F447639

General Info

Members Datasets Scaffolds Average Seq Length
455 229 424 295

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0002278|Ga0495580_0002278_9852_10904
Length 350
Sequence MPALRKTAWRGGVSSGKQVSSRVFDGATFEPQTSVPGGTTVDRLTAMETFVCVVESGSFSAAARLLNVGQPAVSKSIAQLEERLAVRLLLRSTRGLTPTEAGHAFYERAKRAIEEADEAEVAARGSAGALSGRLRISAAVTFARIHILPRLQTFLDRHPELNIDIVLDDENIDLLERGIDVALRMGVLGDSNMTARKVGHGRRCVVGTPAWFAKAGEPRVPADLLSHQAIVYEQGGGGSVWSFRQGNSETSIVVAGRVRVNAAEGVRAAVLADMGVAIASEWMFTPELASGAVKRVLPDWELPGIDLWAVFPSGRMVSAKARAFVAWIEEIFGPQIDALPIEAPPSTNNV

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541357 Duganella sp. GV053 Isolate Unclassified
8 2738543003 Duganella sp. GV066 Isolate Unclassified
9 2738543026 Duganella sp. GV089 Isolate Unclassified
10 2738543029 Duganella sp. GV039 Isolate Unclassified
11 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
12 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
13 2821131069 Duganella sp. 1224 Isolate Unclassified
14 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
15 2857558681 Duganella sp. R-74565 Isolate Unclassified
16 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
17 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
18 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
19 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
20 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
21 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
27 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
28 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
29 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
30 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
97 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
220 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
228 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
229 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 0
Isolates 6.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0.88
Rhizoplane 3.08
Rhizosphere 76.26
Stem 0
Stem Tuber 0
Unclassified 13.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000470 3300002704 Bacteria 10098
2 JGI25155J39150_1000570 3300002704 Bacteria 8215
3 JGI25156J39149_1000039 3300002705 Bacteria 107108
4 JGI25162J39368_1002450 3300002737 Bacteria 7195
5 JGI25154J39366_1000059 3300002738 Bacteria 107114
6 JGI25154J39366_1000162 3300002738 Bacteria 51833
7 JGI25157J39369_1000057 3300002741 Bacteria 107108
8 JGI25152J39213_1002578 3300002773 Bacteria 6785
9 rootH2_10285126 3300003320 Bacteria 1740
10 rootH1_10225905 3300003323 Bacteria 1746
11 JGI25407J50210_10034864 3300003373 Bacteria 1297
12 Ga0055532_1000018 3300003758 Bacteria 305466
13 Ga0055535_1003268 3300003761 Bacteria 4715
14 Ga0065165_1001722 3300005262 Bacteria 21921
15 Ga0065714_10003690 3300005288 Bacteria 9561
16 Ga0070658_10001034 3300005327 Bacteria 23804
17 Ga0070667_100102080 3300005367 Bacteria 2478
18 Ga0070663_100272396 3300005455 Bacteria 1346
19 Ga0070662_100102832 3300005457 Bacteria 2165
20 Ga0070665_100232368 3300005548 Bacteria 1844
21 Ga0068855_100054388 3300005563 Bacteria 4705
22 Ga0068855_100456553 3300005563 Bacteria 1394
23 Ga0068854_100006819 3300005578 Bacteria 7282
24 Ga0081455_10008451 3300005937 Bacteria 10705
25 Ga0081538_10005569 3300005981 Bacteria 11304
26 Ga0075362_10288680 3300006177 Unclassified 812
27 Ga0075366_10138575 3300006195 Unclassified 1470
28 Ga0105244_10120551 3300009036 Bacteria 1270
29 Ga0105240_10056446 3300009093 Bacteria 4913
30 Ga0105237_10004327 3300009545 Bacteria 16462
31 Ga0105238_10000869 3300009551 Bacteria 31184
32 Ga0157373_10088364 3300013100 Bacteria 2183
33 Ga0157370_10049460 3300013104 Bacteria 4023
34 Ga0163162_10006360 3300013306 Bacteria 11435
35 Ga0163162_10103974 3300013306 Bacteria 2934
36 Ga0157375_10043208 3300013308 Bacteria 4369
37 Ga0182008_10003299 3300014497 Bacteria 9823
38 Ga0182006_1001179 3300015261 Bacteria 16418
39 Ga0182007_10030937 3300015262 Bacteria 1826
40 Ga0163161_10016829 3300017792 Bacteria 5112
41 Ga0213872_10027967 3300021361 Bacteria 2587
42 Ga0209435_100007 3300025206 Bacteria 516857
43 Ga0209435_100196 3300025206 Bacteria 17747
44 Ga0209147_100017 3300025229 Bacteria 516857
45 Ga0209437_100088 3300025233 Bacteria 251174
46 Ga0209258_100318 3300025242 Bacteria 74657
47 Ga0209646_1000061 3300025246 Bacteria 255495
48 Ga0209646_1000096 3300025246 Bacteria 182388
49 Ga0209026_1000052 3300025250 Bacteria 248897
50 Ga0209026_1006244 3300025250 Bacteria 2971
51 Ga0209148_1000658 3300025254 Bacteria 29762
52 Ga0209759_1000174 3300025256 Bacteria 107149
53 Ga0209759_1000707 3300025256 Bacteria 29735
54 Ga0209129_1000097 3300025258 Bacteria 165504
55 Ga0209455_1009705 3300025272 Bacteria 2507
56 Ga0209025_1000163 3300025294 Bacteria 165492
57 Ga0209051_1072546 3300025303 Bacteria 1029
58 Ga0207695_10002002 3300025913 Bacteria 31431
59 Ga0207671_10067415 3300025914 Bacteria 2665
60 Ga0207649_10062789 3300025920 Bacteria 2343
61 Ga0207694_10002124 3300025924 Bacteria 16322
62 Ga0207706_10118354 3300025933 Bacteria 2330
63 Ga0207667_10004680 3300025949 Bacteria 16750
64 Ga0207667_10034944 3300025949 Bacteria 5395
65 Ga0207667_10092742 3300025949 Bacteria 3119
66 Ga0207640_10065466 3300025981 Bacteria 2425
67 Ga0207658_10079848 3300025986 Bacteria 2504
68 Ga0207678_10292674 3300026067 Bacteria 1399
69 Ga0207428_10000305 3300027907 Bacteria 65062
70 Ga0395899_0000016 3300037312 Bacteria 468322
71 Ga0395899_0005773 3300037312 Bacteria 9606
72 Ga0395899_0065115 3300037312 Bacteria 2679
73 Ga0395899_0115833 3300037312 Bacteria 1923
74 Ga0395900_0011643 3300037418 Bacteria 8998
75 Ga0395900_0078217 3300037418 Bacteria 3398
76 Ga0395900_0117590 3300037418 Bacteria 2727
77 Ga0395900_0172589 3300037418 Bacteria 2200
78 Ga0395898_0002097 3300037466 Bacteria 24778
79 Ga0395905_0001930 3300037471 Bacteria 23804
80 Ga0395905_0012057 3300037471 Bacteria 8331
81 Ga0395905_0013955 3300037471 Bacteria 7683
82 Ga0395901_0106656 3300038443 Bacteria 2940
83 Ga0395901_0274841 3300038443 Bacteria 1751
84 Ga0237819_00652 3300038705 Bacteria 11273
85 Ga0436361_0532127 3300039447 Bacteria 2687
86 Ga0450889_002593 3300042144 Bacteria 1793
87 Ga0450893_0001544 3300042532 Bacteria 3537
88 Ga0495617_000004 3300046452 Bacteria 511274
89 Ga0495617_000573 3300046452 Bacteria 18878
90 Ga0495617_006372 3300046452 Bacteria 4143
91 Ga0495617_009365 3300046452 Bacteria 3361
92 Ga0495617_055506 3300046452 Bacteria 1314
93 Ga0495627_002439 3300046453 Bacteria 8964
94 Ga0495627_019172 3300046453 Bacteria 2298
95 Ga0495627_050213 3300046453 Bacteria 1257
96 Ga0495592_0021591 3300046454 Bacteria 4897
97 Ga0495592_0037804 3300046454 Bacteria 3633
98 Ga0495603_0008824 3300046455 Bacteria 6093
99 Ga0495603_0010017 3300046455 Bacteria 5734
100 Ga0495603_0054839 3300046455 Bacteria 2362
101 Ga0495590_0000132 3300046457 Bacteria 44154
102 Ga0495590_0000390 3300046457 Bacteria 22199
103 Ga0495590_0004502 3300046457 Bacteria 5623
104 Ga0495590_0009833 3300046457 Bacteria 3619
105 Ga0495590_0012986 3300046457 Bacteria 3073
106 Ga0495590_0016620 3300046457 Bacteria 2655
107 Ga0495591_000132 3300046458 Bacteria 81947
108 Ga0495591_001838 3300046458 Bacteria 12517
109 Ga0495591_010753 3300046458 Bacteria 3519
110 Ga0495591_029166 3300046458 Bacteria 1679
111 Ga0495629_0000138 3300046459 Bacteria 63867
112 Ga0495629_0000325 3300046459 Bacteria 40912
113 Ga0495638_0000047 3300046460 Bacteria 216004
114 Ga0495638_0001528 3300046460 Bacteria 20839
115 Ga0495638_0061907 3300046460 Bacteria 2311
116 Ga0495638_0091325 3300046460 Bacteria 1834
117 Ga0495638_0101656 3300046460 Bacteria 1718
118 Ga0495638_0143648 3300046460 Bacteria 1390
119 Ga0495653_0000007 3300046463 Bacteria 314281
120 Ga0495653_0000446 3300046463 Bacteria 32368
121 Ga0495653_0002298 3300046463 Bacteria 15155
122 Ga0495653_0004003 3300046463 Bacteria 11899
123 Ga0495650_0000086 3300046471 Bacteria 235224
124 Ga0495650_0000547 3300046471 Bacteria 53772
125 Ga0495650_0001202 3300046471 Bacteria 27277
126 Ga0495650_0002285 3300046471 Bacteria 15937
127 Ga0495650_0010729 3300046471 Bacteria 5090
128 Ga0495650_0020808 3300046471 Bacteria 3189
129 Ga0495650_0024248 3300046471 Bacteria 2867
130 Ga0495650_0025750 3300046471 Bacteria 2750
131 Ga0495650_0080025 3300046471 Bacteria 1262
132 Ga0495580_0000567 3300046472 Bacteria 31212
133 Ga0495580_0002278 3300046472 Bacteria 16753
134 Ga0495582_0252920 3300046473 Bacteria 1011
135 Ga0495605_0000060 3300046474 Bacteria 145530
136 Ga0495605_0005840 3300046474 Bacteria 7118
137 Ga0495605_0036986 3300046474 Bacteria 2458
138 Ga0495639_0121292 3300046475 Bacteria 1247
139 Ga0495662_0191297 3300046476 Bacteria 1009
140 Ga0495664_0047177 3300046477 Bacteria 2556
141 Ga0495584_0000135 3300046491 Bacteria 50619
142 Ga0495584_0000850 3300046491 Bacteria 19728
143 Ga0495584_0004108 3300046491 Bacteria 7857
144 Ga0495584_0112162 3300046491 Bacteria 1380
145 Ga0495585_0000492 3300046492 Bacteria 37424
146 Ga0495585_0005878 3300046492 Bacteria 7683
147 Ga0495585_0013437 3300046492 Bacteria 4791
148 Ga0495594_0000810 3300046499 Bacteria 16150
149 Ga0495594_0024675 3300046499 Bacteria 3231
150 Ga0495596_0003753 3300046500 Bacteria 7580
151 Ga0495596_0013483 3300046500 Bacteria 3467
152 Ga0495596_0039718 3300046500 Bacteria 1858
153 Ga0495607_0001893 3300046501 Bacteria 17752
154 Ga0495607_0009613 3300046501 Bacteria 6536
155 Ga0495607_0067071 3300046501 Bacteria 2017
156 Ga0495607_0199497 3300046501 Bacteria 991
157 Ga0495583_0000092 3300046506 Bacteria 158865
158 Ga0495583_0000282 3300046506 Bacteria 82063
159 Ga0495583_0001548 3300046506 Bacteria 22788
160 Ga0495583_0002281 3300046506 Bacteria 16780
161 Ga0495583_0002524 3300046506 Bacteria 15494
162 Ga0495583_0007962 3300046506 Bacteria 6557
163 Ga0495606_0000135 3300046507 Bacteria 125830
164 Ga0495606_0000188 3300046507 Bacteria 108100
165 Ga0495606_0000305 3300046507 Bacteria 84602
166 Ga0495606_0001722 3300046507 Bacteria 28126
167 Ga0495606_0004352 3300046507 Bacteria 14211
168 Ga0495606_0004768 3300046507 Bacteria 13335
169 Ga0495606_0011536 3300046507 Bacteria 7197
170 Ga0495606_0030042 3300046507 Bacteria 3803
171 Ga0495606_0048324 3300046507 Bacteria 2800
172 Ga0495606_0050667 3300046507 Bacteria 2714
173 Ga0495606_0060845 3300046507 Bacteria 2417
174 Ga0495606_0122548 3300046507 Bacteria 1554
175 Ga0495610_0000010 3300046512 Bacteria 538821
176 Ga0495610_0000413 3300046512 Bacteria 43813
177 Ga0495610_0002714 3300046512 Bacteria 14573
178 Ga0495610_0008782 3300046512 Bacteria 6483
179 Ga0495610_0096432 3300046512 Bacteria 1331
180 Ga0495616_0002236 3300046513 Bacteria 12958
181 Ga0495616_0005432 3300046513 Bacteria 7848
182 Ga0495616_0020321 3300046513 Bacteria 3615
183 Ga0495616_0022981 3300046513 Bacteria 3360
184 Ga0495618_0119468 3300046514 Bacteria 1688
185 Ga0495620_0000061 3300046515 Bacteria 94469
186 Ga0495620_0008617 3300046515 Bacteria 5469
187 Ga0495628_0095834 3300046516 Bacteria 2292
188 Ga0495628_0152767 3300046516 Bacteria 1757
189 Ga0495628_0191187 3300046516 Bacteria 1545
190 Ga0495630_0036140 3300046517 Bacteria 3692
191 Ga0495631_0002060 3300046518 Bacteria 11721
192 Ga0495631_0011585 3300046518 Bacteria 4332
193 Ga0495631_0012314 3300046518 Bacteria 4183
194 Ga0495631_0040877 3300046518 Bacteria 2053
195 Ga0495631_0125128 3300046518 Bacteria 1105
196 Ga0495632_0000072 3300046519 Bacteria 104826
197 Ga0495637_0000028 3300046520 Bacteria 144203
198 Ga0495637_0000783 3300046520 Bacteria 21362
199 Ga0495637_0006560 3300046520 Bacteria 5824
200 Ga0495637_0021336 3300046520 Bacteria 2972
201 Ga0495643_0000098 3300046522 Bacteria 145645
202 Ga0495643_0040538 3300046522 Bacteria 2543
203 Ga0495644_0004247 3300046523 Bacteria 5626
204 Ga0495644_0004431 3300046523 Bacteria 5515
205 Ga0495648_0000019 3300046524 Bacteria 276407
206 Ga0495648_0001101 3300046524 Bacteria 27484
207 Ga0495648_0002945 3300046524 Bacteria 15279
208 Ga0495648_0005218 3300046524 Bacteria 10869
209 Ga0495648_0031473 3300046524 Bacteria 3492
210 Ga0495648_0042864 3300046524 Bacteria 2843
211 Ga0495648_0055266 3300046524 Bacteria 2394
212 Ga0495648_0143362 3300046524 Bacteria 1254
213 Ga0495648_0148051 3300046524 Bacteria 1227
214 Ga0495666_0000127 3300046526 Bacteria 31925
215 Ga0495642_0001227 3300046528 Bacteria 11786
216 Ga0495642_0007426 3300046528 Bacteria 4201
217 Ga0495654_0002472 3300046530 Bacteria 11886
218 Ga0495654_0007838 3300046530 Bacteria 5938
219 Ga0495654_0015870 3300046530 Bacteria 3992
220 Ga0495665_0029478 3300046531 Bacteria 2939
221 Ga0495640_0076202 3300046533 Bacteria 2238
222 Ga0495587_0012784 3300046536 Bacteria 5280
223 Ga0495609_0000144 3300046538 Bacteria 74360
224 Ga0495609_0000512 3300046538 Bacteria 31250
225 Ga0495609_0005864 3300046538 Bacteria 6367
226 Ga0495609_0006450 3300046538 Bacteria 5982
227 Ga0495609_0027325 3300046538 Bacteria 2608
228 Ga0495597_0000854 3300046542 Bacteria 23949
229 Ga0495645_0005900 3300046543 Bacteria 8458
230 Ga0495645_0038603 3300046543 Bacteria 3483
231 Ga0495622_0000037 3300046557 Bacteria 119690
232 Ga0495622_0075302 3300046557 Bacteria 1555
233 Ga0495633_0000139 3300046558 Bacteria 96799
234 Ga0495633_0000846 3300046558 Bacteria 26772
235 Ga0495633_0004054 3300046558 Bacteria 9468
236 Ga0495668_0000105 3300046616 Bacteria 133981
237 Ga0495668_0000779 3300046616 Bacteria 37172
238 Ga0495668_0004581 3300046616 Bacteria 9725
239 Ga0495668_0010449 3300046616 Bacteria 5617
240 Ga0495668_0076024 3300046616 Bacteria 1844
241 Ga0495634_0002166 3300046642 Bacteria 16535
242 Ga0495634_0016788 3300046642 Bacteria 5229
243 Ga0495634_0242175 3300046642 Bacteria 1106
244 Ga0495611_0000744 3300046648 Bacteria 18344
245 Ga0495611_0006692 3300046648 Bacteria 4904
246 Ga0495611_0052786 3300046648 Bacteria 1834
247 Ga0495625_0000336 3300046660 Bacteria 71606
248 Ga0495625_0000432 3300046660 Bacteria 63013
249 Ga0495625_0003626 3300046660 Bacteria 15146
250 Ga0495625_0006517 3300046660 Bacteria 10371
251 Ga0495625_0067797 3300046660 Bacteria 2510
252 Ga0495625_0248464 3300046660 Bacteria 1155
253 Ga0495659_0001246 3300046664 Bacteria 8797
254 Ga0495659_0032704 3300046664 Bacteria 1822
255 Ga0495661_0000155 3300046665 Bacteria 80777
256 Ga0495661_0001701 3300046665 Bacteria 17826
257 Ga0495661_0012673 3300046665 Bacteria 5690
258 Ga0495661_0036829 3300046665 Bacteria 3059
259 Ga0495661_0147177 3300046665 Bacteria 1275
260 Ga0495588_0075413 3300046674 Bacteria 1757
261 Ga0495588_0115557 3300046674 Bacteria 1414
262 Ga0495599_0001513 3300046678 Bacteria 13381
263 Ga0495623_0183777 3300046679 Bacteria 1212
264 Ga0495646_0031755 3300046680 Bacteria 3289
265 Ga0495646_0145206 3300046680 Bacteria 1323
266 Ga0495613_0010823 3300046689 Bacteria 6767
267 Ga0495613_0033058 3300046689 Bacteria 3843
268 Ga0495624_0000612 3300046690 Bacteria 27861
269 Ga0495670_0018236 3300046691 Bacteria 3455
270 Ga0495671_0000002 3300046692 Bacteria 1136189
271 Ga0495671_0008544 3300046692 Bacteria 5754
272 Ga0495671_0022014 3300046692 Bacteria 3343
273 Ga0495671_0023829 3300046692 Bacteria 3195
274 Ga0495671_0070260 3300046692 Bacteria 1720
275 Ga0495649_0000185 3300046694 Bacteria 54619
276 Ga0495649_0010785 3300046694 Bacteria 5383
277 Ga0495649_0018046 3300046694 Bacteria 3975
278 Ga0495649_0027136 3300046694 Bacteria 3178
279 Ga0495589_0000509 3300046794 Bacteria 27368
280 Ga0495589_0009984 3300046794 Bacteria 4933
281 Ga0495589_0126474 3300046794 Bacteria 1229
282 Ga0495600_0104232 3300046809 Bacteria 1848
283 Ga0495660_0002602 3300046810 Bacteria 11466
284 Ga0495660_0003147 3300046810 Bacteria 10280
285 Ga0495660_0007443 3300046810 Bacteria 6429
286 Ga0495660_0010453 3300046810 Bacteria 5399
287 Ga0495660_0013495 3300046810 Bacteria 4733
288 Ga0495660_0028160 3300046810 Bacteria 3176
289 Ga0495660_0028867 3300046810 Bacteria 3132
290 Ga0495660_0119375 3300046810 Bacteria 1336
291 Ga0495660_0119562 3300046810 Bacteria 1334
292 Ga0495581_0001090 3300047315 Bacteria 14779
293 Ga0495604_0000888 3300047317 Bacteria 24870
294 Ga0495636_0004010 3300047318 Bacteria 5755
295 Ga0495674_0016585 3300047319 Bacteria 6873
296 Ga0495674_0035058 3300047319 Bacteria 4530
297 Ga0495674_0087710 3300047319 Bacteria 2662
298 Ga0495672_0000166 3300047320 Bacteria 95954
299 Ga0495672_0000305 3300047320 Bacteria 66204
300 Ga0495672_0000588 3300047320 Bacteria 41086
301 Ga0495676_0012631 3300047321 Bacteria 7601
302 Ga0495676_0022495 3300047321 Bacteria 5482
303 Ga0495680_0009564 3300047322 Bacteria 8709
304 Ga0495680_0027295 3300047322 Bacteria 4692
305 Ga0495683_0000020 3300047323 Bacteria 181773
306 Ga0495683_0000263 3300047323 Bacteria 47152
307 Ga0495683_0008731 3300047323 Bacteria 5407
308 Ga0495683_0048906 3300047323 Bacteria 2119
309 Ga0495687_001244 3300047443 Bacteria 24274
310 Ga0495687_014424 3300047443 Bacteria 4069
311 Ga0495675_0016754 3300047444 Bacteria 4634
312 Ga0495675_0117075 3300047444 Bacteria 1661
313 Ga0495677_0000193 3300047445 Bacteria 28150
314 Ga0495677_0013391 3300047445 Bacteria 2985
315 Ga0495677_0015997 3300047445 Bacteria 2723
316 Ga0495677_0029908 3300047445 Bacteria 1981
317 Ga0495679_000036 3300047446 Bacteria 161473
318 Ga0495679_000124 3300047446 Bacteria 68362
319 Ga0495679_006475 3300047446 Bacteria 5030
320 Ga0495679_012930 3300047446 Bacteria 3155
321 Ga0495679_033944 3300047446 Bacteria 1626
322 Ga0495685_000598 3300047447 Bacteria 11120
323 Ga0495673_0000005 3300047469 Bacteria 943364
324 Ga0495673_0000026 3300047469 Bacteria 476378
325 Ga0495673_0000121 3300047469 Bacteria 144619
326 Ga0495673_0003276 3300047469 Bacteria 10782
327 Ga0495673_0009248 3300047469 Bacteria 5468
328 Ga0495673_0027084 3300047469 Bacteria 2732
329 Ga0495681_0007618 3300047470 Bacteria 6886
330 Ga0495681_0009582 3300047470 Bacteria 5948
331 Ga0495681_0015824 3300047470 Bacteria 4256
332 Ga0495681_0018946 3300047470 Bacteria 3775
333 Ga0495681_0127266 3300047470 Bacteria 1087
334 Ga0495684_0025451 3300047471 Bacteria 4547
335 Ga0495684_0079102 3300047471 Bacteria 2496
336 Ga0495686_0000080 3300047472 Bacteria 201665
337 Ga0495686_0000768 3300047472 Bacteria 42318
338 Ga0495686_0000793 3300047472 Bacteria 41237
339 Ga0495686_0028554 3300047472 Bacteria 3632
340 Ga0495686_0035986 3300047472 Bacteria 3178
341 Ga0495686_0038656 3300047472 Bacteria 3051
342 Ga0495593_0008248 3300047673 Bacteria 6062
343 Ga0495593_0030838 3300047673 Bacteria 2931
344 Ga0495602_0066127 3300048088 Bacteria 3116
345 Ga0495614_0003092 3300048089 Bacteria 7413
346 Ga0495626_0000048 3300048091 Bacteria 161634
347 Ga0495626_0014343 3300048091 Bacteria 4092
348 Ga0495626_0078847 3300048091 Bacteria 1466
349 Ga0495626_0140061 3300048091 Bacteria 1026
350 Ga0496100_0052388 3300048903 Bacteria 2653
351 Ga0496101_0027253 3300048904 Bacteria 3979
352 Ga0496101_0045161 3300048904 Bacteria 3155
353 Ga0496102_0008795 3300048905 Bacteria 8661
354 Ga0496102_0128878 3300048905 Bacteria 2366
355 Ga0496102_0145001 3300048905 Bacteria 2228
356 Ga0496103_0114664 3300048906 Bacteria 1713
357 Ga0496104_0169541 3300048907 Bacteria 2093
358 Ga0496106_0006183 3300048909 Bacteria 8853
359 Ga0496106_0153669 3300048909 Bacteria 1816
360 Ga0496107_0081282 3300048910 Bacteria 2363
361 Ga0496110_0081353 3300048913 Bacteria 2887
362 Ga0496114_0227968 3300048917 Bacteria 1636
363 Ga0496115_0165299 3300048918 Bacteria 1830
364 Ga0496117_0004142 3300048920 Bacteria 16215
365 Ga0496117_0018532 3300048920 Bacteria 5760
366 Ga0496117_0109336 3300048920 Bacteria 1726
367 Ga0496118_0020013 3300048921 Bacteria 5955
368 Ga0496120_0174904 3300048923 Bacteria 1059
369 Ga0496121_0000201 3300048924 Bacteria 131246
370 Ga0496121_0001787 3300048924 Bacteria 34789
371 Ga0496121_0027822 3300048924 Bacteria 5280
372 Ga0496121_0071380 3300048924 Bacteria 2793
373 Ga0496121_0173257 3300048924 Bacteria 1565
374 Ga0496122_0011533 3300048925 Bacteria 8938
375 Ga0496122_0056229 3300048925 Bacteria 2935
376 Ga0496123_0009364 3300048926 Bacteria 8829
377 Ga0496123_0018831 3300048926 Bacteria 5471
378 Ga0496124_0018152 3300048927 Bacteria 6601
379 Ga0496124_0065961 3300048927 Bacteria 3016
380 Ga0496125_0000569 3300048928 Bacteria 63317
381 Ga0496125_0038016 3300048928 Bacteria 4175
382 Ga0496125_0127971 3300048928 Bacteria 1795
383 Ga0496126_0000105 3300048929 Bacteria 198893
384 Ga0496126_0017671 3300048929 Bacteria 7104
385 Ga0496126_0039211 3300048929 Bacteria 4398
386 Ga0496126_0045753 3300048929 Bacteria 4020
387 Ga0495678_000077 3300049459 Bacteria 125025
388 Ga0495678_000188 3300049459 Bacteria 72283
389 Ga0495678_000445 3300049459 Bacteria 41172
390 Ga0495678_001769 3300049459 Bacteria 16004
391 Ga0495678_002973 3300049459 Bacteria 10811
392 Ga0495678_009328 3300049459 Bacteria 4864
393 Ga0495678_011197 3300049459 Bacteria 4309
394 Ga0495678_016535 3300049459 Bacteria 3369
395 Ga0495678_029748 3300049459 Bacteria 2291
396 Ga0495682_0001392 3300049460 Bacteria 13194
397 Ga0495682_0004259 3300049460 Bacteria 6184
398 Ga0495682_0044615 3300049460 Bacteria 1621
399 Ga0501031_0109363 3300049568 Bacteria 1805
400 Ga0501032_0114853 3300049569 Bacteria 1780
401 Ga0501043_0086494 3300049579 Bacteria 2463
402 Ga0501046_0197312 3300049580 Bacteria 1499
403 Ga0501047_0043344 3300049581 Bacteria 4346
404 Ga0501047_0044827 3300049581 Bacteria 4274
405 Ga0501070_0341332 3300049586 Bacteria 1217
406 Ga0501035_0118187 3300049822 Bacteria 2319
407 Ga0501035_0330547 3300049822 Bacteria 1279
408 Ga0501044_0126870 3300049823 Bacteria 2548
409 nmdc:mga03683_256922_c1 3300050489 Unclassified 812
410 nmdc:mga0k408_117141_c1 3300050493 Unclassified 1576
411 nmdc:mga06z11_16192_c1 3300050494 Bacteria 3351
412 nmdc:mga07m45_1375_c1 3300050496 Bacteria 11088
413 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
414 Ga0500647_0093300 3300053091 Bacteria 1440
415 Ga0500566_0007836 3300053094 Bacteria 6327
416 Ga0500640_000992 3300053095 Bacteria 8092
417 Ga0500554_000417 3300053102 Bacteria 9012
418 Ga0500572_008539 3300053111 Bacteria 2399
419 Ga0500595_000964 3300053119 Bacteria 16184
420 Ga0500597_079295 3300053120 Bacteria 1424
421 Ga0500614_000185 3300053123 Bacteria 16111
422 Ga0500618_000167 3300053125 Bacteria 54849
423 Ga0500559_0002619 3300053136 Bacteria 9187
424 Ga0500586_002112 3300053145 Bacteria 4397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_050213 Ga0495627_050213_494_1246 231
2 3300006177 Ga0075362_10288680 Ga0075362_102886801 236
3 3300050489 nmdc:mga03683_256922_c1 nmdc:mga03683_256922_c1_28_792 236
4 3300037418 Ga0395900_0117590 Ga0395900_0117590_590_1534 261
5 3300046810 Ga0495660_0028160 Ga0495660_0028160_1942_2814 263
6 3300046507 Ga0495606_0000305 Ga0495606_0000305_23371_24270 265
7 3300046452 Ga0495617_006372 Ga0495617_006372_2745_3623 268
8 3300046500 Ga0495596_0039718 Ga0495596_0039718_15_854 268
9 3300046530 Ga0495654_0015870 Ga0495654_0015870_280_1158 268
10 3300046810 Ga0495660_0119562 Ga0495660_0119562_232_1200 269
11 3300047469 Ga0495673_0027084 Ga0495673_0027084_1177_2058 269
12 3300049459 Ga0495678_016535 Ga0495678_016535_1938_2819 269
13 3300002704 JGI25155J39150_1000570 JGI25155J39150_10005706 270
14 3300002705 JGI25156J39149_1000039 JGI25156J39149_10000396 270
15 3300002738 JGI25154J39366_1000059 JGI25154J39366_10000596 270
16 3300002741 JGI25157J39369_1000057 JGI25157J39369_100005795 270
17 3300003758 Ga0055532_1000018 Ga0055532_1000018187 270
18 3300003761 Ga0055535_1003268 Ga0055535_10032684 270
19 3300025206 Ga0209435_100007 Ga0209435_100007377 270
20 3300025229 Ga0209147_100017 Ga0209147_10001796 270
21 3300025242 Ga0209258_100318 Ga0209258_10031818 270
22 3300025246 Ga0209646_1000096 Ga0209646_100009665 270
23 3300025250 Ga0209026_1000052 Ga0209026_1000052130 270
24 3300025256 Ga0209759_1000174 Ga0209759_100017496 270
25 3300025272 Ga0209455_1009705 Ga0209455_10097053 270
26 3300037312 Ga0395899_0005773 Ga0395899_0005773_6227_7171 270
27 3300042532 Ga0450893_0001544 Ga0450893_0001544_574_1461 270
28 3300005937 Ga0081455_10008451 Ga0081455_100084516 271
29 3300037418 Ga0395900_0078217 Ga0395900_0078217_303_1247 271
30 3300048913 Ga0496110_0081353 Ga0496110_0081353_1313_2200 271
31 3300048927 Ga0496124_0065961 Ga0496124_0065961_818_1705 271
32 3300037312 Ga0395899_0115833 Ga0395899_0115833_725_1669 272
33 3300038705 Ga0237819_00652 Ga0237819_00652_7882_8769 272
34 3300046452 Ga0495617_009365 Ga0495617_009365_1227_2114 273
35 3300046457 Ga0495590_0009833 Ga0495590_0009833_1490_2377 273
36 3300046512 Ga0495610_0096432 Ga0495610_0096432_230_1165 274
37 3300046664 Ga0495659_0032704 Ga0495659_0032704_433_1311 274
38 3300046501 Ga0495607_0067071 Ga0495607_0067071_839_1720 275
39 3300005288 Ga0065714_10003690 Ga0065714_100036902 276
40 3300013104 Ga0157370_10049460 Ga0157370_100494604 276
41 3300013306 Ga0163162_10006360 Ga0163162_100063604 276
42 3300017792 Ga0163161_10016829 Ga0163161_100168295 276
43 3300046454 Ga0495592_0021591 Ga0495592_0021591_2615_3496 276
44 3300046455 Ga0495603_0008824 Ga0495603_0008824_4511_5398 276
45 3300046455 Ga0495603_0010017 Ga0495603_0010017_3179_4066 276
46 3300046463 Ga0495653_0004003 Ga0495653_0004003_2034_2915 276
47 3300046475 Ga0495639_0121292 Ga0495639_0121292_52_939 276
48 3300046499 Ga0495594_0024675 Ga0495594_0024675_1858_2745 276
49 3300046530 Ga0495654_0007838 Ga0495654_0007838_3065_3952 276
50 3300046538 Ga0495609_0006450 Ga0495609_0006450_3161_4048 276
51 3300046543 Ga0495645_0038603 Ga0495645_0038603_713_1594 276
52 3300046557 Ga0495622_0075302 Ga0495622_0075302_290_1177 276
53 3300046642 Ga0495634_0016788 Ga0495634_0016788_1881_2762 276
54 3300046691 Ga0495670_0018236 Ga0495670_0018236_603_1490 276
55 3300046692 Ga0495671_0023829 Ga0495671_0023829_2071_2958 276
56 3300046810 Ga0495660_0013495 Ga0495660_0013495_1761_2648 276
57 3300047321 Ga0495676_0022495 Ga0495676_0022495_2688_3569 276
58 3300047322 Ga0495680_0027295 Ga0495680_0027295_1950_2831 276
59 3300047323 Ga0495683_0048906 Ga0495683_0048906_807_1694 276
60 3300047444 Ga0495675_0117075 Ga0495675_0117075_504_1385 276
61 3300047471 Ga0495684_0025451 Ga0495684_0025451_2717_3598 276
62 3300047673 Ga0495593_0008248 Ga0495593_0008248_4892_5773 276
63 3300048924 Ga0496121_0071380 Ga0496121_0071380_1194_2081 276
64 3300048928 Ga0496125_0038016 Ga0496125_0038016_1963_2850 276
65 3300002773 JGI25152J39213_1002578 JGI25152J39213_10025785 277
66 3300025258 Ga0209129_1000097 Ga0209129_100009753 277
67 3300025294 Ga0209025_1000163 Ga0209025_1000163117 277
68 3300025303 Ga0209051_1072546 Ga0209051_10725461 277
69 3300046520 Ga0495637_0006560 Ga0495637_0006560_2025_2903 278
70 3300046665 Ga0495661_0147177 Ga0495661_0147177_287_1165 278
71 3300047472 Ga0495686_0000768 Ga0495686_0000768_40820_41710 278
72 3300046616 Ga0495668_0000779 Ga0495668_0000779_16582_17454 279
73 3300047469 Ga0495673_0000026 Ga0495673_0000026_119073_119945 279
74 3300047469 Ga0495673_0000005 Ga0495673_0000005_89193_90065 280
75 3300053125 Ga0500618_000167 Ga0500618_000167_44183_45067 280
76 3300046452 Ga0495617_055506 Ga0495617_055506_319_1197 281
77 3300046458 Ga0495591_001838 Ga0495591_001838_8957_9835 281
78 3300046491 Ga0495584_0112162 Ga0495584_0112162_490_1368 281
79 3300046500 Ga0495596_0013483 Ga0495596_0013483_2318_3196 281
80 3300046518 Ga0495631_0125128 Ga0495631_0125128_140_1018 281
81 3300046524 Ga0495648_0005218 Ga0495648_0005218_4715_5593 281
82 3300046524 Ga0495648_0143362 Ga0495648_0143362_119_997 281
83 3300046810 Ga0495660_0002602 Ga0495660_0002602_1943_2821 281
84 3300047470 Ga0495681_0127266 Ga0495681_0127266_65_943 281
85 3300048091 Ga0495626_0078847 Ga0495626_0078847_101_979 281
86 3300049459 Ga0495678_029748 Ga0495678_029748_459_1337 281
87 3300042144 Ga0450889_002593 Ga0450889_002593_676_1563 282
88 3300046458 Ga0495591_010753 Ga0495591_010753_1756_2637 282
89 3300046471 Ga0495650_0080025 Ga0495650_0080025_115_996 282
90 3300046492 Ga0495585_0005878 Ga0495585_0005878_4835_5716 282
91 3300046501 Ga0495607_0199497 Ga0495607_0199497_36_917 282
92 3300046507 Ga0495606_0011536 Ga0495606_0011536_2009_2890 282
93 3300046512 Ga0495610_0002714 Ga0495610_0002714_8741_9622 282
94 3300046694 Ga0495649_0027136 Ga0495649_0027136_1790_2671 282
95 3300047446 Ga0495679_012930 Ga0495679_012930_1803_2684 282
96 3300048091 Ga0495626_0140061 Ga0495626_0140061_43_924 282
97 3300048928 Ga0496125_0127971 Ga0496125_0127971_799_1686 282
98 3300048929 Ga0496126_0017671 Ga0496126_0017671_3633_4598 282
99 3300046460 Ga0495638_0101656 Ga0495638_0101656_96_983 283
100 3300046513 Ga0495616_0005432 Ga0495616_0005432_6366_7310 283
101 3300046616 Ga0495668_0004581 Ga0495668_0004581_3772_4659 283
102 3300046810 Ga0495660_0119375 Ga0495660_0119375_415_1275 283
103 3300049459 Ga0495678_009328 Ga0495678_009328_2686_3573 283
104 3300049569 Ga0501032_0114853 Ga0501032_0114853_11_871 284
105 3300049823 Ga0501044_0126870 Ga0501044_0126870_11_871 284
106 3300046471 Ga0495650_0000086 Ga0495650_0000086_76070_76960 285
107 3300046528 Ga0495642_0007426 Ga0495642_0007426_2363_3229 285
108 3300053091 Ga0500647_0093300 Ga0500647_0093300_235_1098 285
109 3300053094 Ga0500566_0007836 Ga0500566_0007836_1327_2190 285
110 3300053095 Ga0500640_000992 Ga0500640_000992_4864_5727 285
111 3300053102 Ga0500554_000417 Ga0500554_000417_4753_5616 285
112 3300053111 Ga0500572_008539 Ga0500572_008539_769_1632 285
113 3300053119 Ga0500595_000964 Ga0500595_000964_10554_11417 285
114 3300053120 Ga0500597_079295 Ga0500597_079295_268_1131 285
115 3300053123 Ga0500614_000185 Ga0500614_000185_8654_9517 285
116 3300053136 Ga0500559_0002619 Ga0500559_0002619_4762_5625 285
117 3300053145 Ga0500586_002112 Ga0500586_002112_794_1684 285
118 3300047472 Ga0495686_0038656 Ga0495686_0038656_1841_2701 286
119 iso_pu_bacteria 2818991445 2819594196 286
120 3300037418 Ga0395900_0172589 Ga0395900_0172589_522_1397 287
121 3300037471 Ga0395905_0012057 Ga0395905_0012057_4468_5364 287
122 3300038443 Ga0395901_0106656 Ga0395901_0106656_1695_2570 287
123 3300046454 Ga0495592_0037804 Ga0495592_0037804_2440_3339 287
124 3300046457 Ga0495590_0016620 Ga0495590_0016620_1592_2473 287
125 3300046459 Ga0495629_0000138 Ga0495629_0000138_32871_33752 287
126 3300046459 Ga0495629_0000325 Ga0495629_0000325_20022_20921 287
127 3300046460 Ga0495638_0061907 Ga0495638_0061907_1178_2107 287
128 3300046460 Ga0495638_0091325 Ga0495638_0091325_275_1186 287
129 3300046460 Ga0495638_0143648 Ga0495638_0143648_190_1071 287
130 3300046463 Ga0495653_0000007 Ga0495653_0000007_106624_107520 287
131 3300046463 Ga0495653_0000446 Ga0495653_0000446_12917_13798 287
132 3300046463 Ga0495653_0002298 Ga0495653_0002298_7059_7958 287
133 3300046471 Ga0495650_0024248 Ga0495650_0024248_1805_2686 287
134 3300046472 Ga0495580_0000567 Ga0495580_0000567_23112_24011 287
135 3300046473 Ga0495582_0252920 Ga0495582_0252920_83_964 287
136 3300046476 Ga0495662_0191297 Ga0495662_0191297_46_927 287
137 3300046477 Ga0495664_0047177 Ga0495664_0047177_639_1517 287
138 3300046491 Ga0495584_0004108 Ga0495584_0004108_2511_3440 287
139 3300046501 Ga0495607_0001893 Ga0495607_0001893_15055_15984 287
140 3300046501 Ga0495607_0009613 Ga0495607_0009613_1568_2458 287
141 3300046506 Ga0495583_0001548 Ga0495583_0001548_7011_7940 287
142 3300046506 Ga0495583_0002524 Ga0495583_0002524_769_1650 287
143 3300046507 Ga0495606_0000188 Ga0495606_0000188_83106_83996 287
144 3300046507 Ga0495606_0050667 Ga0495606_0050667_113_994 287
145 3300046513 Ga0495616_0020321 Ga0495616_0020321_1226_2155 287
146 3300046514 Ga0495618_0119468 Ga0495618_0119468_500_1399 287
147 3300046515 Ga0495620_0008617 Ga0495620_0008617_1358_2239 287
148 3300046516 Ga0495628_0095834 Ga0495628_0095834_1392_2273 287
149 3300046516 Ga0495628_0152767 Ga0495628_0152767_262_1161 287
150 3300046516 Ga0495628_0191187 Ga0495628_0191187_226_1110 287
151 3300046517 Ga0495630_0036140 Ga0495630_0036140_2271_3152 287
152 3300046524 Ga0495648_0001101 Ga0495648_0001101_20394_21293 287
153 3300046524 Ga0495648_0148051 Ga0495648_0148051_130_1011 287
154 3300046526 Ga0495666_0000127 Ga0495666_0000127_27184_28083 287
155 3300046531 Ga0495665_0029478 Ga0495665_0029478_1353_2252 287
156 3300046533 Ga0495640_0076202 Ga0495640_0076202_218_1117 287
157 3300046536 Ga0495587_0012784 Ga0495587_0012784_542_1441 287
158 3300046538 Ga0495609_0000512 Ga0495609_0000512_18109_19038 287
159 3300046543 Ga0495645_0005900 Ga0495645_0005900_471_1370 287
160 3300046642 Ga0495634_0002166 Ga0495634_0002166_15474_16373 287
161 3300046642 Ga0495634_0242175 Ga0495634_0242175_23_904 287
162 3300046660 Ga0495625_0003626 Ga0495625_0003626_2078_3007 287
163 3300046660 Ga0495625_0067797 Ga0495625_0067797_344_1225 287
164 3300046664 Ga0495659_0001246 Ga0495659_0001246_6239_7168 287
165 3300046665 Ga0495661_0012673 Ga0495661_0012673_25_924 287
166 3300046674 Ga0495588_0115557 Ga0495588_0115557_151_1050 287
167 3300046678 Ga0495599_0001513 Ga0495599_0001513_5179_6078 287
168 3300046679 Ga0495623_0183777 Ga0495623_0183777_218_1117 287
169 3300046680 Ga0495646_0031755 Ga0495646_0031755_569_1468 287
170 3300046680 Ga0495646_0145206 Ga0495646_0145206_103_984 287
171 3300046689 Ga0495613_0010823 Ga0495613_0010823_5156_6055 287
172 3300046690 Ga0495624_0000612 Ga0495624_0000612_25582_26463 287
173 3300046692 Ga0495671_0000002 Ga0495671_0000002_222521_223393 287
174 3300046692 Ga0495671_0008544 Ga0495671_0008544_2976_3857 287
175 3300046694 Ga0495649_0018046 Ga0495649_0018046_1767_2696 287
176 3300046794 Ga0495589_0126474 Ga0495589_0126474_319_1200 287
177 3300046809 Ga0495600_0104232 Ga0495600_0104232_330_1214 287
178 3300046810 Ga0495660_0028867 Ga0495660_0028867_420_1349 287
179 3300047315 Ga0495581_0001090 Ga0495581_0001090_566_1465 287
180 3300047317 Ga0495604_0000888 Ga0495604_0000888_15682_16581 287
181 3300047318 Ga0495636_0004010 Ga0495636_0004010_2351_3280 287
182 3300047319 Ga0495674_0016585 Ga0495674_0016585_1264_2142 287
183 3300047319 Ga0495674_0035058 Ga0495674_0035058_1177_2091 287
184 3300047319 Ga0495674_0087710 Ga0495674_0087710_230_1129 287
185 3300047321 Ga0495676_0012631 Ga0495676_0012631_6044_6943 287
186 3300047322 Ga0495680_0009564 Ga0495680_0009564_613_1512 287
187 3300047443 Ga0495687_014424 Ga0495687_014424_860_1789 287
188 3300047444 Ga0495675_0016754 Ga0495675_0016754_447_1346 287
189 3300047445 Ga0495677_0013391 Ga0495677_0013391_617_1546 287
190 3300047446 Ga0495679_000036 Ga0495679_000036_137708_138589 287
191 3300047446 Ga0495679_006475 Ga0495679_006475_4041_4940 287
192 3300047447 Ga0495685_000598 Ga0495685_000598_6523_7452 287
193 3300047470 Ga0495681_0007618 Ga0495681_0007618_933_1862 287
194 3300047471 Ga0495684_0079102 Ga0495684_0079102_1001_1900 287
195 3300047673 Ga0495593_0030838 Ga0495593_0030838_236_1117 287
196 3300048088 Ga0495602_0066127 Ga0495602_0066127_1630_2529 287
197 3300048089 Ga0495614_0003092 Ga0495614_0003092_91_990 287
198 3300048920 Ga0496117_0018532 Ga0496117_0018532_1176_2057 287
199 3300048921 Ga0496118_0020013 Ga0496118_0020013_3409_4290 287
200 3300048924 Ga0496121_0000201 Ga0496121_0000201_49048_49920 287
201 3300048924 Ga0496121_0027822 Ga0496121_0027822_3294_4175 287
202 3300048928 Ga0496125_0000569 Ga0496125_0000569_39178_40050 287
203 3300049459 Ga0495678_011197 Ga0495678_011197_3216_4097 287
204 3300049460 Ga0495682_0004259 Ga0495682_0004259_3071_3955 287
205 3300049822 Ga0501035_0330547 Ga0501035_0330547_59_946 287
206 iso_pu_bacteria 2857558681 2857563230 287
207 3300025949 Ga0207667_10004680 Ga0207667_1000468014 288
208 3300025949 Ga0207667_10092742 Ga0207667_100927422 288
209 3300046660 Ga0495625_0000336 Ga0495625_0000336_6687_7577 288
210 3300048924 Ga0496121_0173257 Ga0496121_0173257_130_1020 288
211 iso_pu_bacteria 2511231008 2511278633 288
212 iso_pu_bacteria 2511231010 2511292551 288
213 iso_pu_bacteria 2511231023 2511370078 288
214 iso_pu_bacteria 3007614139 3007617593 288
215 iso_pu_bacteria 3007718800 3007723333 288
216 iso_pu_bacteria 8056172158 8056175562 288
217 iso_pu_bacteria 2511231003 2511252310 289
218 iso_pu_bacteria 2511231221 2512032796 289
219 iso_pu_bacteria 2738541297 2738829072 289
220 iso_pu_bacteria 2738541357 2739152868 289
221 iso_pu_bacteria 2738543003 2739194788 289
222 iso_pu_bacteria 2738543026 2739321264 289
223 iso_pu_bacteria 2738543029 2739339505 289
224 iso_pu_bacteria 2818991449 2819617842 289
225 iso_pu_bacteria 2821131069 2821134302 289
226 iso_pu_bacteria 2821443989 2821450009 289
227 iso_pu_bacteria 2884811622 2884813270 289
228 iso_pu_bacteria 2884836552 2884839526 289
229 iso_pu_bacteria 2884852848 2884856664 289
230 iso_pu_bacteria 2896154374 2896158010 289
231 iso_pu_bacteria 2902405164 2902409394 289
232 iso_pu_bacteria 2904439833 2904443485 289
233 iso_pu_bacteria 2904530477 2904532466 289
234 iso_pu_bacteria 2904584206 2904584936 289
235 iso_pu_bacteria 2904589729 2904591458 289
236 iso_pu_bacteria 2904601388 2904605480 289
237 iso_pu_bacteria 2919079590 2919081253 289
238 iso_pu_bacteria 3003665799 3003671728 289
239 3300013306 Ga0163162_10103974 Ga0163162_101039743 290
240 3300047472 Ga0495686_0000080 Ga0495686_0000080_157153_158055 290
241 3300049568 Ga0501031_0109363 Ga0501031_0109363_679_1557 290
242 3300049579 Ga0501043_0086494 Ga0501043_0086494_1421_2299 290
243 3300049580 Ga0501046_0197312 Ga0501046_0197312_388_1266 290
244 3300049581 Ga0501047_0044827 Ga0501047_0044827_1632_2510 290
245 3300049586 Ga0501070_0341332 Ga0501070_0341332_328_1206 290
246 3300049822 Ga0501035_0118187 Ga0501035_0118187_414_1292 290
247 3300013100 Ga0157373_10088364 Ga0157373_100883642 291
248 3300037312 Ga0395899_0000016 Ga0395899_0000016_124176_125066 291
249 3300046460 Ga0495638_0000047 Ga0495638_0000047_173213_174106 291
250 3300046471 Ga0495650_0001202 Ga0495650_0001202_4559_5452 291
251 3300046506 Ga0495583_0000092 Ga0495583_0000092_39516_40409 291
252 3300046524 Ga0495648_0000019 Ga0495648_0000019_231373_232266 291
253 3300046528 Ga0495642_0001227 Ga0495642_0001227_3650_4543 291
254 3300046557 Ga0495622_0000037 Ga0495622_0000037_44788_45681 291
255 3300046558 Ga0495633_0000846 Ga0495633_0000846_12443_13336 291
256 3300046660 Ga0495625_0000432 Ga0495625_0000432_23515_24408 291
257 3300049459 Ga0495678_002973 Ga0495678_002973_3887_4780 291
258 3300005327 Ga0070658_10001034 Ga0070658_100010349 292
259 3300005563 Ga0068855_100456553 Ga0068855_1004565531 292
260 3300046457 Ga0495590_0012986 Ga0495590_0012986_137_1075 292
261 3300046471 Ga0495650_0002285 Ga0495650_0002285_7703_8641 292
262 3300046507 Ga0495606_0004352 Ga0495606_0004352_1235_2170 292
263 3300046507 Ga0495606_0048324 Ga0495606_0048324_1018_1896 292
264 3300046689 Ga0495613_0033058 Ga0495613_0033058_1499_2386 292
265 3300047469 Ga0495673_0009248 Ga0495673_0009248_1207_2088 292
266 3300048904 Ga0496101_0027253 Ga0496101_0027253_1385_2296 292
267 3300048924 Ga0496121_0001787 Ga0496121_0001787_19367_20344 292
268 3300002704 JGI25155J39150_1000470 JGI25155J39150_10004705 293
269 3300002737 JGI25162J39368_1002450 JGI25162J39368_10024502 293
270 3300002738 JGI25154J39366_1000162 JGI25154J39366_10001628 293
271 3300003320 rootH2_10285126 rootH2_102851262 293
272 3300003323 rootH1_10225905 rootH1_102259052 293
273 3300003373 JGI25407J50210_10034864 JGI25407J50210_100348641 293
274 3300005262 Ga0065165_1001722 Ga0065165_10017227 293
275 3300005367 Ga0070667_100102080 Ga0070667_1001020803 293
276 3300005455 Ga0070663_100272396 Ga0070663_1002723961 293
277 3300005457 Ga0070662_100102832 Ga0070662_1001028321 293
278 3300005548 Ga0070665_100232368 Ga0070665_1002323682 293
279 3300005563 Ga0068855_100054388 Ga0068855_1000543882 293
280 3300005578 Ga0068854_100006819 Ga0068854_1000068197 293
281 3300005981 Ga0081538_10005569 Ga0081538_100055693 293
282 3300006195 Ga0075366_10138575 Ga0075366_101385752 293
283 3300009036 Ga0105244_10120551 Ga0105244_101205512 293
284 3300009093 Ga0105240_10056446 Ga0105240_100564462 293
285 3300009545 Ga0105237_10004327 Ga0105237_100043275 293
286 3300009551 Ga0105238_10000869 Ga0105238_1000086915 293
287 3300013308 Ga0157375_10043208 Ga0157375_100432082 293
288 3300014497 Ga0182008_10003299 Ga0182008_100032994 293
289 3300015261 Ga0182006_1001179 Ga0182006_10011796 293
290 3300015262 Ga0182007_10030937 Ga0182007_100309371 293
291 3300021361 Ga0213872_10027967 Ga0213872_100279673 293
292 3300025206 Ga0209435_100196 Ga0209435_1001969 293
293 3300025233 Ga0209437_100088 Ga0209437_100088196 293
294 3300025246 Ga0209646_1000061 Ga0209646_1000061129 293
295 3300025250 Ga0209026_1006244 Ga0209026_10062443 293
296 3300025254 Ga0209148_1000658 Ga0209148_10006589 293
297 3300025256 Ga0209759_1000707 Ga0209759_100070711 293
298 3300025913 Ga0207695_10002002 Ga0207695_100020029 293
299 3300025914 Ga0207671_10067415 Ga0207671_100674153 293
300 3300025920 Ga0207649_10062789 Ga0207649_100627891 293
301 3300025924 Ga0207694_10002124 Ga0207694_100021245 293
302 3300025933 Ga0207706_10118354 Ga0207706_101183543 293
303 3300025949 Ga0207667_10034944 Ga0207667_100349443 293
304 3300025981 Ga0207640_10065466 Ga0207640_100654662 293
305 3300025986 Ga0207658_10079848 Ga0207658_100798481 293
306 3300026067 Ga0207678_10292674 Ga0207678_102926742 293
307 3300027907 Ga0207428_10000305 Ga0207428_1000030534 293
308 3300037312 Ga0395899_0065115 Ga0395899_0065115_675_1565 293
309 3300037418 Ga0395900_0011643 Ga0395900_0011643_2571_3473 293
310 3300037466 Ga0395898_0002097 Ga0395898_0002097_516_1418 293
311 3300037471 Ga0395905_0001930 Ga0395905_0001930_273_1175 293
312 3300037471 Ga0395905_0013955 Ga0395905_0013955_4194_5096 293
313 3300038443 Ga0395901_0274841 Ga0395901_0274841_644_1546 293
314 3300039447 Ga0436361_0532127 Ga0436361_0532127_1274_2194 293
315 3300046452 Ga0495617_000004 Ga0495617_000004_293438_294328 293
316 3300046452 Ga0495617_000573 Ga0495617_000573_17339_18256 293
317 3300046453 Ga0495627_002439 Ga0495627_002439_6713_7609 293
318 3300046453 Ga0495627_019172 Ga0495627_019172_738_1634 293
319 3300046455 Ga0495603_0054839 Ga0495603_0054839_380_1324 293
320 3300046457 Ga0495590_0000132 Ga0495590_0000132_30933_31895 293
321 3300046457 Ga0495590_0000390 Ga0495590_0000390_1631_2557 293
322 3300046457 Ga0495590_0004502 Ga0495590_0004502_1322_2242 293
323 3300046458 Ga0495591_000132 Ga0495591_000132_31410_32372 293
324 3300046458 Ga0495591_029166 Ga0495591_029166_119_1015 293
325 3300046460 Ga0495638_0001528 Ga0495638_0001528_10689_11633 293
326 3300046471 Ga0495650_0000547 Ga0495650_0000547_6357_7244 293
327 3300046471 Ga0495650_0010729 Ga0495650_0010729_164_1060 293
328 3300046471 Ga0495650_0020808 Ga0495650_0020808_1300_2211 293
329 3300046471 Ga0495650_0025750 Ga0495650_0025750_840_1784 293
330 3300046472 Ga0495580_0002278 Ga0495580_0002278_9852_10904 293
331 3300046474 Ga0495605_0000060 Ga0495605_0000060_37133_38029 293
332 3300046474 Ga0495605_0005840 Ga0495605_0005840_5653_6597 293
333 3300046474 Ga0495605_0036986 Ga0495605_0036986_396_1358 293
334 3300046491 Ga0495584_0000135 Ga0495584_0000135_10444_11421 293
335 3300046491 Ga0495584_0000850 Ga0495584_0000850_8632_9594 293
336 3300046492 Ga0495585_0000492 Ga0495585_0000492_28344_29234 293
337 3300046492 Ga0495585_0013437 Ga0495585_0013437_3008_3970 293
338 3300046499 Ga0495594_0000810 Ga0495594_0000810_2372_3268 293
339 3300046500 Ga0495596_0003753 Ga0495596_0003753_6122_7084 293
340 3300046506 Ga0495583_0000282 Ga0495583_0000282_49974_50870 293
341 3300046506 Ga0495583_0002281 Ga0495583_0002281_8025_8987 293
342 3300046506 Ga0495583_0007962 Ga0495583_0007962_5474_6388 293
343 3300046507 Ga0495606_0000135 Ga0495606_0000135_93019_93933 293
344 3300046507 Ga0495606_0001722 Ga0495606_0001722_2224_3138 293
345 3300046507 Ga0495606_0004768 Ga0495606_0004768_10596_11573 293
346 3300046507 Ga0495606_0030042 Ga0495606_0030042_1321_2238 293
347 3300046507 Ga0495606_0060845 Ga0495606_0060845_1336_2298 293
348 3300046507 Ga0495606_0122548 Ga0495606_0122548_527_1441 293
349 3300046512 Ga0495610_0000010 Ga0495610_0000010_174399_175289 293
350 3300046512 Ga0495610_0000413 Ga0495610_0000413_33820_34782 293
351 3300046512 Ga0495610_0008782 Ga0495610_0008782_2125_3012 293
352 3300046513 Ga0495616_0002236 Ga0495616_0002236_8097_9011 293
353 3300046513 Ga0495616_0022981 Ga0495616_0022981_1814_2776 293
354 3300046515 Ga0495620_0000061 Ga0495620_0000061_42719_43615 293
355 3300046518 Ga0495631_0002060 Ga0495631_0002060_6848_7762 293
356 3300046518 Ga0495631_0011585 Ga0495631_0011585_378_1274 293
357 3300046518 Ga0495631_0012314 Ga0495631_0012314_621_1583 293
358 3300046518 Ga0495631_0040877 Ga0495631_0040877_597_1502 293
359 3300046519 Ga0495632_0000072 Ga0495632_0000072_19965_20861 293
360 3300046520 Ga0495637_0000028 Ga0495637_0000028_111832_112794 293
361 3300046520 Ga0495637_0000783 Ga0495637_0000783_6474_7391 293
362 3300046520 Ga0495637_0021336 Ga0495637_0021336_1610_2506 293
363 3300046522 Ga0495643_0000098 Ga0495643_0000098_118182_119072 293
364 3300046522 Ga0495643_0040538 Ga0495643_0040538_1282_2244 293
365 3300046523 Ga0495644_0004247 Ga0495644_0004247_1937_2851 293
366 3300046523 Ga0495644_0004431 Ga0495644_0004431_1546_2508 293
367 3300046524 Ga0495648_0002945 Ga0495648_0002945_6989_7885 293
368 3300046524 Ga0495648_0031473 Ga0495648_0031473_2057_2962 293
369 3300046524 Ga0495648_0042864 Ga0495648_0042864_573_1463 293
370 3300046524 Ga0495648_0055266 Ga0495648_0055266_793_1755 293
371 3300046530 Ga0495654_0002472 Ga0495654_0002472_7358_8254 293
372 3300046538 Ga0495609_0000144 Ga0495609_0000144_49958_50854 293
373 3300046538 Ga0495609_0005864 Ga0495609_0005864_912_1874 293
374 3300046538 Ga0495609_0027325 Ga0495609_0027325_591_1481 293
375 3300046542 Ga0495597_0000854 Ga0495597_0000854_22955_23851 293
376 3300046558 Ga0495633_0000139 Ga0495633_0000139_45049_45945 293
377 3300046558 Ga0495633_0004054 Ga0495633_0004054_4225_5187 293
378 3300046616 Ga0495668_0000105 Ga0495668_0000105_12532_13452 293
379 3300046616 Ga0495668_0010449 Ga0495668_0010449_3842_4756 293
380 3300046616 Ga0495668_0076024 Ga0495668_0076024_631_1593 293
381 3300046648 Ga0495611_0000744 Ga0495611_0000744_13286_14248 293
382 3300046648 Ga0495611_0006692 Ga0495611_0006692_3079_3975 293
383 3300046648 Ga0495611_0052786 Ga0495611_0052786_725_1630 293
384 3300046660 Ga0495625_0006517 Ga0495625_0006517_8320_9210 293
385 3300046660 Ga0495625_0248464 Ga0495625_0248464_83_976 293
386 3300046665 Ga0495661_0000155 Ga0495661_0000155_29026_29922 293
387 3300046665 Ga0495661_0001701 Ga0495661_0001701_5778_6674 293
388 3300046665 Ga0495661_0036829 Ga0495661_0036829_1352_2242 293
389 3300046674 Ga0495588_0075413 Ga0495588_0075413_71_976 293
390 3300046692 Ga0495671_0022014 Ga0495671_0022014_1556_2461 293
391 3300046692 Ga0495671_0070260 Ga0495671_0070260_121_1011 293
392 3300046694 Ga0495649_0000185 Ga0495649_0000185_40423_41385 293
393 3300046694 Ga0495649_0010785 Ga0495649_0010785_719_1633 293
394 3300046794 Ga0495589_0000509 Ga0495589_0000509_19086_19982 293
395 3300046794 Ga0495589_0009984 Ga0495589_0009984_353_1297 293
396 3300046810 Ga0495660_0003147 Ga0495660_0003147_5131_6036 293
397 3300046810 Ga0495660_0007443 Ga0495660_0007443_3878_4840 293
398 3300046810 Ga0495660_0010453 Ga0495660_0010453_2937_3833 293
399 3300047320 Ga0495672_0000166 Ga0495672_0000166_39224_40120 293
400 3300047320 Ga0495672_0000305 Ga0495672_0000305_31410_32372 293
401 3300047320 Ga0495672_0000588 Ga0495672_0000588_13660_14550 293
402 3300047323 Ga0495683_0000020 Ga0495683_0000020_107724_108620 293
403 3300047323 Ga0495683_0000263 Ga0495683_0000263_33824_34786 293
404 3300047323 Ga0495683_0008731 Ga0495683_0008731_584_1498 293
405 3300047443 Ga0495687_001244 Ga0495687_001244_12594_13571 293
406 3300047445 Ga0495677_0000193 Ga0495677_0000193_8031_8993 293
407 3300047445 Ga0495677_0015997 Ga0495677_0015997_1700_2590 293
408 3300047445 Ga0495677_0029908 Ga0495677_0029908_217_1131 293
409 3300047446 Ga0495679_000124 Ga0495679_000124_50002_50898 293
410 3300047446 Ga0495679_033944 Ga0495679_033944_480_1370 293
411 3300047469 Ga0495673_0000121 Ga0495673_0000121_18878_19771 293
412 3300047469 Ga0495673_0003276 Ga0495673_0003276_3135_4031 293
413 3300047470 Ga0495681_0009582 Ga0495681_0009582_1172_2086 293
414 3300047470 Ga0495681_0015824 Ga0495681_0015824_2921_3883 293
415 3300047470 Ga0495681_0018946 Ga0495681_0018946_1651_2547 293
416 3300047472 Ga0495686_0000793 Ga0495686_0000793_14957_15991 293
417 3300047472 Ga0495686_0028554 Ga0495686_0028554_1263_2174 293
418 3300047472 Ga0495686_0035986 Ga0495686_0035986_2026_2988 293
419 3300048091 Ga0495626_0000048 Ga0495626_0000048_140561_141469 293
420 3300048091 Ga0495626_0014343 Ga0495626_0014343_371_1285 293
421 3300048903 Ga0496100_0052388 Ga0496100_0052388_1634_2578 293
422 3300048904 Ga0496101_0045161 Ga0496101_0045161_415_1359 293
423 3300048905 Ga0496102_0008795 Ga0496102_0008795_3293_4237 293
424 3300048905 Ga0496102_0128878 Ga0496102_0128878_459_1355 293
425 3300048905 Ga0496102_0145001 Ga0496102_0145001_61_975 293
426 3300048906 Ga0496103_0114664 Ga0496103_0114664_619_1515 293
427 3300048907 Ga0496104_0169541 Ga0496104_0169541_226_1170 293
428 3300048909 Ga0496106_0006183 Ga0496106_0006183_6381_7325 293
429 3300048909 Ga0496106_0153669 Ga0496106_0153669_857_1801 293
430 3300048910 Ga0496107_0081282 Ga0496107_0081282_660_1604 293
431 3300048917 Ga0496114_0227968 Ga0496114_0227968_657_1601 293
432 3300048918 Ga0496115_0165299 Ga0496115_0165299_483_1382 293
433 3300048920 Ga0496117_0004142 Ga0496117_0004142_5946_6878 293
434 3300048920 Ga0496117_0109336 Ga0496117_0109336_304_1218 293
435 3300048923 Ga0496120_0174904 Ga0496120_0174904_17_916 293
436 3300048925 Ga0496122_0011533 Ga0496122_0011533_1567_2463 293
437 3300048925 Ga0496122_0056229 Ga0496122_0056229_659_1549 293
438 3300048926 Ga0496123_0009364 Ga0496123_0009364_4083_4979 293
439 3300048926 Ga0496123_0018831 Ga0496123_0018831_4348_5262 293
440 3300048927 Ga0496124_0018152 Ga0496124_0018152_1339_2301 293
441 3300048929 Ga0496126_0000105 Ga0496126_0000105_26948_27880 293
442 3300048929 Ga0496126_0039211 Ga0496126_0039211_2727_3608 293
443 3300048929 Ga0496126_0045753 Ga0496126_0045753_77_976 293
444 3300049459 Ga0495678_000077 Ga0495678_000077_85244_86140 293
445 3300049459 Ga0495678_000188 Ga0495678_000188_30680_31642 293
446 3300049459 Ga0495678_000445 Ga0495678_000445_26619_27509 293
447 3300049459 Ga0495678_001769 Ga0495678_001769_7115_8029 293
448 3300049460 Ga0495682_0001392 Ga0495682_0001392_5179_6093 293
449 3300049460 Ga0495682_0044615 Ga0495682_0044615_284_1246 293
450 3300049581 Ga0501047_0043344 Ga0501047_0043344_890_1783 293
451 3300050493 nmdc:mga0k408_117141_c1 nmdc:mga0k408_117141_c1_112_1047 293
452 3300050494 nmdc:mga06z11_16192_c1 nmdc:mga06z11_16192_c1_1265_2200 293
453 3300050496 nmdc:mga07m45_1375_c1 nmdc:mga07m45_1375_c1_3912_4811 293
454 3300050511 nmdc:mga08y16_33_c1 nmdc:mga08y16_33_c1_75100_76074 293
455 iso_pu_bacteria 8047673197 8047676766 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03466

LysR_substrate

LysR substrate binding domain

127

333

0.98

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

44

103

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9696 3 84
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9545 3 87
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9481 3 90
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9447 3 90
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.9432 3 86
ID Description Score Start End Superfamily
af_P45463_8_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9883 5 85 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9797 4 85 1.10.10.10
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9763 3 86 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.976 3 82 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9751 4 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9865 1 83 GO:0003700
GO:0006351
GO:0043565
AF-A0A833KNX1-F1-model_v4 deleted 0.9725 3 74
AF-A0A553ZST6-F1-model_v4 LysR family transcriptional regulator 0.9715 1 80 GO:0003700
GO:0006351
GO:0043565
AF-A0A658JMP9-F1-model_v4 deleted 0.9665 1 80
AF-A0A6I5XAC4-F1-model_v4 LysR family transcriptional regulator 0.9652 1 85 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.03 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map