F447410
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 454 | 348 | 368 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300031691|Ga0316579_10006447|Ga0316579_100064472 |
| Length | 168 |
| Sequence | MIAGATDRARPDYMSRAPTAGNPFDLNRFVEAQSGDYEQALRELRRGRKVGHWIWYILPQMRGLGMSSMSSRYGIGSLDEAKAYLAHPVLGPRLRECVEAVCTHKGMSAGQILGSLDAMKFRSCLTLFAEADGPDSAFARALGQFFDDQRDPKTLELLGRSSRGGGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 5 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 6 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 7 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 8 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 9 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 10 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 11 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 12 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 13 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 14 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 15 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 16 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 17 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 18 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 19 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 20 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 21 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 22 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 23 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 24 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 25 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 26 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 27 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 28 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 29 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 30 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 31 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 32 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 33 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 34 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 35 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 36 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 37 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 38 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 39 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 40 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 41 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 42 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 43 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 44 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 45 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 46 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 47 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 48 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 49 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 50 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 51 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 52 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 53 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 54 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 55 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 56 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 57 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 58 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 59 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 60 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 61 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 62 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 63 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 64 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 65 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 66 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 67 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 68 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 69 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 70 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 130 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 155 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 156 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 293 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 294 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 296 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 297 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 301 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 302 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 307 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 310 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 317 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 318 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 322 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 324 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 327 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 329 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 330 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 331 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 332 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 333 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 334 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 335 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 336 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 337 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 338 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 339 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 340 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 341 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 342 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 343 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 344 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 345 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 346 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 347 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 348 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.06 |
| Metatranscriptomes | 0 |
| Isolates | 18.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.86 |
| Nodule | 15.64 |
| Rhizoplane | 4.41 |
| Rhizosphere | 55.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10024675 | 3300001989 | Bacteria | 2118 |
| 2 | JGI24737J22298_10147813 | 3300001990 | Bacteria | 694 |
| 3 | JGI25153J46596_10000531 | 3300003215 | Bacteria | 23973 |
| 4 | JGI25153J46596_10086934 | 3300003215 | Bacteria | 765 |
| 5 | Ga0055543_1003684 | 3300004625 | Bacteria | 4409 |
| 6 | Ga0065165_1000780 | 3300005262 | Bacteria | 42673 |
| 7 | Ga0065165_1000826 | 3300005262 | Bacteria | 40863 |
| 8 | Ga0065165_1020047 | 3300005262 | Bacteria | 2368 |
| 9 | Ga0070670_100053143 | 3300005331 | Bacteria | 3479 |
| 10 | Ga0070670_100448409 | 3300005331 | Bacteria | 1143 |
| 11 | Ga0070670_101782643 | 3300005331 | Bacteria | 567 |
| 12 | Ga0070680_100236039 | 3300005336 | Bacteria | 1545 |
| 13 | Ga0070680_100508089 | 3300005336 | Bacteria | 1031 |
| 14 | Ga0068868_100324211 | 3300005338 | Bacteria | 1313 |
| 15 | Ga0070692_10836234 | 3300005345 | Bacteria | 631 |
| 16 | Ga0070668_100021775 | 3300005347 | Bacteria | 4843 |
| 17 | Ga0070668_100516004 | 3300005347 | Bacteria | 1036 |
| 18 | Ga0070669_100107030 | 3300005353 | Bacteria | 2118 |
| 19 | Ga0070669_100327154 | 3300005353 | Bacteria | 1239 |
| 20 | Ga0070675_100048053 | 3300005354 | Bacteria | 3498 |
| 21 | Ga0070675_100375683 | 3300005354 | Bacteria | 1264 |
| 22 | Ga0070671_100151444 | 3300005355 | Bacteria | 1959 |
| 23 | Ga0070673_100232193 | 3300005364 | Bacteria | 1601 |
| 24 | Ga0070667_100019257 | 3300005367 | Bacteria | 5662 |
| 25 | Ga0070667_100111188 | 3300005367 | Bacteria | 2376 |
| 26 | Ga0070709_10001247 | 3300005434 | Bacteria | 13912 |
| 27 | Ga0070713_100000233 | 3300005436 | Bacteria | 36949 |
| 28 | Ga0070713_100104750 | 3300005436 | Bacteria | 2456 |
| 29 | Ga0070700_100538139 | 3300005441 | Bacteria | 905 |
| 30 | Ga0070708_100098743 | 3300005445 | Bacteria | 2670 |
| 31 | Ga0070663_100060896 | 3300005455 | Bacteria | 2717 |
| 32 | Ga0070663_100218721 | 3300005455 | Bacteria | 1494 |
| 33 | Ga0070663_101142470 | 3300005455 | Bacteria | 682 |
| 34 | Ga0070681_10055383 | 3300005458 | Bacteria | 3948 |
| 35 | Ga0068867_100226107 | 3300005459 | Bacteria | 1510 |
| 36 | Ga0068867_100510395 | 3300005459 | Bacteria | 1035 |
| 37 | Ga0070706_100737207 | 3300005467 | Bacteria | 913 |
| 38 | Ga0070698_100125232 | 3300005471 | Bacteria | 2527 |
| 39 | Ga0070679_100244072 | 3300005530 | Bacteria | 1753 |
| 40 | Ga0068853_101102358 | 3300005539 | Bacteria | 765 |
| 41 | Ga0068853_101212525 | 3300005539 | Bacteria | 729 |
| 42 | Ga0070672_100719060 | 3300005543 | Bacteria | 875 |
| 43 | Ga0070672_100948002 | 3300005543 | Unclassified | 761 |
| 44 | Ga0070686_100448910 | 3300005544 | Bacteria | 991 |
| 45 | Ga0070695_100064803 | 3300005545 | Bacteria | 2378 |
| 46 | Ga0070696_100354829 | 3300005546 | Bacteria | 1136 |
| 47 | Ga0070665_100032656 | 3300005548 | Bacteria | 5239 |
| 48 | Ga0070665_100794606 | 3300005548 | Bacteria | 959 |
| 49 | Ga0068855_100418488 | 3300005563 | Bacteria | 1466 |
| 50 | Ga0068855_100549860 | 3300005563 | Bacteria | 1250 |
| 51 | Ga0070664_100430547 | 3300005564 | Bacteria | 1209 |
| 52 | Ga0070664_100445397 | 3300005564 | Bacteria | 1188 |
| 53 | Ga0068857_100093990 | 3300005577 | Bacteria | 2685 |
| 54 | Ga0068857_100444951 | 3300005577 | Bacteria | 1211 |
| 55 | Ga0068857_100786323 | 3300005577 | Bacteria | 908 |
| 56 | Ga0068854_100100778 | 3300005578 | Bacteria | 2165 |
| 57 | Ga0068856_100026975 | 3300005614 | Bacteria | 5603 |
| 58 | Ga0068856_100087920 | 3300005614 | Bacteria | 3090 |
| 59 | Ga0068852_100604323 | 3300005616 | Bacteria | 1101 |
| 60 | Ga0068852_101140165 | 3300005616 | Bacteria | 800 |
| 61 | Ga0068859_100065505 | 3300005617 | Bacteria | 3667 |
| 62 | Ga0068859_100259497 | 3300005617 | Bacteria | 1829 |
| 63 | Ga0068864_100777004 | 3300005618 | Bacteria | 940 |
| 64 | Ga0068863_100735157 | 3300005841 | Bacteria | 982 |
| 65 | Ga0068858_100288122 | 3300005842 | Bacteria | 1565 |
| 66 | Ga0068860_100027100 | 3300005843 | Bacteria | 5521 |
| 67 | Ga0081540_1053755 | 3300005983 | Bacteria | 1972 |
| 68 | Ga0081539_10010966 | 3300005985 | Bacteria | 7261 |
| 69 | Ga0075365_10225717 | 3300006038 | Bacteria | 1314 |
| 70 | Ga0075368_10007965 | 3300006042 | Bacteria | 3758 |
| 71 | Ga0075363_100039423 | 3300006048 | Bacteria | 2486 |
| 72 | Ga0075364_10106450 | 3300006051 | Bacteria | 1869 |
| 73 | Ga0070715_10246376 | 3300006163 | Bacteria | 932 |
| 74 | Ga0070716_100000644 | 3300006173 | Bacteria | 14828 |
| 75 | Ga0070712_100000024 | 3300006175 | Bacteria | 78736 |
| 76 | Ga0075367_10117086 | 3300006178 | Bacteria | 1640 |
| 77 | Ga0075369_10130778 | 3300006186 | Bacteria | 1140 |
| 78 | Ga0075366_10057401 | 3300006195 | Bacteria | 2314 |
| 79 | Ga0097621_100525081 | 3300006237 | Bacteria | 1075 |
| 80 | Ga0097621_100963230 | 3300006237 | Unclassified | 797 |
| 81 | Ga0075370_10199708 | 3300006353 | Bacteria | 1179 |
| 82 | Ga0068871_101363038 | 3300006358 | Bacteria | 668 |
| 83 | Ga0075428_102339997 | 3300006844 | Bacteria | 549 |
| 84 | Ga0075431_100066871 | 3300006847 | Bacteria | 3710 |
| 85 | Ga0075431_100481949 | 3300006847 | Bacteria | 1233 |
| 86 | Ga0068865_100178100 | 3300006881 | Bacteria | 1635 |
| 87 | Ga0075436_101008089 | 3300006914 | Bacteria | 625 |
| 88 | Ga0097620_100065506 | 3300006931 | Bacteria | 3667 |
| 89 | Ga0097620_100259492 | 3300006931 | Bacteria | 1829 |
| 90 | Ga0099824_1029046 | 3300006942 | Bacteria | 2413 |
| 91 | Ga0099823_1016643 | 3300006944 | Bacteria | 7202 |
| 92 | Ga0105240_10022911 | 3300009093 | Bacteria | 8273 |
| 93 | Ga0105245_10817684 | 3300009098 | Bacteria | 970 |
| 94 | Ga0105247_10154490 | 3300009101 | Bacteria | 1515 |
| 95 | Ga0114129_11740026 | 3300009147 | Unclassified | 760 |
| 96 | Ga0114129_12583464 | 3300009147 | Bacteria | 606 |
| 97 | Ga0105243_10133082 | 3300009148 | Bacteria | 2112 |
| 98 | Ga0105243_11294830 | 3300009148 | Bacteria | 746 |
| 99 | Ga0105241_10139225 | 3300009174 | Bacteria | 1974 |
| 100 | Ga0105242_11747466 | 3300009176 | Bacteria | 659 |
| 101 | Ga0105248_10102158 | 3300009177 | Bacteria | 3231 |
| 102 | Ga0105237_10103257 | 3300009545 | Bacteria | 2842 |
| 103 | Ga0105237_11271734 | 3300009545 | Bacteria | 742 |
| 104 | Ga0105237_11655442 | 3300009545 | Bacteria | 647 |
| 105 | Ga0105238_10529250 | 3300009551 | Bacteria | 1182 |
| 106 | Ga0105238_10529790 | 3300009551 | Bacteria | 1181 |
| 107 | Ga0105249_11533378 | 3300009553 | Bacteria | 739 |
| 108 | Ga0105239_10137660 | 3300010375 | Bacteria | 2718 |
| 109 | Ga0105239_10408629 | 3300010375 | Bacteria | 1537 |
| 110 | Ga0105239_10576323 | 3300010375 | Bacteria | 1283 |
| 111 | Ga0105246_10103876 | 3300011119 | Bacteria | 2074 |
| 112 | Ga0157369_10361915 | 3300013105 | Bacteria | 1506 |
| 113 | Ga0157369_10610258 | 3300013105 | Bacteria | 1126 |
| 114 | Ga0157378_10576289 | 3300013297 | Bacteria | 1134 |
| 115 | Ga0157378_10743172 | 3300013297 | Bacteria | 1003 |
| 116 | Ga0157378_13315440 | 3300013297 | Bacteria | 500 |
| 117 | Ga0163162_11504809 | 3300013306 | Bacteria | 767 |
| 118 | Ga0157372_10539685 | 3300013307 | Bacteria | 1360 |
| 119 | Ga0157372_11831362 | 3300013307 | Bacteria | 698 |
| 120 | Ga0157375_10030275 | 3300013308 | Bacteria | 5102 |
| 121 | Ga0157375_10524451 | 3300013308 | Bacteria | 1347 |
| 122 | Ga0163163_10051180 | 3300014325 | Bacteria | 4072 |
| 123 | Ga0163163_10080821 | 3300014325 | Bacteria | 3251 |
| 124 | Ga0157380_10526523 | 3300014326 | Bacteria | 1154 |
| 125 | Ga0182008_10300230 | 3300014497 | Bacteria | 840 |
| 126 | Ga0157379_10153320 | 3300014968 | Bacteria | 2078 |
| 127 | Ga0157379_10244318 | 3300014968 | Bacteria | 1628 |
| 128 | Ga0157379_10345374 | 3300014968 | Bacteria | 1362 |
| 129 | Ga0163161_10745314 | 3300017792 | Bacteria | 819 |
| 130 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 131 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 132 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 133 | Ga0209563_103040 | 3300025230 | Bacteria | 3584 |
| 134 | Ga0209677_101583 | 3300025253 | Bacteria | 9653 |
| 135 | Ga0209148_1000289 | 3300025254 | Bacteria | 75390 |
| 136 | Ga0209233_1002174 | 3300025261 | Bacteria | 7347 |
| 137 | Ga0209455_1000612 | 3300025272 | Bacteria | 22684 |
| 138 | Ga0209758_1000160 | 3300025297 | Bacteria | 154304 |
| 139 | Ga0209758_1041384 | 3300025297 | Bacteria | 1723 |
| 140 | Ga0209758_1049219 | 3300025297 | Bacteria | 1490 |
| 141 | Ga0207426_1003500 | 3300025302 | Bacteria | 8458 |
| 142 | Ga0207426_1060622 | 3300025302 | Bacteria | 1089 |
| 143 | Ga0207710_10048868 | 3300025900 | Bacteria | 1894 |
| 144 | Ga0207647_10018357 | 3300025904 | Bacteria | 4734 |
| 145 | Ga0207647_10219805 | 3300025904 | Bacteria | 1095 |
| 146 | Ga0207699_10000729 | 3300025906 | Bacteria | 15708 |
| 147 | Ga0207654_10054765 | 3300025911 | Bacteria | 2306 |
| 148 | Ga0207695_10073276 | 3300025913 | Bacteria | 3490 |
| 149 | Ga0207671_10019111 | 3300025914 | Bacteria | 5248 |
| 150 | Ga0207671_11042516 | 3300025914 | Unclassified | 644 |
| 151 | Ga0207693_10000528 | 3300025915 | Bacteria | 34513 |
| 152 | Ga0207660_10127087 | 3300025917 | Bacteria | 1937 |
| 153 | Ga0207660_10495489 | 3300025917 | Bacteria | 991 |
| 154 | Ga0207657_10437850 | 3300025919 | Bacteria | 1026 |
| 155 | Ga0207657_10456492 | 3300025919 | Bacteria | 1002 |
| 156 | Ga0207652_10458614 | 3300025921 | Bacteria | 1149 |
| 157 | Ga0207646_10523410 | 3300025922 | Archaea | 1067 |
| 158 | Ga0207681_10061687 | 3300025923 | Bacteria | 2579 |
| 159 | Ga0207681_10295468 | 3300025923 | Bacteria | 1280 |
| 160 | Ga0207694_10303452 | 3300025924 | Bacteria | 1315 |
| 161 | Ga0207650_10151534 | 3300025925 | Bacteria | 1830 |
| 162 | Ga0207650_10850043 | 3300025925 | Bacteria | 774 |
| 163 | Ga0207659_10049753 | 3300025926 | Bacteria | 2974 |
| 164 | Ga0207659_10508734 | 3300025926 | Bacteria | 1020 |
| 165 | Ga0207700_10003329 | 3300025928 | Bacteria | 9322 |
| 166 | Ga0207700_10853972 | 3300025928 | Bacteria | 814 |
| 167 | Ga0207700_10938869 | 3300025928 | Bacteria | 774 |
| 168 | Ga0207644_10292493 | 3300025931 | Bacteria | 1310 |
| 169 | Ga0207686_10205145 | 3300025934 | Bacteria | 1414 |
| 170 | Ga0207709_10072710 | 3300025935 | Bacteria | 2188 |
| 171 | Ga0207704_10459984 | 3300025938 | Bacteria | 1017 |
| 172 | Ga0207665_10014123 | 3300025939 | Bacteria | 5253 |
| 173 | Ga0207691_10825029 | 3300025940 | Unclassified | 778 |
| 174 | Ga0207711_10269869 | 3300025941 | Bacteria | 1565 |
| 175 | Ga0207711_11537759 | 3300025941 | Bacteria | 608 |
| 176 | Ga0207689_10717360 | 3300025942 | Bacteria | 843 |
| 177 | Ga0207679_10028248 | 3300025945 | Bacteria | 3890 |
| 178 | Ga0207667_10293982 | 3300025949 | Bacteria | 1659 |
| 179 | Ga0207667_10713764 | 3300025949 | Bacteria | 1004 |
| 180 | Ga0207651_10195949 | 3300025960 | Bacteria | 1615 |
| 181 | Ga0207712_10081066 | 3300025961 | Bacteria | 2362 |
| 182 | Ga0207668_10351426 | 3300025972 | Bacteria | 1233 |
| 183 | Ga0207640_10290500 | 3300025981 | Bacteria | 1289 |
| 184 | Ga0207658_10059628 | 3300025986 | Bacteria | 2844 |
| 185 | Ga0207658_10102595 | 3300025986 | Bacteria | 2244 |
| 186 | Ga0207658_10622904 | 3300025986 | Bacteria | 971 |
| 187 | Ga0207677_11574832 | 3300026023 | Bacteria | 608 |
| 188 | Ga0207703_10271230 | 3300026035 | Bacteria | 1537 |
| 189 | Ga0207703_10576725 | 3300026035 | Bacteria | 1063 |
| 190 | Ga0207703_11467579 | 3300026035 | Bacteria | 656 |
| 191 | Ga0207639_11228906 | 3300026041 | Bacteria | 703 |
| 192 | Ga0207678_10087280 | 3300026067 | Bacteria | 2666 |
| 193 | Ga0207678_10251468 | 3300026067 | Bacteria | 1514 |
| 194 | Ga0207702_10000993 | 3300026078 | Bacteria | 29058 |
| 195 | Ga0207702_10021105 | 3300026078 | Bacteria | 5390 |
| 196 | Ga0207702_10533736 | 3300026078 | Bacteria | 1146 |
| 197 | Ga0207648_10538873 | 3300026089 | Bacteria | 1071 |
| 198 | Ga0207674_10114495 | 3300026116 | Bacteria | 2669 |
| 199 | Ga0207674_10511119 | 3300026116 | Bacteria | 1160 |
| 200 | Ga0207674_10581150 | 3300026116 | Bacteria | 1082 |
| 201 | Ga0207683_10130326 | 3300026121 | Bacteria | 2262 |
| 202 | Ga0207698_10337872 | 3300026142 | Bacteria | 1417 |
| 203 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 204 | Ga0209489_103917 | 3300027361 | Bacteria | 28294 |
| 205 | Ga0209700_100036 | 3300027363 | Bacteria | 187888 |
| 206 | Ga0209813_10062209 | 3300027866 | Bacteria | 1194 |
| 207 | Ga0268266_10144787 | 3300028379 | Bacteria | 2135 |
| 208 | Ga0268266_10214744 | 3300028379 | Bacteria | 1766 |
| 209 | Ga0268264_10022569 | 3300028381 | Bacteria | 5137 |
| 210 | Ga0265338_10013374 | 3300028800 | Bacteria | 9272 |
| 211 | Ga0265325_10000451 | 3300031241 | Bacteria | 29659 |
| 212 | Ga0265339_10004264 | 3300031249 | Bacteria | 9781 |
| 213 | Ga0265316_10030700 | 3300031344 | Bacteria | 4402 |
| 214 | Ga0307408_100249104 | 3300031548 | Bacteria | 1464 |
| 215 | Ga0265313_10001684 | 3300031595 | Bacteria | 20414 |
| 216 | Ga0316579_10006447 | 3300031691 | Bacteria | 4790 |
| 217 | Ga0265314_10003943 | 3300031711 | Bacteria | 14082 |
| 218 | Ga0316578_10019617 | 3300031728 | Bacteria | 3726 |
| 219 | Ga0307416_101012301 | 3300032002 | Bacteria | 934 |
| 220 | Ga0307510_10007884 | 3300033180 | Bacteria | 12686 |
| 221 | Ga0316574_0409911 | 3300035398 | Unclassified | 853 |
| 222 | Ga0316574_0667428 | 3300035398 | Unclassified | 639 |
| 223 | Ga0373933_0897960 | 3300035724 | Unclassified | 583 |
| 224 | Ga0395900_0001114 | 3300037418 | Bacteria | 34044 |
| 225 | Ga0395900_0156313 | 3300037418 | Bacteria | 2329 |
| 226 | Ga0395900_0395246 | 3300037418 | Bacteria | 1348 |
| 227 | Ga0395898_0008436 | 3300037466 | Bacteria | 10891 |
| 228 | Ga0395898_0378588 | 3300037466 | Bacteria | 1350 |
| 229 | Ga0395905_0044671 | 3300037471 | Bacteria | 4157 |
| 230 | Ga0395905_0238134 | 3300037471 | Bacteria | 1701 |
| 231 | Ga0316581_0033206 | 3300037588 | Bacteria | 1558 |
| 232 | Ga0436364_1295084 | 3300037853 | Bacteria | 2009 |
| 233 | Ga0395901_0071243 | 3300038443 | Bacteria | 3622 |
| 234 | Ga0395901_0760654 | 3300038443 | Bacteria | 961 |
| 235 | Ga0436361_1084244 | 3300039447 | Bacteria | 594 |
| 236 | Ga0466969_0152761 | 3300044656 | Bacteria | 1063 |
| 237 | Ga0466972_0000142 | 3300044658 | Bacteria | 58711 |
| 238 | Ga0466972_0219489 | 3300044658 | Bacteria | 889 |
| 239 | Ga0466965_0065069 | 3300044683 | Bacteria | 1826 |
| 240 | Ga0466965_0077284 | 3300044683 | Bacteria | 1681 |
| 241 | Ga0466965_0305537 | 3300044683 | Bacteria | 864 |
| 242 | Ga0466966_0016700 | 3300044684 | Bacteria | 4849 |
| 243 | Ga0466966_0064757 | 3300044684 | Bacteria | 2300 |
| 244 | Ga0466961_0210727 | 3300044693 | Bacteria | 1199 |
| 245 | Ga0466968_0005776 | 3300044735 | Bacteria | 4641 |
| 246 | Ga0466968_0136335 | 3300044735 | Bacteria | 1120 |
| 247 | Ga0466970_0022116 | 3300044765 | Bacteria | 3319 |
| 248 | Ga0466970_0059184 | 3300044765 | Bacteria | 2052 |
| 249 | Ga0466957_0553222 | 3300044842 | Bacteria | 802 |
| 250 | Ga0466960_0031341 | 3300044901 | Bacteria | 2453 |
| 251 | Ga0466960_0543422 | 3300044901 | Bacteria | 685 |
| 252 | Ga0466959_0300790 | 3300045049 | Bacteria | 1099 |
| 253 | Ga0466958_0073290 | 3300045836 | Bacteria | 2098 |
| 254 | Ga0495603_0426001 | 3300046455 | Bacteria | 760 |
| 255 | Ga0495638_0000398 | 3300046460 | Bacteria | 53469 |
| 256 | Ga0495605_0233551 | 3300046474 | Bacteria | 791 |
| 257 | Ga0495583_0122799 | 3300046506 | Bacteria | 1092 |
| 258 | Ga0495606_0126837 | 3300046507 | Bacteria | 1521 |
| 259 | Ga0495610_0036754 | 3300046512 | Bacteria | 2500 |
| 260 | Ga0495632_0108434 | 3300046519 | Bacteria | 1305 |
| 261 | Ga0495643_0054782 | 3300046522 | Bacteria | 2133 |
| 262 | Ga0495643_0079759 | 3300046522 | Bacteria | 1706 |
| 263 | Ga0495648_0213841 | 3300046524 | Bacteria | 956 |
| 264 | Ga0495648_0243905 | 3300046524 | Bacteria | 871 |
| 265 | Ga0495597_0158803 | 3300046542 | Bacteria | 924 |
| 266 | Ga0495622_0270056 | 3300046557 | Bacteria | 745 |
| 267 | Ga0495668_0032962 | 3300046616 | Bacteria | 2912 |
| 268 | Ga0495668_0592950 | 3300046616 | Bacteria | 612 |
| 269 | Ga0495611_0127568 | 3300046648 | Bacteria | 1187 |
| 270 | Ga0495625_0243766 | 3300046660 | Bacteria | 1169 |
| 271 | Ga0495625_0462246 | 3300046660 | Bacteria | 782 |
| 272 | Ga0495661_0252063 | 3300046665 | Bacteria | 901 |
| 273 | Ga0495661_0300726 | 3300046665 | Bacteria | 803 |
| 274 | Ga0495588_0264004 | 3300046674 | Bacteria | 907 |
| 275 | Ga0495649_0000802 | 3300046694 | Bacteria | 25323 |
| 276 | Ga0495683_0013708 | 3300047323 | Bacteria | 4234 |
| 277 | Ga0495687_003920 | 3300047443 | Bacteria | 10425 |
| 278 | Ga0495687_076472 | 3300047443 | Bacteria | 1325 |
| 279 | Ga0495673_0116035 | 3300047469 | Bacteria | 1065 |
| 280 | Ga0496100_0124002 | 3300048903 | Bacteria | 1811 |
| 281 | Ga0496100_0482436 | 3300048903 | Bacteria | 954 |
| 282 | Ga0496101_0055608 | 3300048904 | Bacteria | 2859 |
| 283 | Ga0496101_0568468 | 3300048904 | Bacteria | 896 |
| 284 | Ga0496103_0616495 | 3300048906 | Bacteria | 691 |
| 285 | Ga0496104_0149248 | 3300048907 | Bacteria | 2245 |
| 286 | Ga0496105_0082518 | 3300048908 | Bacteria | 2655 |
| 287 | Ga0496105_0176064 | 3300048908 | Bacteria | 1752 |
| 288 | Ga0496108_0043991 | 3300048911 | Bacteria | 3729 |
| 289 | Ga0496109_0049410 | 3300048912 | Bacteria | 3829 |
| 290 | Ga0496109_1209096 | 3300048912 | Unclassified | 692 |
| 291 | Ga0496110_0147859 | 3300048913 | Bacteria | 2126 |
| 292 | Ga0496112_0048748 | 3300048915 | Bacteria | 4151 |
| 293 | Ga0496112_0153753 | 3300048915 | Bacteria | 2268 |
| 294 | Ga0496112_0409530 | 3300048915 | Bacteria | 1295 |
| 295 | Ga0496113_0023123 | 3300048916 | Bacteria | 4405 |
| 296 | Ga0496113_0710273 | 3300048916 | Bacteria | 802 |
| 297 | Ga0496114_0225581 | 3300048917 | Bacteria | 1645 |
| 298 | Ga0496115_0262377 | 3300048918 | Bacteria | 1420 |
| 299 | Ga0496115_0330296 | 3300048918 | Bacteria | 1246 |
| 300 | Ga0496117_0140912 | 3300048920 | Bacteria | 1444 |
| 301 | Ga0496118_0070532 | 3300048921 | Bacteria | 2522 |
| 302 | Ga0496118_0073567 | 3300048921 | Bacteria | 2447 |
| 303 | Ga0496118_0368994 | 3300048921 | Bacteria | 758 |
| 304 | Ga0496119_0033756 | 3300048922 | Bacteria | 3386 |
| 305 | Ga0496119_0047798 | 3300048922 | Bacteria | 2659 |
| 306 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 307 | Ga0496121_0056775 | 3300048924 | Bacteria | 3249 |
| 308 | Ga0496121_0059648 | 3300048924 | Bacteria | 3144 |
| 309 | Ga0496121_0487868 | 3300048924 | Bacteria | 785 |
| 310 | Ga0496122_0493527 | 3300048925 | Bacteria | 597 |
| 311 | Ga0496124_0251277 | 3300048927 | Bacteria | 1308 |
| 312 | Ga0496125_0070386 | 3300048928 | Bacteria | 2739 |
| 313 | Ga0496126_0132738 | 3300048929 | Bacteria | 2150 |
| 314 | Ga0501034_0072565 | 3300049571 | Bacteria | 3451 |
| 315 | Ga0501038_0008008 | 3300049574 | Bacteria | 9736 |
| 316 | Ga0501249_001010 | 3300049679 | Bacteria | 6048 |
| 317 | Ga0501219_018980 | 3300049703 | Bacteria | 584 |
| 318 | nmdc:mga00v17_629406_c1 | 3300050491 | Bacteria | 691 |
| 319 | nmdc:mga0yw44_14162_c1 | 3300050492 | Bacteria | 4223 |
| 320 | nmdc:mga0yw44_952674_c1 | 3300050492 | Bacteria | 581 |
| 321 | nmdc:mga04h51_6268_c1 | 3300050495 | Bacteria | 3075 |
| 322 | nmdc:mga05p37_1301131_c1 | 3300050507 | Unclassified | 741 |
| 323 | nmdc:mga06r32_455485_c1 | 3300050510 | Bacteria | 1259 |
| 324 | nmdc:mga08y16_687703_c1 | 3300050511 | Bacteria | 1024 |
| 325 | nmdc:mga0sz30_281573_c1 | 3300050516 | Bacteria | 741 |
| 326 | nmdc:mga0sz30_95437_c1 | 3300050516 | Bacteria | 1297 |
| 327 | Ga0500578_0112634 | 3300053086 | Bacteria | 1714 |
| 328 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 329 | Ga0500644_0512244 | 3300053088 | Bacteria | 528 |
| 330 | Ga0500646_0053069 | 3300053090 | Bacteria | 1175 |
| 331 | Ga0500647_0276402 | 3300053091 | Bacteria | 727 |
| 332 | Ga0500647_0309701 | 3300053091 | Bacteria | 672 |
| 333 | Ga0500583_0227630 | 3300053092 | Bacteria | 923 |
| 334 | Ga0500651_0166756 | 3300053093 | Bacteria | 1315 |
| 335 | Ga0500566_0000082 | 3300053094 | Bacteria | 47150 |
| 336 | Ga0500640_061099 | 3300053095 | Bacteria | 1633 |
| 337 | Ga0500650_0175755 | 3300053098 | Bacteria | 983 |
| 338 | Ga0500555_004293 | 3300053103 | Bacteria | 4055 |
| 339 | Ga0500556_0011101 | 3300053104 | Bacteria | 2660 |
| 340 | Ga0500557_000015 | 3300053105 | Bacteria | 106282 |
| 341 | Ga0500562_032755 | 3300053108 | Bacteria | 1372 |
| 342 | Ga0500569_036834 | 3300053109 | Bacteria | 1410 |
| 343 | Ga0500592_008233 | 3300053116 | Bacteria | 1654 |
| 344 | Ga0500594_0232062 | 3300053118 | Bacteria | 611 |
| 345 | Ga0500607_073965 | 3300053121 | Bacteria | 1752 |
| 346 | Ga0500642_0006650 | 3300053130 | Bacteria | 3824 |
| 347 | Ga0500655_051196 | 3300053133 | Bacteria | 823 |
| 348 | Ga0500655_107526 | 3300053133 | Bacteria | 587 |
| 349 | Ga0500559_0042017 | 3300053136 | Bacteria | 1993 |
| 350 | Ga0500568_0021270 | 3300053139 | Bacteria | 2793 |
| 351 | Ga0500577_0044024 | 3300053142 | Bacteria | 1643 |
| 352 | Ga0500585_062506 | 3300053144 | Bacteria | 1341 |
| 353 | Ga0500588_0040153 | 3300053146 | Bacteria | 1405 |
| 354 | Ga0500588_0168043 | 3300053146 | Bacteria | 801 |
| 355 | Ga0500589_160056 | 3300053147 | Bacteria | 906 |
| 356 | Ga0500604_0131197 | 3300053151 | Bacteria | 843 |
| 357 | Ga0500604_0197665 | 3300053151 | Bacteria | 691 |
| 358 | Ga0500616_0092727 | 3300053153 | Bacteria | 1492 |
| 359 | Ga0500619_066977 | 3300053154 | Bacteria | 1189 |
| 360 | Ga0500624_024237 | 3300053157 | Bacteria | 1001 |
| 361 | Ga0500627_0191922 | 3300053158 | Bacteria | 917 |
| 362 | Ga0500639_057275 | 3300053163 | Bacteria | 2016 |
| 363 | Ga0500636_0381057 | 3300053177 | Bacteria | 661 |
| 364 | Ga0500645_023897 | 3300053730 | Bacteria | 1872 |
| 365 | Ga0500645_195972 | 3300053730 | Bacteria | 546 |
| 366 | Ga0500601_043370 | 3300053737 | Bacteria | 550 |
| 367 | Ga0500661_010451 | 3300055283 | Bacteria | 1691 |
| 368 | Ga0466962_0656068 | 3300061719 | Bacteria | 537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019638758 | 8019645276 | 129 |
| 2 | 3300026142 | Ga0207698_10337872 | Ga0207698_103378721 | 134 |
| 3 | iso_pu_bacteria | 2842038055 | 2842039063 | 136 |
| 4 | iso_pu_bacteria | 2842045827 | 2842047990 | 136 |
| 5 | 3300005445 | Ga0070708_100098743 | Ga0070708_1000987432 | 137 |
| 6 | 3300005471 | Ga0070698_100125232 | Ga0070698_1001252323 | 137 |
| 7 | 3300005545 | Ga0070695_100064803 | Ga0070695_1000648032 | 137 |
| 8 | 3300005546 | Ga0070696_100354829 | Ga0070696_1003548292 | 137 |
| 9 | 3300005336 | Ga0070680_100236039 | Ga0070680_1002360393 | 138 |
| 10 | 3300005336 | Ga0070680_100508089 | Ga0070680_1005080892 | 138 |
| 11 | 3300005434 | Ga0070709_10001247 | Ga0070709_100012475 | 138 |
| 12 | 3300005436 | Ga0070713_100000233 | Ga0070713_10000023322 | 138 |
| 13 | 3300005436 | Ga0070713_100104750 | Ga0070713_1001047502 | 138 |
| 14 | 3300005458 | Ga0070681_10055383 | Ga0070681_100553834 | 138 |
| 15 | 3300005530 | Ga0070679_100244072 | Ga0070679_1002440722 | 138 |
| 16 | 3300005577 | Ga0068857_100786323 | Ga0068857_1007863232 | 138 |
| 17 | 3300005614 | Ga0068856_100026975 | Ga0068856_1000269755 | 138 |
| 18 | 3300005616 | Ga0068852_100604323 | Ga0068852_1006043233 | 138 |
| 19 | 3300006163 | Ga0070715_10246376 | Ga0070715_102463762 | 138 |
| 20 | 3300006173 | Ga0070716_100000644 | Ga0070716_1000006445 | 138 |
| 21 | 3300006175 | Ga0070712_100000024 | Ga0070712_1000000246 | 138 |
| 22 | 3300006358 | Ga0068871_101363038 | Ga0068871_1013630381 | 138 |
| 23 | 3300006914 | Ga0075436_101008089 | Ga0075436_1010080891 | 138 |
| 24 | 3300009093 | Ga0105240_10022911 | Ga0105240_100229116 | 138 |
| 25 | 3300009174 | Ga0105241_10139225 | Ga0105241_101392252 | 138 |
| 26 | 3300013105 | Ga0157369_10361915 | Ga0157369_103619152 | 138 |
| 27 | 3300013105 | Ga0157369_10610258 | Ga0157369_106102582 | 138 |
| 28 | 3300013297 | Ga0157378_13315440 | Ga0157378_133154401 | 138 |
| 29 | 3300013307 | Ga0157372_10539685 | Ga0157372_105396851 | 138 |
| 30 | 3300013307 | Ga0157372_11831362 | Ga0157372_118313622 | 138 |
| 31 | 3300013308 | Ga0157375_10030275 | Ga0157375_100302753 | 138 |
| 32 | 3300014497 | Ga0182008_10300230 | Ga0182008_103002301 | 138 |
| 33 | 3300025906 | Ga0207699_10000729 | Ga0207699_100007295 | 138 |
| 34 | 3300025913 | Ga0207695_10073276 | Ga0207695_100732762 | 138 |
| 35 | 3300025914 | Ga0207671_11042516 | Ga0207671_110425162 | 138 |
| 36 | 3300025915 | Ga0207693_10000528 | Ga0207693_100005287 | 138 |
| 37 | 3300025917 | Ga0207660_10127087 | Ga0207660_101270872 | 138 |
| 38 | 3300025917 | Ga0207660_10495489 | Ga0207660_104954893 | 138 |
| 39 | 3300025921 | Ga0207652_10458614 | Ga0207652_104586142 | 138 |
| 40 | 3300025928 | Ga0207700_10003329 | Ga0207700_100033297 | 138 |
| 41 | 3300025928 | Ga0207700_10853972 | Ga0207700_108539722 | 138 |
| 42 | 3300025928 | Ga0207700_10938869 | Ga0207700_109388692 | 138 |
| 43 | 3300025939 | Ga0207665_10014123 | Ga0207665_100141233 | 138 |
| 44 | 3300026078 | Ga0207702_10000993 | Ga0207702_1000099311 | 138 |
| 45 | 3300026116 | Ga0207674_10511119 | Ga0207674_105111192 | 138 |
| 46 | iso_pu_bacteria | 2511231028 | 2511401276 | 138 |
| 47 | iso_pu_bacteria | 2513237094 | 2513638973 | 138 |
| 48 | iso_pu_bacteria | 2513237095 | 2513645835 | 138 |
| 49 | iso_pu_bacteria | 2528768022 | 2528856088 | 138 |
| 50 | iso_pu_bacteria | 2617270741 | 2617375776 | 138 |
| 51 | iso_pu_bacteria | 2816332527 | 2818238881 | 138 |
| 52 | iso_pu_bacteria | 2824600985 | 2824605749 | 138 |
| 53 | iso_pu_bacteria | 2824609381 | 2824614454 | 138 |
| 54 | iso_pu_bacteria | 2824653114 | 2824657745 | 138 |
| 55 | iso_pu_bacteria | 2824661429 | 2824667129 | 138 |
| 56 | iso_pu_bacteria | 2824753945 | 2824758200 | 138 |
| 57 | iso_pu_bacteria | 2824763712 | 2824768181 | 138 |
| 58 | iso_pu_bacteria | 2839989709 | 2839992680 | 138 |
| 59 | iso_pu_bacteria | 2847930680 | 2847936212 | 138 |
| 60 | iso_pu_bacteria | 2849076700 | 2849079307 | 138 |
| 61 | iso_pu_bacteria | 2857509624 | 2857514308 | 138 |
| 62 | iso_pu_bacteria | 2874612657 | 2874615411 | 138 |
| 63 | iso_pu_bacteria | 2874620515 | 2874627825 | 138 |
| 64 | iso_pu_bacteria | 2874628541 | 2874631860 | 138 |
| 65 | iso_pu_bacteria | 2879083081 | 2879083708 | 138 |
| 66 | iso_pu_bacteria | 2885366525 | 2885373161 | 138 |
| 67 | iso_pu_bacteria | 2885409591 | 2885410436 | 138 |
| 68 | iso_pu_bacteria | 2888378607 | 2888384070 | 138 |
| 69 | iso_pu_bacteria | 2888388044 | 2888393791 | 138 |
| 70 | iso_pu_bacteria | 2888419890 | 2888424531 | 138 |
| 71 | iso_pu_bacteria | 2904666416 | 2904672855 | 138 |
| 72 | iso_pu_bacteria | 2906643746 | 2906651450 | 138 |
| 73 | iso_pu_bacteria | 2908775508 | 2908780168 | 138 |
| 74 | iso_pu_bacteria | 2932784394 | 2932790358 | 138 |
| 75 | iso_pu_bacteria | 2932828146 | 2932829991 | 138 |
| 76 | iso_pu_bacteria | 2935616580 | 2935623055 | 138 |
| 77 | iso_pu_bacteria | 2935638405 | 2935642419 | 138 |
| 78 | iso_pu_bacteria | 2935665750 | 2935668278 | 138 |
| 79 | iso_pu_bacteria | 2935675223 | 2935676309 | 138 |
| 80 | iso_pu_bacteria | 2935684952 | 2935686386 | 138 |
| 81 | iso_pu_bacteria | 2935694250 | 2935701081 | 138 |
| 82 | iso_pu_bacteria | 2935703347 | 2935706138 | 138 |
| 83 | iso_pu_bacteria | 2935713505 | 2935722279 | 138 |
| 84 | iso_pu_bacteria | 2935722832 | 2935731692 | 138 |
| 85 | iso_pu_bacteria | 2935732158 | 2935732174 | 138 |
| 86 | iso_pu_bacteria | 2935741537 | 2935741553 | 138 |
| 87 | iso_pu_bacteria | 2935750917 | 2935752351 | 138 |
| 88 | iso_pu_bacteria | 2935769743 | 2935773300 | 138 |
| 89 | iso_pu_bacteria | 2935785616 | 2935792746 | 138 |
| 90 | iso_pu_bacteria | 2935793552 | 2935800773 | 138 |
| 91 | iso_pu_bacteria | 2935801545 | 2935803137 | 138 |
| 92 | iso_pu_bacteria | 2935810662 | 2935814453 | 138 |
| 93 | iso_pu_bacteria | 2935819856 | 2935822048 | 138 |
| 94 | iso_pu_bacteria | 2935827899 | 2935831591 | 138 |
| 95 | iso_pu_bacteria | 2935837841 | 2935838451 | 138 |
| 96 | iso_pu_bacteria | 2935847175 | 2935847630 | 138 |
| 97 | iso_pu_bacteria | 2935855204 | 2935861303 | 138 |
| 98 | iso_pu_bacteria | 2935864058 | 2935865841 | 138 |
| 99 | iso_pu_bacteria | 2935873716 | 2935878342 | 138 |
| 100 | iso_pu_bacteria | 2935959822 | 2935965841 | 138 |
| 101 | iso_pu_bacteria | 2935975950 | 2935982668 | 138 |
| 102 | iso_pu_bacteria | 2935992306 | 2935994655 | 138 |
| 103 | iso_pu_bacteria | 2936002035 | 2936007482 | 138 |
| 104 | iso_pu_bacteria | 2936037263 | 2936040010 | 138 |
| 105 | iso_pu_bacteria | 2940556831 | 2940556847 | 138 |
| 106 | iso_pu_bacteria | 2941538514 | 2941538881 | 138 |
| 107 | iso_pu_bacteria | 3005587118 | 3005592648 | 138 |
| 108 | iso_pu_bacteria | 3005710791 | 3005714915 | 138 |
| 109 | iso_pu_bacteria | 3005718088 | 3005722329 | 138 |
| 110 | iso_pu_bacteria | 8016511872 | 8016522328 | 138 |
| 111 | iso_pu_bacteria | 8016522445 | 8016529609 | 138 |
| 112 | iso_pu_bacteria | 8016530956 | 8016534826 | 138 |
| 113 | iso_pu_bacteria | 8016548790 | 8016554090 | 138 |
| 114 | iso_pu_bacteria | 8016557553 | 8016562465 | 138 |
| 115 | iso_pu_bacteria | 8016566248 | 8016573174 | 138 |
| 116 | iso_pu_bacteria | 8016575299 | 8016577316 | 138 |
| 117 | iso_pu_bacteria | 8016595262 | 8016600260 | 138 |
| 118 | iso_pu_bacteria | 8016622563 | 8016626551 | 138 |
| 119 | iso_pu_bacteria | 8017057580 | 8017063231 | 138 |
| 120 | iso_pu_bacteria | 8019530166 | 8019534590 | 138 |
| 121 | iso_pu_bacteria | 8019547302 | 8019553652 | 138 |
| 122 | iso_pu_bacteria | 8019576017 | 8019582658 | 138 |
| 123 | iso_pu_bacteria | 8019586578 | 8019590449 | 138 |
| 124 | iso_pu_bacteria | 8019597564 | 8019600904 | 138 |
| 125 | iso_pu_bacteria | 8019608314 | 8019617647 | 138 |
| 126 | iso_pu_bacteria | 8019659431 | 8019662345 | 138 |
| 127 | iso_pu_bacteria | 8019668869 | 8019671846 | 138 |
| 128 | iso_pu_bacteria | 8056967851 | 8056968046 | 138 |
| 129 | 3300005353 | Ga0070669_100107030 | Ga0070669_1001070302 | 139 |
| 130 | 3300005543 | Ga0070672_100719060 | Ga0070672_1007190602 | 139 |
| 131 | 3300014326 | Ga0157380_10526523 | Ga0157380_105265232 | 139 |
| 132 | 3300025972 | Ga0207668_10351426 | Ga0207668_103514262 | 139 |
| 133 | 3300028800 | Ga0265338_10013374 | Ga0265338_100133743 | 139 |
| 134 | 3300031241 | Ga0265325_10000451 | Ga0265325_1000045123 | 139 |
| 135 | 3300031249 | Ga0265339_10004264 | Ga0265339_100042643 | 139 |
| 136 | 3300031344 | Ga0265316_10030700 | Ga0265316_100307003 | 139 |
| 137 | 3300031595 | Ga0265313_10001684 | Ga0265313_1000168418 | 139 |
| 138 | 3300032002 | Ga0307416_101012301 | Ga0307416_1010123012 | 139 |
| 139 | 3300037466 | Ga0395898_0378588 | Ga0395898_0378588_271_696 | 139 |
| 140 | 3300044684 | Ga0466966_0016700 | Ga0466966_0016700_2186_2617 | 139 |
| 141 | 3300044765 | Ga0466970_0022116 | Ga0466970_0022116_487_918 | 139 |
| 142 | 3300045049 | Ga0466959_0300790 | Ga0466959_0300790_538_969 | 139 |
| 143 | 3300048915 | Ga0496112_0153753 | Ga0496112_0153753_1091_1513 | 139 |
| 144 | 3300044683 | Ga0466965_0077284 | Ga0466965_0077284_289_717 | 140 |
| 145 | 3300044693 | Ga0466961_0210727 | Ga0466961_0210727_187_615 | 140 |
| 146 | 3300044735 | Ga0466968_0136335 | Ga0466968_0136335_371_799 | 140 |
| 147 | 3300045836 | Ga0466958_0073290 | Ga0466958_0073290_372_800 | 140 |
| 148 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_41643_42080 | 140 |
| 149 | 3300005467 | Ga0070706_100737207 | Ga0070706_1007372071 | 141 |
| 150 | 3300005985 | Ga0081539_10010966 | Ga0081539_100109663 | 141 |
| 151 | 3300006237 | Ga0097621_100963230 | Ga0097621_1009632302 | 141 |
| 152 | 3300006847 | Ga0075431_100481949 | Ga0075431_1004819492 | 141 |
| 153 | 3300014968 | Ga0157379_10244318 | Ga0157379_102443181 | 141 |
| 154 | 3300025922 | Ga0207646_10523410 | Ga0207646_105234101 | 141 |
| 155 | 3300025986 | Ga0207658_10102595 | Ga0207658_101025953 | 141 |
| 156 | 3300026035 | Ga0207703_10271230 | Ga0207703_102712302 | 141 |
| 157 | 3300044842 | Ga0466957_0553222 | Ga0466957_0553222_106_558 | 141 |
| 158 | 3300046694 | Ga0495649_0000802 | Ga0495649_0000802_18362_18790 | 141 |
| 159 | 3300001989 | JGI24739J22299_10024675 | JGI24739J22299_100246753 | 142 |
| 160 | 3300001990 | JGI24737J22298_10147813 | JGI24737J22298_101478131 | 142 |
| 161 | 3300003215 | JGI25153J46596_10000531 | JGI25153J46596_1000053126 | 142 |
| 162 | 3300003215 | JGI25153J46596_10086934 | JGI25153J46596_100869341 | 142 |
| 163 | 3300004625 | Ga0055543_1003684 | Ga0055543_10036845 | 142 |
| 164 | 3300005262 | Ga0065165_1000780 | Ga0065165_10007809 | 142 |
| 165 | 3300005262 | Ga0065165_1000826 | Ga0065165_100082614 | 142 |
| 166 | 3300005262 | Ga0065165_1020047 | Ga0065165_10200472 | 142 |
| 167 | 3300005331 | Ga0070670_100053143 | Ga0070670_1000531432 | 142 |
| 168 | 3300005331 | Ga0070670_100448409 | Ga0070670_1004484093 | 142 |
| 169 | 3300005331 | Ga0070670_101782643 | Ga0070670_1017826431 | 142 |
| 170 | 3300005338 | Ga0068868_100324211 | Ga0068868_1003242112 | 142 |
| 171 | 3300005345 | Ga0070692_10836234 | Ga0070692_108362342 | 142 |
| 172 | 3300005347 | Ga0070668_100021775 | Ga0070668_1000217756 | 142 |
| 173 | 3300005347 | Ga0070668_100516004 | Ga0070668_1005160042 | 142 |
| 174 | 3300005353 | Ga0070669_100327154 | Ga0070669_1003271542 | 142 |
| 175 | 3300005354 | Ga0070675_100048053 | Ga0070675_1000480532 | 142 |
| 176 | 3300005354 | Ga0070675_100375683 | Ga0070675_1003756832 | 142 |
| 177 | 3300005355 | Ga0070671_100151444 | Ga0070671_1001514442 | 142 |
| 178 | 3300005364 | Ga0070673_100232193 | Ga0070673_1002321932 | 142 |
| 179 | 3300005367 | Ga0070667_100019257 | Ga0070667_1000192575 | 142 |
| 180 | 3300005367 | Ga0070667_100111188 | Ga0070667_1001111882 | 142 |
| 181 | 3300005441 | Ga0070700_100538139 | Ga0070700_1005381391 | 142 |
| 182 | 3300005455 | Ga0070663_100060896 | Ga0070663_1000608962 | 142 |
| 183 | 3300005455 | Ga0070663_100218721 | Ga0070663_1002187212 | 142 |
| 184 | 3300005455 | Ga0070663_101142470 | Ga0070663_1011424701 | 142 |
| 185 | 3300005459 | Ga0068867_100226107 | Ga0068867_1002261072 | 142 |
| 186 | 3300005459 | Ga0068867_100510395 | Ga0068867_1005103951 | 142 |
| 187 | 3300005539 | Ga0068853_101102358 | Ga0068853_1011023581 | 142 |
| 188 | 3300005539 | Ga0068853_101212525 | Ga0068853_1012125251 | 142 |
| 189 | 3300005543 | Ga0070672_100948002 | Ga0070672_1009480021 | 142 |
| 190 | 3300005544 | Ga0070686_100448910 | Ga0070686_1004489101 | 142 |
| 191 | 3300005548 | Ga0070665_100032656 | Ga0070665_1000326564 | 142 |
| 192 | 3300005548 | Ga0070665_100794606 | Ga0070665_1007946062 | 142 |
| 193 | 3300005563 | Ga0068855_100418488 | Ga0068855_1004184883 | 142 |
| 194 | 3300005563 | Ga0068855_100549860 | Ga0068855_1005498602 | 142 |
| 195 | 3300005564 | Ga0070664_100430547 | Ga0070664_1004305471 | 142 |
| 196 | 3300005564 | Ga0070664_100445397 | Ga0070664_1004453971 | 142 |
| 197 | 3300005577 | Ga0068857_100093990 | Ga0068857_1000939902 | 142 |
| 198 | 3300005577 | Ga0068857_100444951 | Ga0068857_1004449512 | 142 |
| 199 | 3300005578 | Ga0068854_100100778 | Ga0068854_1001007783 | 142 |
| 200 | 3300005614 | Ga0068856_100087920 | Ga0068856_1000879203 | 142 |
| 201 | 3300005616 | Ga0068852_101140165 | Ga0068852_1011401651 | 142 |
| 202 | 3300005617 | Ga0068859_100065505 | Ga0068859_1000655052 | 142 |
| 203 | 3300005617 | Ga0068859_100259497 | Ga0068859_1002594972 | 142 |
| 204 | 3300005618 | Ga0068864_100777004 | Ga0068864_1007770042 | 142 |
| 205 | 3300005841 | Ga0068863_100735157 | Ga0068863_1007351572 | 142 |
| 206 | 3300005842 | Ga0068858_100288122 | Ga0068858_1002881222 | 142 |
| 207 | 3300005843 | Ga0068860_100027100 | Ga0068860_1000271002 | 142 |
| 208 | 3300005983 | Ga0081540_1053755 | Ga0081540_10537552 | 142 |
| 209 | 3300006038 | Ga0075365_10225717 | Ga0075365_102257171 | 142 |
| 210 | 3300006042 | Ga0075368_10007965 | Ga0075368_100079653 | 142 |
| 211 | 3300006048 | Ga0075363_100039423 | Ga0075363_1000394232 | 142 |
| 212 | 3300006051 | Ga0075364_10106450 | Ga0075364_101064502 | 142 |
| 213 | 3300006178 | Ga0075367_10117086 | Ga0075367_101170862 | 142 |
| 214 | 3300006186 | Ga0075369_10130778 | Ga0075369_101307782 | 142 |
| 215 | 3300006195 | Ga0075366_10057401 | Ga0075366_100574011 | 142 |
| 216 | 3300006237 | Ga0097621_100525081 | Ga0097621_1005250812 | 142 |
| 217 | 3300006353 | Ga0075370_10199708 | Ga0075370_101997082 | 142 |
| 218 | 3300006844 | Ga0075428_102339997 | Ga0075428_1023399971 | 142 |
| 219 | 3300006847 | Ga0075431_100066871 | Ga0075431_1000668712 | 142 |
| 220 | 3300006881 | Ga0068865_100178100 | Ga0068865_1001781001 | 142 |
| 221 | 3300006931 | Ga0097620_100065506 | Ga0097620_1000655062 | 142 |
| 222 | 3300006931 | Ga0097620_100259492 | Ga0097620_1002594922 | 142 |
| 223 | 3300006942 | Ga0099824_1029046 | Ga0099824_10290463 | 142 |
| 224 | 3300006944 | Ga0099823_1016643 | Ga0099823_10166432 | 142 |
| 225 | 3300009098 | Ga0105245_10817684 | Ga0105245_108176841 | 142 |
| 226 | 3300009101 | Ga0105247_10154490 | Ga0105247_101544902 | 142 |
| 227 | 3300009147 | Ga0114129_11740026 | Ga0114129_117400261 | 142 |
| 228 | 3300009147 | Ga0114129_12583464 | Ga0114129_125834642 | 142 |
| 229 | 3300009148 | Ga0105243_10133082 | Ga0105243_101330822 | 142 |
| 230 | 3300009148 | Ga0105243_11294830 | Ga0105243_112948301 | 142 |
| 231 | 3300009176 | Ga0105242_11747466 | Ga0105242_117474661 | 142 |
| 232 | 3300009177 | Ga0105248_10102158 | Ga0105248_101021582 | 142 |
| 233 | 3300009545 | Ga0105237_10103257 | Ga0105237_101032572 | 142 |
| 234 | 3300009545 | Ga0105237_11271734 | Ga0105237_112717342 | 142 |
| 235 | 3300009545 | Ga0105237_11655442 | Ga0105237_116554421 | 142 |
| 236 | 3300009551 | Ga0105238_10529250 | Ga0105238_105292501 | 142 |
| 237 | 3300009551 | Ga0105238_10529790 | Ga0105238_105297902 | 142 |
| 238 | 3300009553 | Ga0105249_11533378 | Ga0105249_115333781 | 142 |
| 239 | 3300010375 | Ga0105239_10137660 | Ga0105239_101376602 | 142 |
| 240 | 3300010375 | Ga0105239_10408629 | Ga0105239_104086291 | 142 |
| 241 | 3300010375 | Ga0105239_10576323 | Ga0105239_105763232 | 142 |
| 242 | 3300011119 | Ga0105246_10103876 | Ga0105246_101038762 | 142 |
| 243 | 3300013297 | Ga0157378_10576289 | Ga0157378_105762891 | 142 |
| 244 | 3300013297 | Ga0157378_10743172 | Ga0157378_107431722 | 142 |
| 245 | 3300013306 | Ga0163162_11504809 | Ga0163162_115048091 | 142 |
| 246 | 3300013308 | Ga0157375_10524451 | Ga0157375_105244512 | 142 |
| 247 | 3300014325 | Ga0163163_10051180 | Ga0163163_100511804 | 142 |
| 248 | 3300014325 | Ga0163163_10080821 | Ga0163163_100808212 | 142 |
| 249 | 3300014968 | Ga0157379_10153320 | Ga0157379_101533202 | 142 |
| 250 | 3300014968 | Ga0157379_10345374 | Ga0157379_103453742 | 142 |
| 251 | 3300017792 | Ga0163161_10745314 | Ga0163161_107453141 | 142 |
| 252 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001791 | 142 |
| 253 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001857 | 142 |
| 254 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001338 | 142 |
| 255 | 3300025230 | Ga0209563_103040 | Ga0209563_1030402 | 142 |
| 256 | 3300025253 | Ga0209677_101583 | Ga0209677_1015834 | 142 |
| 257 | 3300025254 | Ga0209148_1000289 | Ga0209148_100028914 | 142 |
| 258 | 3300025261 | Ga0209233_1002174 | Ga0209233_10021744 | 142 |
| 259 | 3300025272 | Ga0209455_1000612 | Ga0209455_10006122 | 142 |
| 260 | 3300025297 | Ga0209758_1000160 | Ga0209758_100016049 | 142 |
| 261 | 3300025297 | Ga0209758_1041384 | Ga0209758_10413843 | 142 |
| 262 | 3300025297 | Ga0209758_1049219 | Ga0209758_10492192 | 142 |
| 263 | 3300025302 | Ga0207426_1003500 | Ga0207426_10035002 | 142 |
| 264 | 3300025302 | Ga0207426_1060622 | Ga0207426_10606222 | 142 |
| 265 | 3300025900 | Ga0207710_10048868 | Ga0207710_100488682 | 142 |
| 266 | 3300025904 | Ga0207647_10018357 | Ga0207647_100183572 | 142 |
| 267 | 3300025904 | Ga0207647_10219805 | Ga0207647_102198051 | 142 |
| 268 | 3300025911 | Ga0207654_10054765 | Ga0207654_100547652 | 142 |
| 269 | 3300025914 | Ga0207671_10019111 | Ga0207671_100191112 | 142 |
| 270 | 3300025919 | Ga0207657_10437850 | Ga0207657_104378502 | 142 |
| 271 | 3300025919 | Ga0207657_10456492 | Ga0207657_104564922 | 142 |
| 272 | 3300025923 | Ga0207681_10061687 | Ga0207681_100616872 | 142 |
| 273 | 3300025923 | Ga0207681_10295468 | Ga0207681_102954682 | 142 |
| 274 | 3300025924 | Ga0207694_10303452 | Ga0207694_103034522 | 142 |
| 275 | 3300025925 | Ga0207650_10151534 | Ga0207650_101515342 | 142 |
| 276 | 3300025925 | Ga0207650_10850043 | Ga0207650_108500432 | 142 |
| 277 | 3300025926 | Ga0207659_10049753 | Ga0207659_100497533 | 142 |
| 278 | 3300025926 | Ga0207659_10508734 | Ga0207659_105087342 | 142 |
| 279 | 3300025931 | Ga0207644_10292493 | Ga0207644_102924931 | 142 |
| 280 | 3300025934 | Ga0207686_10205145 | Ga0207686_102051451 | 142 |
| 281 | 3300025935 | Ga0207709_10072710 | Ga0207709_100727102 | 142 |
| 282 | 3300025938 | Ga0207704_10459984 | Ga0207704_104599841 | 142 |
| 283 | 3300025940 | Ga0207691_10825029 | Ga0207691_108250291 | 142 |
| 284 | 3300025941 | Ga0207711_10269869 | Ga0207711_102698692 | 142 |
| 285 | 3300025941 | Ga0207711_11537759 | Ga0207711_115377592 | 142 |
| 286 | 3300025942 | Ga0207689_10717360 | Ga0207689_107173601 | 142 |
| 287 | 3300025945 | Ga0207679_10028248 | Ga0207679_100282483 | 142 |
| 288 | 3300025949 | Ga0207667_10293982 | Ga0207667_102939823 | 142 |
| 289 | 3300025949 | Ga0207667_10713764 | Ga0207667_107137641 | 142 |
| 290 | 3300025960 | Ga0207651_10195949 | Ga0207651_101959492 | 142 |
| 291 | 3300025961 | Ga0207712_10081066 | Ga0207712_100810662 | 142 |
| 292 | 3300025981 | Ga0207640_10290500 | Ga0207640_102905001 | 142 |
| 293 | 3300025986 | Ga0207658_10059628 | Ga0207658_100596282 | 142 |
| 294 | 3300025986 | Ga0207658_10622904 | Ga0207658_106229042 | 142 |
| 295 | 3300026023 | Ga0207677_11574832 | Ga0207677_115748321 | 142 |
| 296 | 3300026035 | Ga0207703_10576725 | Ga0207703_105767252 | 142 |
| 297 | 3300026035 | Ga0207703_11467579 | Ga0207703_114675791 | 142 |
| 298 | 3300026041 | Ga0207639_11228906 | Ga0207639_112289062 | 142 |
| 299 | 3300026067 | Ga0207678_10087280 | Ga0207678_100872802 | 142 |
| 300 | 3300026067 | Ga0207678_10251468 | Ga0207678_102514682 | 142 |
| 301 | 3300026078 | Ga0207702_10021105 | Ga0207702_100211054 | 142 |
| 302 | 3300026078 | Ga0207702_10533736 | Ga0207702_105337362 | 142 |
| 303 | 3300026089 | Ga0207648_10538873 | Ga0207648_105388731 | 142 |
| 304 | 3300026116 | Ga0207674_10114495 | Ga0207674_101144952 | 142 |
| 305 | 3300026116 | Ga0207674_10581150 | Ga0207674_105811502 | 142 |
| 306 | 3300026121 | Ga0207683_10130326 | Ga0207683_101303263 | 142 |
| 307 | 3300027296 | Ga0209389_1000008 | Ga0209389_1000008132 | 142 |
| 308 | 3300027361 | Ga0209489_103917 | Ga0209489_10391718 | 142 |
| 309 | 3300027363 | Ga0209700_100036 | Ga0209700_10003618 | 142 |
| 310 | 3300027866 | Ga0209813_10062209 | Ga0209813_100622092 | 142 |
| 311 | 3300028379 | Ga0268266_10144787 | Ga0268266_101447872 | 142 |
| 312 | 3300028379 | Ga0268266_10214744 | Ga0268266_102147442 | 142 |
| 313 | 3300028381 | Ga0268264_10022569 | Ga0268264_100225697 | 142 |
| 314 | 3300031548 | Ga0307408_100249104 | Ga0307408_1002491041 | 142 |
| 315 | 3300031691 | Ga0316579_10006447 | Ga0316579_100064472 | 142 |
| 316 | 3300031711 | Ga0265314_10003943 | Ga0265314_1000394310 | 142 |
| 317 | 3300031728 | Ga0316578_10019617 | Ga0316578_100196176 | 142 |
| 318 | 3300033180 | Ga0307510_10007884 | Ga0307510_1000788413 | 142 |
| 319 | 3300035398 | Ga0316574_0409911 | Ga0316574_0409911_115_567 | 142 |
| 320 | 3300035398 | Ga0316574_0667428 | Ga0316574_0667428_56_562 | 142 |
| 321 | 3300035724 | Ga0373933_0897960 | Ga0373933_0897960_44_508 | 142 |
| 322 | 3300037418 | Ga0395900_0001114 | Ga0395900_0001114_9529_9969 | 142 |
| 323 | 3300037418 | Ga0395900_0156313 | Ga0395900_0156313_20_457 | 142 |
| 324 | 3300037418 | Ga0395900_0395246 | Ga0395900_0395246_869_1306 | 142 |
| 325 | 3300037466 | Ga0395898_0008436 | Ga0395898_0008436_5906_6346 | 142 |
| 326 | 3300037471 | Ga0395905_0044671 | Ga0395905_0044671_887_1324 | 142 |
| 327 | 3300037471 | Ga0395905_0238134 | Ga0395905_0238134_965_1405 | 142 |
| 328 | 3300037588 | Ga0316581_0033206 | Ga0316581_0033206_618_1124 | 142 |
| 329 | 3300037853 | Ga0436364_1295084 | Ga0436364_1295084_481_918 | 142 |
| 330 | 3300038443 | Ga0395901_0071243 | Ga0395901_0071243_1580_2020 | 142 |
| 331 | 3300038443 | Ga0395901_0760654 | Ga0395901_0760654_125_562 | 142 |
| 332 | 3300039447 | Ga0436361_1084244 | Ga0436361_1084244_53_526 | 142 |
| 333 | 3300044656 | Ga0466969_0152761 | Ga0466969_0152761_59_499 | 142 |
| 334 | 3300044658 | Ga0466972_0000142 | Ga0466972_0000142_7849_8286 | 142 |
| 335 | 3300044658 | Ga0466972_0219489 | Ga0466972_0219489_371_811 | 142 |
| 336 | 3300044683 | Ga0466965_0065069 | Ga0466965_0065069_261_698 | 142 |
| 337 | 3300044683 | Ga0466965_0305537 | Ga0466965_0305537_396_827 | 142 |
| 338 | 3300044684 | Ga0466966_0064757 | Ga0466966_0064757_841_1302 | 142 |
| 339 | 3300044735 | Ga0466968_0005776 | Ga0466968_0005776_510_950 | 142 |
| 340 | 3300044765 | Ga0466970_0059184 | Ga0466970_0059184_145_582 | 142 |
| 341 | 3300044901 | Ga0466960_0031341 | Ga0466960_0031341_28_468 | 142 |
| 342 | 3300044901 | Ga0466960_0543422 | Ga0466960_0543422_16_453 | 142 |
| 343 | 3300046455 | Ga0495603_0426001 | Ga0495603_0426001_35_475 | 142 |
| 344 | 3300046460 | Ga0495638_0000398 | Ga0495638_0000398_8551_8991 | 142 |
| 345 | 3300046474 | Ga0495605_0233551 | Ga0495605_0233551_31_468 | 142 |
| 346 | 3300046506 | Ga0495583_0122799 | Ga0495583_0122799_429_869 | 142 |
| 347 | 3300046507 | Ga0495606_0126837 | Ga0495606_0126837_974_1411 | 142 |
| 348 | 3300046512 | Ga0495610_0036754 | Ga0495610_0036754_2037_2474 | 142 |
| 349 | 3300046519 | Ga0495632_0108434 | Ga0495632_0108434_384_821 | 142 |
| 350 | 3300046522 | Ga0495643_0054782 | Ga0495643_0054782_181_618 | 142 |
| 351 | 3300046522 | Ga0495643_0079759 | Ga0495643_0079759_187_627 | 142 |
| 352 | 3300046524 | Ga0495648_0213841 | Ga0495648_0213841_87_527 | 142 |
| 353 | 3300046524 | Ga0495648_0243905 | Ga0495648_0243905_272_712 | 142 |
| 354 | 3300046542 | Ga0495597_0158803 | Ga0495597_0158803_226_666 | 142 |
| 355 | 3300046557 | Ga0495622_0270056 | Ga0495622_0270056_140_580 | 142 |
| 356 | 3300046616 | Ga0495668_0032962 | Ga0495668_0032962_1445_1882 | 142 |
| 357 | 3300046616 | Ga0495668_0592950 | Ga0495668_0592950_127_567 | 142 |
| 358 | 3300046648 | Ga0495611_0127568 | Ga0495611_0127568_114_554 | 142 |
| 359 | 3300046660 | Ga0495625_0243766 | Ga0495625_0243766_21_461 | 142 |
| 360 | 3300046660 | Ga0495625_0462246 | Ga0495625_0462246_227_664 | 142 |
| 361 | 3300046665 | Ga0495661_0252063 | Ga0495661_0252063_372_812 | 142 |
| 362 | 3300046665 | Ga0495661_0300726 | Ga0495661_0300726_114_554 | 142 |
| 363 | 3300046674 | Ga0495588_0264004 | Ga0495588_0264004_187_627 | 142 |
| 364 | 3300047323 | Ga0495683_0013708 | Ga0495683_0013708_2224_2661 | 142 |
| 365 | 3300047443 | Ga0495687_003920 | Ga0495687_003920_9600_10073 | 142 |
| 366 | 3300047443 | Ga0495687_076472 | Ga0495687_076472_858_1298 | 142 |
| 367 | 3300047469 | Ga0495673_0116035 | Ga0495673_0116035_592_1032 | 142 |
| 368 | 3300048903 | Ga0496100_0124002 | Ga0496100_0124002_437_877 | 142 |
| 369 | 3300048903 | Ga0496100_0482436 | Ga0496100_0482436_460_897 | 142 |
| 370 | 3300048904 | Ga0496101_0055608 | Ga0496101_0055608_1120_1560 | 142 |
| 371 | 3300048904 | Ga0496101_0568468 | Ga0496101_0568468_180_617 | 142 |
| 372 | 3300048906 | Ga0496103_0616495 | Ga0496103_0616495_48_488 | 142 |
| 373 | 3300048907 | Ga0496104_0149248 | Ga0496104_0149248_95_535 | 142 |
| 374 | 3300048908 | Ga0496105_0082518 | Ga0496105_0082518_1565_2005 | 142 |
| 375 | 3300048908 | Ga0496105_0176064 | Ga0496105_0176064_1219_1656 | 142 |
| 376 | 3300048911 | Ga0496108_0043991 | Ga0496108_0043991_2412_2849 | 142 |
| 377 | 3300048912 | Ga0496109_0049410 | Ga0496109_0049410_180_617 | 142 |
| 378 | 3300048912 | Ga0496109_1209096 | Ga0496109_1209096_141_581 | 142 |
| 379 | 3300048913 | Ga0496110_0147859 | Ga0496110_0147859_212_652 | 142 |
| 380 | 3300048915 | Ga0496112_0048748 | Ga0496112_0048748_508_945 | 142 |
| 381 | 3300048915 | Ga0496112_0409530 | Ga0496112_0409530_103_543 | 142 |
| 382 | 3300048916 | Ga0496113_0023123 | Ga0496113_0023123_1106_1543 | 142 |
| 383 | 3300048916 | Ga0496113_0710273 | Ga0496113_0710273_135_572 | 142 |
| 384 | 3300048917 | Ga0496114_0225581 | Ga0496114_0225581_373_813 | 142 |
| 385 | 3300048918 | Ga0496115_0262377 | Ga0496115_0262377_359_799 | 142 |
| 386 | 3300048918 | Ga0496115_0330296 | Ga0496115_0330296_464_901 | 142 |
| 387 | 3300048920 | Ga0496117_0140912 | Ga0496117_0140912_115_552 | 142 |
| 388 | 3300048921 | Ga0496118_0070532 | Ga0496118_0070532_874_1314 | 142 |
| 389 | 3300048921 | Ga0496118_0073567 | Ga0496118_0073567_960_1400 | 142 |
| 390 | 3300048921 | Ga0496118_0368994 | Ga0496118_0368994_253_690 | 142 |
| 391 | 3300048922 | Ga0496119_0033756 | Ga0496119_0033756_33_470 | 142 |
| 392 | 3300048922 | Ga0496119_0047798 | Ga0496119_0047798_918_1358 | 142 |
| 393 | 3300048924 | Ga0496121_0056775 | Ga0496121_0056775_1356_1796 | 142 |
| 394 | 3300048924 | Ga0496121_0059648 | Ga0496121_0059648_741_1178 | 142 |
| 395 | 3300048924 | Ga0496121_0487868 | Ga0496121_0487868_286_726 | 142 |
| 396 | 3300048925 | Ga0496122_0493527 | Ga0496122_0493527_18_455 | 142 |
| 397 | 3300048927 | Ga0496124_0251277 | Ga0496124_0251277_677_1114 | 142 |
| 398 | 3300048928 | Ga0496125_0070386 | Ga0496125_0070386_2241_2678 | 142 |
| 399 | 3300048929 | Ga0496126_0132738 | Ga0496126_0132738_1360_1797 | 142 |
| 400 | 3300049571 | Ga0501034_0072565 | Ga0501034_0072565_2260_2697 | 142 |
| 401 | 3300049574 | Ga0501038_0008008 | Ga0501038_0008008_3422_3880 | 142 |
| 402 | 3300049679 | Ga0501249_001010 | Ga0501249_001010_5075_5518 | 142 |
| 403 | 3300049703 | Ga0501219_018980 | Ga0501219_018980_26_469 | 142 |
| 404 | 3300050491 | nmdc:mga00v17_629406_c1 | nmdc:mga00v17_629406_c1_130_567 | 142 |
| 405 | 3300050492 | nmdc:mga0yw44_14162_c1 | nmdc:mga0yw44_14162_c1_2292_2729 | 142 |
| 406 | 3300050492 | nmdc:mga0yw44_952674_c1 | nmdc:mga0yw44_952674_c1_90_533 | 142 |
| 407 | 3300050495 | nmdc:mga04h51_6268_c1 | nmdc:mga04h51_6268_c1_423_860 | 142 |
| 408 | 3300050507 | nmdc:mga05p37_1301131_c1 | nmdc:mga05p37_1301131_c1_200_637 | 142 |
| 409 | 3300050510 | nmdc:mga06r32_455485_c1 | nmdc:mga06r32_455485_c1_687_1124 | 142 |
| 410 | 3300050511 | nmdc:mga08y16_687703_c1 | nmdc:mga08y16_687703_c1_467_943 | 142 |
| 411 | 3300050516 | nmdc:mga0sz30_281573_c1 | nmdc:mga0sz30_281573_c1_254_691 | 142 |
| 412 | 3300050516 | nmdc:mga0sz30_95437_c1 | nmdc:mga0sz30_95437_c1_373_810 | 142 |
| 413 | 3300053086 | Ga0500578_0112634 | Ga0500578_0112634_1164_1604 | 142 |
| 414 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_14942_15382 | 142 |
| 415 | 3300053088 | Ga0500644_0512244 | Ga0500644_0512244_34_474 | 142 |
| 416 | 3300053090 | Ga0500646_0053069 | Ga0500646_0053069_162_602 | 142 |
| 417 | 3300053091 | Ga0500647_0276402 | Ga0500647_0276402_76_516 | 142 |
| 418 | 3300053091 | Ga0500647_0309701 | Ga0500647_0309701_161_598 | 142 |
| 419 | 3300053092 | Ga0500583_0227630 | Ga0500583_0227630_125_565 | 142 |
| 420 | 3300053093 | Ga0500651_0166756 | Ga0500651_0166756_31_468 | 142 |
| 421 | 3300053094 | Ga0500566_0000082 | Ga0500566_0000082_10705_11142 | 142 |
| 422 | 3300053095 | Ga0500640_061099 | Ga0500640_061099_229_666 | 142 |
| 423 | 3300053098 | Ga0500650_0175755 | Ga0500650_0175755_530_967 | 142 |
| 424 | 3300053103 | Ga0500555_004293 | Ga0500555_004293_740_1180 | 142 |
| 425 | 3300053104 | Ga0500556_0011101 | Ga0500556_0011101_1103_1543 | 142 |
| 426 | 3300053105 | Ga0500557_000015 | Ga0500557_000015_3327_3767 | 142 |
| 427 | 3300053108 | Ga0500562_032755 | Ga0500562_032755_435_875 | 142 |
| 428 | 3300053109 | Ga0500569_036834 | Ga0500569_036834_728_1165 | 142 |
| 429 | 3300053116 | Ga0500592_008233 | Ga0500592_008233_40_480 | 142 |
| 430 | 3300053118 | Ga0500594_0232062 | Ga0500594_0232062_78_518 | 142 |
| 431 | 3300053121 | Ga0500607_073965 | Ga0500607_073965_119_556 | 142 |
| 432 | 3300053130 | Ga0500642_0006650 | Ga0500642_0006650_1209_1649 | 142 |
| 433 | 3300053133 | Ga0500655_051196 | Ga0500655_051196_104_541 | 142 |
| 434 | 3300053133 | Ga0500655_107526 | Ga0500655_107526_64_504 | 142 |
| 435 | 3300053136 | Ga0500559_0042017 | Ga0500559_0042017_1341_1778 | 142 |
| 436 | 3300053139 | Ga0500568_0021270 | Ga0500568_0021270_1530_1970 | 142 |
| 437 | 3300053142 | Ga0500577_0044024 | Ga0500577_0044024_1062_1502 | 142 |
| 438 | 3300053144 | Ga0500585_062506 | Ga0500585_062506_471_908 | 142 |
| 439 | 3300053146 | Ga0500588_0040153 | Ga0500588_0040153_669_1106 | 142 |
| 440 | 3300053146 | Ga0500588_0168043 | Ga0500588_0168043_127_567 | 142 |
| 441 | 3300053147 | Ga0500589_160056 | Ga0500589_160056_379_819 | 142 |
| 442 | 3300053151 | Ga0500604_0131197 | Ga0500604_0131197_309_749 | 142 |
| 443 | 3300053151 | Ga0500604_0197665 | Ga0500604_0197665_206_646 | 142 |
| 444 | 3300053153 | Ga0500616_0092727 | Ga0500616_0092727_750_1190 | 142 |
| 445 | 3300053154 | Ga0500619_066977 | Ga0500619_066977_37_474 | 142 |
| 446 | 3300053157 | Ga0500624_024237 | Ga0500624_024237_145_582 | 142 |
| 447 | 3300053158 | Ga0500627_0191922 | Ga0500627_0191922_270_710 | 142 |
| 448 | 3300053163 | Ga0500639_057275 | Ga0500639_057275_205_642 | 142 |
| 449 | 3300053177 | Ga0500636_0381057 | Ga0500636_0381057_206_646 | 142 |
| 450 | 3300053730 | Ga0500645_023897 | Ga0500645_023897_196_636 | 142 |
| 451 | 3300053730 | Ga0500645_195972 | Ga0500645_195972_20_460 | 142 |
| 452 | 3300053737 | Ga0500601_043370 | Ga0500601_043370_62_502 | 142 |
| 453 | 3300055283 | Ga0500661_010451 | Ga0500661_010451_579_1016 | 142 |
| 454 | 3300061719 | Ga0466962_0656068 | Ga0466962_0656068_40_471 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jek-assembly1.cif.gz_A | crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a | 0.9963 | 3 | 139 |
| 2jek-assembly1.cif.gz_A | crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a | 0.9681 | 3 | 139 |
| 7ep0-assembly1.cif.gz_A | crystal structure of zyg11b bound to gste degron | 0.4601 | 1 | 124 |
| 6ve7-assembly1.cif.gz_d | the inner junction complex of chlamydomonas reinhardtii doublet microtubule | 0.4412 | 33 | 128 |
| 5aff-assembly1.cif.gz_A | symportin 1 chaperones 5s rnp assembly during ribosome biogenesis by occupying an essential rrna binding site | 0.4298 | 6 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jekA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 | 0.9963 | 3 | 139 | 1.25.40.380 |
| 2jekA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 | 0.9681 | 3 | 139 | 1.25.40.380 |
| af_Q8VE52_114_320_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5858 | 6 | 125 | 1.25.10.10 |
| af_Q54B61_245_442_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5844 | 15 | 127 | 1.25.10.10 |
| af_A0A1D6I621_113_222_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.517 | 59 | 127 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3IZ37-F1-model_v4 | Uncharacterized protein | 1.005 | 51 | 141 |
|
| AF-A0A0S6UUP6-F1-model_v4 | Calpastatin | 1.003 | 1 | 141 |
|
| AF-A0A2S9GFW1-F1-model_v4 | DUF1810 domain-containing protein | 1.003 | 29 | 110 |
|
| AF-A0A7V7TXD8-F1-model_v4 | DUF1810 domain-containing protein | 1.002 | 1 | 139 |
|
| AF-A0A1H7GQQ3-F1-model_v4 | Calpastatin | 0.9999 | 6 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar