 185
125 3300005536 Ga0070697_100142228 Ga0070697_1001422282 185
126 3300005536 Ga0070697_100521233 Ga0070697_1005212332 185
127 3300005546 Ga0070696_100792802 Ga0070696_1007928021 185
128 3300005549 Ga0070704_100513047 Ga0070704_1005130472 185
129 3300005563 Ga0068855_101187353 Ga0068855_1011873531 185
130 3300005937 Ga0081455_10126881 Ga0081455_101268812 185
131 3300005983 Ga0081540_1035467 Ga0081540_10354672 185
132 3300006844 Ga0075428_100000358 Ga0075428_10000035833 185
133 3300006847 Ga0075431_100000329 Ga0075431_10000032920 185
134 3300006847 Ga0075431_100040124 Ga0075431_1000401245 185
135 3300006847 Ga0075431_100249983 Ga0075431_1002499832 185
136 3300006852 Ga0075433_10100229 Ga0075433_101002292 185
137 3300006852 Ga0075433_10225435 Ga0075433_102254351 185
138 3300006852 Ga0075433_10531938 Ga0075433_105319381 185
139 3300006871 Ga0075434_100067906 Ga0075434_1000679065 185
140 3300006871 Ga0075434_100192242 Ga0075434_1001922422 185
141 3300006871 Ga0075434_100415461 Ga0075434_1004154612 185
142 3300006880 Ga0075429_100001808 Ga0075429_1000018088 185
143 3300006880 Ga0075429_100012391 Ga0075429_1000123914 185
144 3300006880 Ga0075429_100979505 Ga0075429_1009795051 185
145 3300006914 Ga0075436_100049624 Ga0075436_1000496243 185
146 3300006914 Ga0075436_100062064 Ga0075436_1000620642 185
147 3300007076 Ga0075435_100011295 Ga0075435_1000112955 185
148 3300007076 Ga0075435_100037488 Ga0075435_1000374885 185
149 3300007076 Ga0075435_100131581 Ga0075435_1001315812 185
150 3300007076 Ga0075435_100292363 Ga0075435_1002923632 185
151 3300007076 Ga0075435_100303188 Ga0075435_1003031882 185
152 3300009147 Ga0114129_10001581 Ga0114129_1000158120 185
153 3300009147 Ga0114129_10339173 Ga0114129_103391732 185
154 3300009553 Ga0105249_10639594 Ga0105249_106395941 185
155 3300025910 Ga0207684_10005261 Ga0207684_1000526111 185
156 3300025910 Ga0207684_10014903 Ga0207684_100149032 185
157 3300025922 Ga0207646_10013815 Ga0207646_100138157 185
158 3300025922 Ga0207646_10021610 Ga0207646_100216102 185
159 3300025922 Ga0207646_10029245 Ga0207646_100292451 185
160 3300025922 Ga0207646_10266193 Ga0207646_102661932 185
161 3300025961 Ga0207712_10498629 Ga0207712_104986292 185
162 3300028380 Ga0268265_10642718 Ga0268265_106427182 185
163 3300035112 Ga0373932_0094125 Ga0373932_0094125_313_879 185
164 3300045051 Ga0451576_0286434 Ga0451576_0286434_98_661 185
165 3300046472 Ga0495580_0001345 Ga0495580_0001345_3956_4522 185
166 3300046528 Ga0495642_0011028 Ga0495642_0011028_111_677 185
167 3300050507 nmdc:mga05p37_5167_c1 nmdc:mga05p37_5167_c1_12289_12867 185
168 3300050507 nmdc:mga05p37_606203_c1 nmdc:mga05p37_606203_c1_407_964 185
169 3300050507 nmdc:mga05p37_666_c1 nmdc:mga05p37_666_c1_28468_29028 185
170 3300050507 nmdc:mga05p37_67945_c1 nmdc:mga05p37_67945_c1_2670_3230 185
171 3300050507 nmdc:mga05p37_896382_c1 nmdc:mga05p37_896382_c1_348_911 185
172 3300050508 nmdc:mga09592_2617_c1 nmdc:mga09592_2617_c1_5524_6084 185
173 3300050508 nmdc:mga09592_832732_c1 nmdc:mga09592_832732_c1_140_703 185
174 3300050510 nmdc:mga06r32_1162_c1 nmdc:mga06r32_1162_c1_3243_3803 185
175 3300050512 nmdc:mga0n895_177413_c1 nmdc:mga0n895_177413_c1_1135_1695 185
176 3300050512 nmdc:mga0n895_35279_c1 nmdc:mga0n895_35279_c1_1608_2174 185
177 3300050513 nmdc:mga0rr50_202494_c1 nmdc:mga0rr50_202494_c1_849_1409 185
178 3300050513 nmdc:mga0rr50_260368_c1 nmdc:mga0rr50_260368_c1_270_827 185
179 3300050513 nmdc:mga0rr50_686795_c1 nmdc:mga0rr50_686795_c1_246_806 185
180 3300050514 nmdc:mga08x19_153991_c1 nmdc:mga08x19_153991_c1_530_1087 185
181 3300050514 nmdc:mga08x19_33256_c1 nmdc:mga08x19_33256_c1_688_1248 185
182 3300050515 nmdc:mga0a205_67288_c1 nmdc:mga0a205_67288_c1_1661_2221 185
183 3300005295 Ga0065707_10031291 Ga0065707_100312912 186
184 3300005353 Ga0070669_100261889 Ga0070669_1002618892 186
185 3300005440 Ga0070705_100402229 Ga0070705_1004022292 186
186 3300005444 Ga0070694_100072480 Ga0070694_1000724802 186
187 3300005518 Ga0070699_101079916 Ga0070699_1010799162 186
188 3300005544 Ga0070686_100240468 Ga0070686_1002404682 186
189 3300005545 Ga0070695_100048473 Ga0070695_1000484734 186
190 3300005549 Ga0070704_100534036 Ga0070704_1005340361 186
191 3300005617 Ga0068859_100333347 Ga0068859_1003333473 186
192 3300005617 Ga0068859_100424180 Ga0068859_1004241802 186
193 3300005618 Ga0068864_100822820 Ga0068864_1008228201 186
194 3300005719 Ga0068861_100328869 Ga0068861_1003288692 186
195 3300005843 Ga0068860_100538670 Ga0068860_1005386702 186
196 3300005844 Ga0068862_100109472 Ga0068862_1001094723 186
197 3300006058 Ga0075432_10037371 Ga0075432_100373712 186
198 3300006844 Ga0075428_100462570 Ga0075428_1004625702 186
199 3300006844 Ga0075428_100532386 Ga0075428_1005323862 186
200 3300006846 Ga0075430_100173989 Ga0075430_1001739893 186
201 3300006846 Ga0075430_100344383 Ga0075430_1003443833 186
202 3300006846 Ga0075430_100555919 Ga0075430_1005559192 186
203 3300006847 Ga0075431_100019893 Ga0075431_1000198936 186
204 3300006847 Ga0075431_100447168 Ga0075431_1004471681 186
205 3300006852 Ga0075433_10076942 Ga0075433_100769422 186
206 3300006852 Ga0075433_10137189 Ga0075433_101371892 186
207 3300006852 Ga0075433_10167871 Ga0075433_101678712 186
208 3300006880 Ga0075429_100097537 Ga0075429_1000975373 186
209 3300006880 Ga0075429_100098054 Ga0075429_1000980542 186
210 3300006914 Ga0075436_100322997 Ga0075436_1003229972 186
211 3300006931 Ga0097620_100333353 Ga0097620_1003333533 186
212 3300006931 Ga0097620_100424159 Ga0097620_1004241592 186
213 3300007076 Ga0075435_100054786 Ga0075435_1000547863 186
214 3300009094 Ga0111539_10004956 Ga0111539_100049563 186
215 3300009094 Ga0111539_11925526 Ga0111539_119255261 186
216 3300009147 Ga0114129_10004909 Ga0114129_100049099 186
217 3300009147 Ga0114129_10214439 Ga0114129_102144393 186
218 3300009147 Ga0114129_10263824 Ga0114129_102638241 186
219 3300009147 Ga0114129_10325154 Ga0114129_103251542 186
220 3300009147 Ga0114129_10605244 Ga0114129_106052441 186
221 3300009148 Ga0105243_10995960 Ga0105243_109959602 186
222 3300009177 Ga0105248_10061602 Ga0105248_100616022 186
223 3300009553 Ga0105249_10443570 Ga0105249_104435702 186
224 3300009553 Ga0105249_10906382 Ga0105249_109063821 186
225 3300013297 Ga0157378_10269241 Ga0157378_102692411 186
226 3300013306 Ga0163162_10761904 Ga0163162_107619041 186
227 3300025923 Ga0207681_10227914 Ga0207681_102279142 186
228 3300025938 Ga0207704_10568094 Ga0207704_105680941 186
229 3300025941 Ga0207711_10085904 Ga0207711_100859041 186
230 3300025961 Ga0207712_10128862 Ga0207712_101288621 186
231 3300025961 Ga0207712_10762659 Ga0207712_107626592 186
232 3300025972 Ga0207668_10242230 Ga0207668_102422302 186
233 3300026075 Ga0207708_10098286 Ga0207708_100982862 186
234 3300026095 Ga0207676_10234111 Ga0207676_102341111 186
235 3300026095 Ga0207676_11031706 Ga0207676_110317062 186
236 3300026116 Ga0207674_10550887 Ga0207674_105508872 186
237 3300026118 Ga0207675_100157836 Ga0207675_1001578363 186
238 3300027671 Ga0209588_1036688 Ga0209588_10366882 186
239 3300027671 Ga0209588_1075755 Ga0209588_10757552 186
240 3300027907 Ga0207428_10000213 Ga0207428_100002133 186
241 3300028380 Ga0268265_10457476 Ga0268265_104574762 186
242 3300028381 Ga0268264_10258702 Ga0268264_102587022 186
243 3300028381 Ga0268264_11267627 Ga0268264_112676272 186
244 3300035088 Ga0373940_0009623 Ga0373940_0009623_81_647 186
245 3300035092 Ga0373952_0057159 Ga0373952_0057159_277_843 186
246 3300035242 Ga0373962_0013747 Ga0373962_0013747_1398_1964 186
247 3300037312 Ga0395899_0053967 Ga0395899_0053967_1203_1766 186
248 3300037418 Ga0395900_0001971 Ga0395900_0001971_13439_14002 186
249 3300037466 Ga0395898_0008700 Ga0395898_0008700_5184_5747 186
250 3300038443 Ga0395901_0011681 Ga0395901_0011681_6742_7305 186
251 3300049568 Ga0501031_0006928 Ga0501031_0006928_301_864 186
252 3300049571 Ga0501034_0257441 Ga0501034_0257441_1016_1579 186
253 3300049572 Ga0501036_0001299 Ga0501036_0001299_9571_10134 186
254 3300049573 Ga0501037_0083957 Ga0501037_0083957_1441_2004 186
255 3300049574 Ga0501038_0001040 Ga0501038_0001040_9510_10073 186
256 3300049575 Ga0501039_0001181 Ga0501039_0001181_16602_17165 186
257 3300049575 Ga0501039_0585933 Ga0501039_0585933_293_856 186
258 3300049576 Ga0501040_0002124 Ga0501040_0002124_2672_3235 186
259 3300049576 Ga0501040_0021372 Ga0501040_0021372_3292_3855 186
260 3300049576 Ga0501040_0345333 Ga0501040_0345333_51_611 186
261 3300049577 Ga0501041_0001037 Ga0501041_0001037_11175_11738 186
262 3300049577 Ga0501041_0005941 Ga0501041_0005941_2404_2967 186
263 3300049577 Ga0501041_0013692 Ga0501041_0013692_1121_1681 186
264 3300049578 Ga0501042_0000469 Ga0501042_0000469_10754_11317 186
265 3300049578 Ga0501042_0056717 Ga0501042_0056717_814_1374 186
266 3300049578 Ga0501042_0200925 Ga0501042_0200925_668_1231 186
267 3300049579 Ga0501043_0018672 Ga0501043_0018672_2904_3467 186
268 3300049580 Ga0501046_0003123 Ga0501046_0003123_5178_5741 186
269 3300049580 Ga0501046_0017334 Ga0501046_0017334_4998_5558 186
270 3300049580 Ga0501046_0071485 Ga0501046_0071485_93_656 186
271 3300049582 Ga0501048_0005244 Ga0501048_0005244_5840_6403 186
272 3300049584 Ga0501068_0025052 Ga0501068_0025052_974_1537 186
273 3300049584 Ga0501068_0115432 Ga0501068_0115432_502_1062 186
274 3300049585 Ga0501069_0361052 Ga0501069_0361052_194_757 186
275 3300049586 Ga0501070_0077688 Ga0501070_0077688_1434_1997 186
276 3300049587 Ga0501071_0002392 Ga0501071_0002392_1269_1832 186
277 3300049588 Ga0501072_0004123 Ga0501072_0004123_2627_3190 186
278 3300049588 Ga0501072_0013240 Ga0501072_0013240_2529_3089 186
279 3300049588 Ga0501072_0056904 Ga0501072_0056904_845_1408 186
280 3300049588 Ga0501072_0059342 Ga0501072_0059342_277_858 186
281 3300049590 Ga0501074_0001367 Ga0501074_0001367_10042_10605 186
282 3300049590 Ga0501074_0168275 Ga0501074_0168275_65_628 186
283 3300049590 Ga0501074_0195928 Ga0501074_0195928_575_1135 186
284 3300049591 Ga0501075_0000050 Ga0501075_0000050_2489_3052 186
285 3300049591 Ga0501075_0014584 Ga0501075_0014584_3795_4355 186
286 3300049591 Ga0501075_0045073 Ga0501075_0045073_1859_2422 186
287 3300049592 Ga0501076_0000008 Ga0501076_0000008_116397_116960 186
288 3300049592 Ga0501076_0002521 Ga0501076_0002521_1049_1609 186
289 3300049592 Ga0501076_0041275 Ga0501076_0041275_148_711 186
290 3300049593 Ga0501077_0000022 Ga0501077_0000022_9564_10127 186
291 3300049593 Ga0501077_0027492 Ga0501077_0027492_487_1047 186
292 3300049741 Ga0501079_0003078 Ga0501079_0003078_2093_2656 186
293 3300049741 Ga0501079_0069895 Ga0501079_0069895_1352_1915 186
294 3300049741 Ga0501079_0795450 Ga0501079_0795450_135_695 186
295 3300049742 Ga0501080_0001332 Ga0501080_0001332_1398_1961 186
296 3300049742 Ga0501080_0219369 Ga0501080_0219369_805_1368 186
297 3300049743 Ga0501081_0000039 Ga0501081_0000039_29422_29985 186
298 3300049743 Ga0501081_0005816 Ga0501081_0005816_1152_1712 186
299 3300049743 Ga0501081_0010735 Ga0501081_0010735_5088_5651 186
300 3300049744 Ga0501083_0058566 Ga0501083_0058566_723_1286 186
301 3300049744 Ga0501083_0479747 Ga0501083_0479747_89_652 186
302 3300049822 Ga0501035_0015423 Ga0501035_0015423_5502_6065 186
303 3300049824 Ga0501045_0001097 Ga0501045_0001097_7812_8375 186
304 3300049824 Ga0501045_0077006 Ga0501045_0077006_508_1071 186
305 3300050507 nmdc:mga05p37_26294_c1 nmdc:mga05p37_26294_c1_1701_2273 186
306 3300050507 nmdc:mga05p37_267531_c1 nmdc:mga05p37_267531_c1_949_1515 186
307 3300050508 nmdc:mga09592_170731_c1 nmdc:mga09592_170731_c1_487_1053 186
308 3300050508 nmdc:mga09592_315846_c1 nmdc:mga09592_315846_c1_691_1263 186
309 3300050509 nmdc:mga0qj67_142346_c1 nmdc:mga0qj67_142346_c1_394_954 186
310 3300050510 nmdc:mga06r32_23532_c1 nmdc:mga06r32_23532_c1_2255_2815 186
311 3300050510 nmdc:mga06r32_429119_c1 nmdc:mga06r32_429119_c1_208_774 186
312 3300050510 nmdc:mga06r32_559840_c1 nmdc:mga06r32_559840_c1_281_844 186
313 3300050510 nmdc:mga06r32_58075_c1 nmdc:mga06r32_58075_c1_539_1111 186
314 3300050511 nmdc:mga08y16_569_c1 nmdc:mga08y16_569_c1_31015_31581 186
315 3300050515 nmdc:mga0a205_411679_c1 nmdc:mga0a205_411679_c1_116_688 186
316 3300054114 Ga0501084_0004936 Ga0501084_0004936_769_1332 186
317 3300060353 Ga0501082_0003409 Ga0501082_0003409_10565_11125 186
318 3300060353 Ga0501082_0004191 Ga0501082_0004191_9602_10165 186
319 3300060353 Ga0501082_0083314 Ga0501082_0083314_861_1424 186
320 3300061734 Ga0530510_0005580 Ga0530510_0005580_2672_3235 186
321 3300061734 Ga0530510_0009418 Ga0530510_0009418_6024_6584 186
322 3300061734 Ga0530510_0083157 Ga0530510_0083157_304_867 186
323 3300005331 Ga0070670_100564788 Ga0070670_1005647881 187
324 3300005336 Ga0070680_100008143 Ga0070680_1000081433 187
325 3300005336 Ga0070680_100386999 Ga0070680_1003869992 187
326 3300005336 Ga0070680_100413226 Ga0070680_1004132261 187
327 3300005341 Ga0070691_10025599 Ga0070691_100255992 187
328 3300005345 Ga0070692_10212165 Ga0070692_102121651 187
329 3300005347 Ga0070668_100195359 Ga0070668_1001953592 187
330 3300005353 Ga0070669_100033913 Ga0070669_1000339132 187
331 3300005365 Ga0070688_100669817 Ga0070688_1006698172 187
332 3300005406 Ga0070703_10149011 Ga0070703_101490111 187
333 3300005438 Ga0070701_10034435 Ga0070701_100344355 187
334 3300005444 Ga0070694_100037582 Ga0070694_1000375823 187
335 3300005458 Ga0070681_10018073 Ga0070681_100180737 187
336 3300005468 Ga0070707_100587632 Ga0070707_1005876322 187
337 3300005471 Ga0070698_100525579 Ga0070698_1005255792 187
338 3300005518 Ga0070699_100081165 Ga0070699_1000811652 187
339 3300005518 Ga0070699_100293943 Ga0070699_1002939433 187
340 3300005518 Ga0070699_101226416 Ga0070699_1012264161 187
341 3300005530 Ga0070679_100095359 Ga0070679_1000953592 187
342 3300005544 Ga0070686_100109446 Ga0070686_1001094462 187
343 3300005545 Ga0070695_100119805 Ga0070695_1001198052 187
344 3300005546 Ga0070696_100059223 Ga0070696_1000592231 187
345 3300005549 Ga0070704_100263406 Ga0070704_1002634062 187
346 3300005577 Ga0068857_100068023 Ga0068857_1000680233 187
347 3300005617 Ga0068859_100653015 Ga0068859_1006530151 187
348 3300005842 Ga0068858_101085940 Ga0068858_1010859401 187
349 3300005843 Ga0068860_101026497 Ga0068860_1010264971 187
350 3300005844 Ga0068862_100070575 Ga0068862_1000705754 187
351 3300005844 Ga0068862_100835629 Ga0068862_1008356292 187
352 3300006844 Ga0075428_100085532 Ga0075428_1000855323 187
353 3300006844 Ga0075428_100936200 Ga0075428_1009362002 187
354 3300006847 Ga0075431_100273410 Ga0075431_1002734102 187
355 3300006852 Ga0075433_10437323 Ga0075433_104373232 187
356 3300006881 Ga0068865_101089564 Ga0068865_1010895641 187
357 3300006931 Ga0097620_100652914 Ga0097620_1006529142 187
358 3300009094 Ga0111539_10002746 Ga0111539_1000274623 187
359 3300009147 Ga0114129_10452276 Ga0114129_104522762 187
360 3300009147 Ga0114129_10781677 Ga0114129_107816771 187
361 3300009148 Ga0105243_10516591 Ga0105243_105165912 187
362 3300009174 Ga0105241_10041334 Ga0105241_100413346 187
363 3300009174 Ga0105241_10125233 Ga0105241_101252332 187
364 3300009176 Ga0105242_10066701 Ga0105242_100667014 187
365 3300009176 Ga0105242_10575359 Ga0105242_105753592 187
366 3300009553 Ga0105249_10096287 Ga0105249_100962872 187
367 3300009553 Ga0105249_10151005 Ga0105249_101510051 187
368 3300013297 Ga0157378_11045728 Ga0157378_110457282 187
369 3300013306 Ga0163162_10039807 Ga0163162_100398074 187
370 3300013308 Ga0157375_10219690 Ga0157375_102196902 187
371 3300013308 Ga0157375_11175185 Ga0157375_111751852 187
372 3300014326 Ga0157380_10417877 Ga0157380_104178771 187
373 3300025885 Ga0207653_10004662 Ga0207653_100046623 187
374 3300025910 Ga0207684_10297851 Ga0207684_102978512 187
375 3300025918 Ga0207662_10117551 Ga0207662_101175512 187
376 3300025921 Ga0207652_10077205 Ga0207652_100772052 187
377 3300025925 Ga0207650_10386886 Ga0207650_103868862 187
378 3300025932 Ga0207690_10101606 Ga0207690_101016062 187
379 3300025933 Ga0207706_10068401 Ga0207706_100684012 187
380 3300025934 Ga0207686_10011003 Ga0207686_100110031 187
381 3300025936 Ga0207670_10549215 Ga0207670_105492151 187
382 3300025938 Ga0207704_10227705 Ga0207704_102277052 187
383 3300025942 Ga0207689_10085903 Ga0207689_100859035 187
384 3300025961 Ga0207712_10067436 Ga0207712_100674361 187
385 3300025961 Ga0207712_10215393 Ga0207712_102153932 187
386 3300025972 Ga0207668_10176914 Ga0207668_101769142 187
387 3300026089 Ga0207648_10126433 Ga0207648_101264336 187
388 3300026089 Ga0207648_10158188 Ga0207648_101581882 187
389 3300026116 Ga0207674_10108854 Ga0207674_101088544 187
390 3300027907 Ga0207428_10005402 Ga0207428_1000540213 187
391 3300028380 Ga0268265_10315652 Ga0268265_103156522 187
392 3300028381 Ga0268264_10075014 Ga0268264_100750146 187
393 3300028381 Ga0268264_10148745 Ga0268264_101487452 187
394 3300035115 Ga0373941_0001864 Ga0373941_0001864_1200_1766 187
395 3300035121 Ga0373960_0064470 Ga0373960_0064470_393_959 187
396 3300042876 Ga0451577_0087533 Ga0451577_0087533_640_1206 187
397 3300046455 Ga0495603_0088528 Ga0495603_0088528_621_1187 187
398 3300046691 Ga0495670_0219724 Ga0495670_0219724_48_614 187
399 3300047318 Ga0495636_0159032 Ga0495636_0159032_398_967 187
400 3300048905 Ga0496102_0193940 Ga0496102_0193940_148_714 187
401 3300048906 Ga0496103_0017323 Ga0496103_0017323_3205_3771 187
402 3300048909 Ga0496106_0111110 Ga0496106_0111110_75_641 187
403 3300048909 Ga0496106_0337618 Ga0496106_0337618_337_903 187
404 3300049570 Ga0501033_0272117 Ga0501033_0272117_66_629 187
405 3300049572 Ga0501036_0029098 Ga0501036_0029098_3829_4419 187
406 3300049574 Ga0501038_0050249 Ga0501038_0050249_1371_1961 187
407 3300049575 Ga0501039_0016839 Ga0501039_0016839_1364_1954 187
408 3300049575 Ga0501039_0182739 Ga0501039_0182739_494_1057 187
409 3300049576 Ga0501040_0149087 Ga0501040_0149087_253_843 187
410 3300049576 Ga0501040_0202579 Ga0501040_0202579_743_1306 187
411 3300049577 Ga0501041_0001659 Ga0501041_0001659_6921_7511 187
412 3300049578 Ga0501042_0001126 Ga0501042_0001126_10496_11086 187
413 3300049579 Ga0501043_0829220 Ga0501043_0829220_24_587 187
414 3300049580 Ga0501046_0301964 Ga0501046_0301964_195_758 187
415 3300049582 Ga0501048_0037523 Ga0501048_0037523_214_804 187
416 3300049584 Ga0501068_0121407 Ga0501068_0121407_184_774 187
417 3300049587 Ga0501071_0013960 Ga0501071_0013960_931_1503 187
418 3300049587 Ga0501071_0015685 Ga0501071_0015685_3485_4075 187
419 3300049588 Ga0501072_0016666 Ga0501072_0016666_2333_2923 187
420 3300049590 Ga0501074_0114172 Ga0501074_0114172_667_1257 187
421 3300049591 Ga0501075_0000021 Ga0501075_0000021_18566_19156 187
422 3300049591 Ga0501075_0291425 Ga0501075_0291425_654_1217 187
423 3300049592 Ga0501076_0001180 Ga0501076_0001180_16253_16843 187
424 3300049592 Ga0501076_0080883 Ga0501076_0080883_867_1430 187
425 3300049592 Ga0501076_0327870 Ga0501076_0327870_315_881 187
426 3300049593 Ga0501077_0093064 Ga0501077_0093064_388_978 187
427 3300049593 Ga0501077_0144751 Ga0501077_0144751_283_849 187
428 3300049593 Ga0501077_0229375 Ga0501077_0229375_500_1063 187
429 3300049741 Ga0501079_0034558 Ga0501079_0034558_3099_3689 187
430 3300049742 Ga0501080_0238259 Ga0501080_0238259_644_1207 187
431 3300049743 Ga0501081_0002948 Ga0501081_0002948_6328_6918 187
432 3300049743 Ga0501081_0102552 Ga0501081_0102552_145_711 187
433 3300049743 Ga0501081_0132845 Ga0501081_0132845_237_800 187
434 3300050507 nmdc:mga05p37_234478_c1 nmdc:mga05p37_234478_c1_931_1500 187
435 3300050507 nmdc:mga05p37_45726_c1 nmdc:mga05p37_45726_c1_1502_2068 187
436 3300050507 nmdc:mga05p37_603938_c1 nmdc:mga05p37_603938_c1_63_650 187
437 3300050510 nmdc:mga06r32_477366_c1 nmdc:mga06r32_477366_c1_379_948 187
438 3300050511 nmdc:mga08y16_11703_c1 nmdc:mga08y16_11703_c1_7168_7734 187
439 3300050511 nmdc:mga08y16_148613_c1 nmdc:mga08y16_148613_c1_612_1178 187
440 3300050512 nmdc:mga0n895_455353_c1 nmdc:mga0n895_455353_c1_644_1210 187
441 3300050515 nmdc:mga0a205_294230_c1 nmdc:mga0a205_294230_c1_912_1478 187
442 3300054114 Ga0501084_0015452 Ga0501084_0015452_4799_5362 187
443 3300060353 Ga0501082_0004811 Ga0501082_0004811_5360_5950 187
444 3300060353 Ga0501082_0178649 Ga0501082_0178649_349_915 187
445 3300061734 Ga0530510_0000012 Ga0530510_0000012_47663_48253 187
446 3300061734 Ga0530510_0066748 Ga0530510_0066748_1073_1636 187
447 3300005445 Ga0070708_100087518 Ga0070708_1000875182 188
448 3300005518 Ga0070699_100190298 Ga0070699_1001902984 188
449 3300025910 Ga0207684_10134149 Ga0207684_101341492 188
450 3300025922 Ga0207646_10024755 Ga0207646_100247555 188
451 3300049741 Ga0501079_0098135 Ga0501079_0098135_659_1240 188
452 3300054114 Ga0501084_0726812 Ga0501084_0726812_216_797 188
453 3300003203 JGI25406J46586_10050061 JGI25406J46586_100500611 189
454 3300005985 Ga0081539_10000792 Ga0081539_1000079256 189
455 3300007265 Ga0099794_10060663 Ga0099794_100606632 189
456 3300037312 Ga0395899_0310026 Ga0395899_0310026_367_984 189
457 3300037418 Ga0395900_0142867 Ga0395900_0142867_143_760 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

39

118

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cni-assembly1.cif.gz_B crystal structure of h105a pgam5 dimer 0.7732 38 182
6e4b-assembly2.cif.gz_D the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.7611 38 182
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.7588 38 188
8glv-assembly1.cif.gz_Cp 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.756 167 189
6cnl-assembly1.cif.gz_L crystal structure of h105a pgam5 dodecamer 0.7526 38 182
ID Description Score Start End Superfamily
af_F4I2N3_12_231_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.772 38 178 3.40.50.1240
af_Q5ABB4_12_212_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7584 38 182 3.40.50.1240
3f2iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7552 41 159 3.40.50.1240
af_K7TSF9_113_270_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7528 44 117 3.40.50.1240
6cnlL00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7526 38 182 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A2V6Y082-F1-model_v4 Histidine phosphatase family protein 0.997 29 189
AF-A0A2V6Y082-F1-model_v4 Histidine phosphatase family protein 0.9612 29 189
AF-W7W0X0-F1-model_v4 Histidine phosphatase superfamily (Branch 1) 0.9591 30 141
AF-A0A2V7D0U8-F1-model_v4 Histidine phosphatase family protein 0.956 14 189
AF-A0A527ZRD1-F1-model_v4 Histidine phosphatase family protein 0.9537 30 152

Feature Viewer

pLDDT pTM Quality
90.46 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map