F447410

General Info

Members Datasets Scaffolds Average Seq Length
454 348 368 145

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10006447|Ga0316579_100064472
Length 168
Sequence MIAGATDRARPDYMSRAPTAGNPFDLNRFVEAQSGDYEQALRELRRGRKVGHWIWYILPQMRGLGMSSMSSRYGIGSLDEAKAYLAHPVLGPRLRECVEAVCTHKGMSAGQILGSLDAMKFRSCLTLFAEADGPDSAFARALGQFFDDQRDPKTLELLGRSSRGGGDA

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
5 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
6 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
7 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
8 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
9 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
10 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
11 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
12 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
13 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
14 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
15 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
16 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
17 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
18 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
19 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
20 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
21 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
22 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
23 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
24 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
25 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
26 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
27 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
28 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
29 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
30 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
31 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
32 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
33 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
34 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
35 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
36 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
37 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
38 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
39 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
40 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
41 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
42 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
43 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
44 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
45 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
46 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
47 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
48 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
49 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
50 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
51 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
52 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
53 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
54 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
55 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
56 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
57 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
58 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
59 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
60 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
61 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
62 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
63 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
64 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
65 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
66 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
67 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
68 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
130 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
155 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
156 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
284 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
301 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
302 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
303 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
304 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
305 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
306 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
307 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
308 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
309 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
316 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
317 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
321 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
322 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
323 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
327 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
330 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
331 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
332 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
333 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
334 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
335 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
336 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
337 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
338 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
339 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
340 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
341 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
342 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
343 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
344 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
345 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
346 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
347 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
348 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.06
Metatranscriptomes 0
Isolates 18.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.86
Nodule 15.64
Rhizoplane 4.41
Rhizosphere 55.73
Stem 0
Stem Tuber 0
Unclassified 8.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10024675 3300001989 Bacteria 2118
2 JGI24737J22298_10147813 3300001990 Bacteria 694
3 JGI25153J46596_10000531 3300003215 Bacteria 23973
4 JGI25153J46596_10086934 3300003215 Bacteria 765
5 Ga0055543_1003684 3300004625 Bacteria 4409
6 Ga0065165_1000780 3300005262 Bacteria 42673
7 Ga0065165_1000826 3300005262 Bacteria 40863
8 Ga0065165_1020047 3300005262 Bacteria 2368
9 Ga0070670_100053143 3300005331 Bacteria 3479
10 Ga0070670_100448409 3300005331 Bacteria 1143
11 Ga0070670_101782643 3300005331 Bacteria 567
12 Ga0070680_100236039 3300005336 Bacteria 1545
13 Ga0070680_100508089 3300005336 Bacteria 1031
14 Ga0068868_100324211 3300005338 Bacteria 1313
15 Ga0070692_10836234 3300005345 Bacteria 631
16 Ga0070668_100021775 3300005347 Bacteria 4843
17 Ga0070668_100516004 3300005347 Bacteria 1036
18 Ga0070669_100107030 3300005353 Bacteria 2118
19 Ga0070669_100327154 3300005353 Bacteria 1239
20 Ga0070675_100048053 3300005354 Bacteria 3498
21 Ga0070675_100375683 3300005354 Bacteria 1264
22 Ga0070671_100151444 3300005355 Bacteria 1959
23 Ga0070673_100232193 3300005364 Bacteria 1601
24 Ga0070667_100019257 3300005367 Bacteria 5662
25 Ga0070667_100111188 3300005367 Bacteria 2376
26 Ga0070709_10001247 3300005434 Bacteria 13912
27 Ga0070713_100000233 3300005436 Bacteria 36949
28 Ga0070713_100104750 3300005436 Bacteria 2456
29 Ga0070700_100538139 3300005441 Bacteria 905
30 Ga0070708_100098743 3300005445 Bacteria 2670
31 Ga0070663_100060896 3300005455 Bacteria 2717
32 Ga0070663_100218721 3300005455 Bacteria 1494
33 Ga0070663_101142470 3300005455 Bacteria 682
34 Ga0070681_10055383 3300005458 Bacteria 3948
35 Ga0068867_100226107 3300005459 Bacteria 1510
36 Ga0068867_100510395 3300005459 Bacteria 1035
37 Ga0070706_100737207 3300005467 Bacteria 913
38 Ga0070698_100125232 3300005471 Bacteria 2527
39 Ga0070679_100244072 3300005530 Bacteria 1753
40 Ga0068853_101102358 3300005539 Bacteria 765
41 Ga0068853_101212525 3300005539 Bacteria 729
42 Ga0070672_100719060 3300005543 Bacteria 875
43 Ga0070672_100948002 3300005543 Unclassified 761
44 Ga0070686_100448910 3300005544 Bacteria 991
45 Ga0070695_100064803 3300005545 Bacteria 2378
46 Ga0070696_100354829 3300005546 Bacteria 1136
47 Ga0070665_100032656 3300005548 Bacteria 5239
48 Ga0070665_100794606 3300005548 Bacteria 959
49 Ga0068855_100418488 3300005563 Bacteria 1466
50 Ga0068855_100549860 3300005563 Bacteria 1250
51 Ga0070664_100430547 3300005564 Bacteria 1209
52 Ga0070664_100445397 3300005564 Bacteria 1188
53 Ga0068857_100093990 3300005577 Bacteria 2685
54 Ga0068857_100444951 3300005577 Bacteria 1211
55 Ga0068857_100786323 3300005577 Bacteria 908
56 Ga0068854_100100778 3300005578 Bacteria 2165
57 Ga0068856_100026975 3300005614 Bacteria 5603
58 Ga0068856_100087920 3300005614 Bacteria 3090
59 Ga0068852_100604323 3300005616 Bacteria 1101
60 Ga0068852_101140165 3300005616 Bacteria 800
61 Ga0068859_100065505 3300005617 Bacteria 3667
62 Ga0068859_100259497 3300005617 Bacteria 1829
63 Ga0068864_100777004 3300005618 Bacteria 940
64 Ga0068863_100735157 3300005841 Bacteria 982
65 Ga0068858_100288122 3300005842 Bacteria 1565
66 Ga0068860_100027100 3300005843 Bacteria 5521
67 Ga0081540_1053755 3300005983 Bacteria 1972
68 Ga0081539_10010966 3300005985 Bacteria 7261
69 Ga0075365_10225717 3300006038 Bacteria 1314
70 Ga0075368_10007965 3300006042 Bacteria 3758
71 Ga0075363_100039423 3300006048 Bacteria 2486
72 Ga0075364_10106450 3300006051 Bacteria 1869
73 Ga0070715_10246376 3300006163 Bacteria 932
74 Ga0070716_100000644 3300006173 Bacteria 14828
75 Ga0070712_100000024 3300006175 Bacteria 78736
76 Ga0075367_10117086 3300006178 Bacteria 1640
77 Ga0075369_10130778 3300006186 Bacteria 1140
78 Ga0075366_10057401 3300006195 Bacteria 2314
79 Ga0097621_100525081 3300006237 Bacteria 1075
80 Ga0097621_100963230 3300006237 Unclassified 797
81 Ga0075370_10199708 3300006353 Bacteria 1179
82 Ga0068871_101363038 3300006358 Bacteria 668
83 Ga0075428_102339997 3300006844 Bacteria 549
84 Ga0075431_100066871 3300006847 Bacteria 3710
85 Ga0075431_100481949 3300006847 Bacteria 1233
86 Ga0068865_100178100 3300006881 Bacteria 1635
87 Ga0075436_101008089 3300006914 Bacteria 625
88 Ga0097620_100065506 3300006931 Bacteria 3667
89 Ga0097620_100259492 3300006931 Bacteria 1829
90 Ga0099824_1029046 3300006942 Bacteria 2413
91 Ga0099823_1016643 3300006944 Bacteria 7202
92 Ga0105240_10022911 3300009093 Bacteria 8273
93 Ga0105245_10817684 3300009098 Bacteria 970
94 Ga0105247_10154490 3300009101 Bacteria 1515
95 Ga0114129_11740026 3300009147 Unclassified 760
96 Ga0114129_12583464 3300009147 Bacteria 606
97 Ga0105243_10133082 3300009148 Bacteria 2112
98 Ga0105243_11294830 3300009148 Bacteria 746
99 Ga0105241_10139225 3300009174 Bacteria 1974
100 Ga0105242_11747466 3300009176 Bacteria 659
101 Ga0105248_10102158 3300009177 Bacteria 3231
102 Ga0105237_10103257 3300009545 Bacteria 2842
103 Ga0105237_11271734 3300009545 Bacteria 742
104 Ga0105237_11655442 3300009545 Bacteria 647
105 Ga0105238_10529250 3300009551 Bacteria 1182
106 Ga0105238_10529790 3300009551 Bacteria 1181
107 Ga0105249_11533378 3300009553 Bacteria 739
108 Ga0105239_10137660 3300010375 Bacteria 2718
109 Ga0105239_10408629 3300010375 Bacteria 1537
110 Ga0105239_10576323 3300010375 Bacteria 1283
111 Ga0105246_10103876 3300011119 Bacteria 2074
112 Ga0157369_10361915 3300013105 Bacteria 1506
113 Ga0157369_10610258 3300013105 Bacteria 1126
114 Ga0157378_10576289 3300013297 Bacteria 1134
115 Ga0157378_10743172 3300013297 Bacteria 1003
116 Ga0157378_13315440 3300013297 Bacteria 500
117 Ga0163162_11504809 3300013306 Bacteria 767
118 Ga0157372_10539685 3300013307 Bacteria 1360
119 Ga0157372_11831362 3300013307 Bacteria 698
120 Ga0157375_10030275 3300013308 Bacteria 5102
121 Ga0157375_10524451 3300013308 Bacteria 1347
122 Ga0163163_10051180 3300014325 Bacteria 4072
123 Ga0163163_10080821 3300014325 Bacteria 3251
124 Ga0157380_10526523 3300014326 Bacteria 1154
125 Ga0182008_10300230 3300014497 Bacteria 840
126 Ga0157379_10153320 3300014968 Bacteria 2078
127 Ga0157379_10244318 3300014968 Bacteria 1628
128 Ga0157379_10345374 3300014968 Bacteria 1362
129 Ga0163161_10745314 3300017792 Bacteria 819
130 Ga0214542_1000001 3300021321 Bacteria 1018696
131 Ga0214545_1000001 3300021324 Bacteria 1092817
132 Ga0214543_1000001 3300021327 Bacteria 776921
133 Ga0209563_103040 3300025230 Bacteria 3584
134 Ga0209677_101583 3300025253 Bacteria 9653
135 Ga0209148_1000289 3300025254 Bacteria 75390
136 Ga0209233_1002174 3300025261 Bacteria 7347
137 Ga0209455_1000612 3300025272 Bacteria 22684
138 Ga0209758_1000160 3300025297 Bacteria 154304
139 Ga0209758_1041384 3300025297 Bacteria 1723
140 Ga0209758_1049219 3300025297 Bacteria 1490
141 Ga0207426_1003500 3300025302 Bacteria 8458
142 Ga0207426_1060622 3300025302 Bacteria 1089
143 Ga0207710_10048868 3300025900 Bacteria 1894
144 Ga0207647_10018357 3300025904 Bacteria 4734
145 Ga0207647_10219805 3300025904 Bacteria 1095
146 Ga0207699_10000729 3300025906 Bacteria 15708
147 Ga0207654_10054765 3300025911 Bacteria 2306
148 Ga0207695_10073276 3300025913 Bacteria 3490
149 Ga0207671_10019111 3300025914 Bacteria 5248
150 Ga0207671_11042516 3300025914 Unclassified 644
151 Ga0207693_10000528 3300025915 Bacteria 34513
152 Ga0207660_10127087 3300025917 Bacteria 1937
153 Ga0207660_10495489 3300025917 Bacteria 991
154 Ga0207657_10437850 3300025919 Bacteria 1026
155 Ga0207657_10456492 3300025919 Bacteria 1002
156 Ga0207652_10458614 3300025921 Bacteria 1149
157 Ga0207646_10523410 3300025922 Archaea 1067
158 Ga0207681_10061687 3300025923 Bacteria 2579
159 Ga0207681_10295468 3300025923 Bacteria 1280
160 Ga0207694_10303452 3300025924 Bacteria 1315
161 Ga0207650_10151534 3300025925 Bacteria 1830
162 Ga0207650_10850043 3300025925 Bacteria 774
163 Ga0207659_10049753 3300025926 Bacteria 2974
164 Ga0207659_10508734 3300025926 Bacteria 1020
165 Ga0207700_10003329 3300025928 Bacteria 9322
166 Ga0207700_10853972 3300025928 Bacteria 814
167 Ga0207700_10938869 3300025928 Bacteria 774
168 Ga0207644_10292493 3300025931 Bacteria 1310
169 Ga0207686_10205145 3300025934 Bacteria 1414
170 Ga0207709_10072710 3300025935 Bacteria 2188
171 Ga0207704_10459984 3300025938 Bacteria 1017
172 Ga0207665_10014123 3300025939 Bacteria 5253
173 Ga0207691_10825029 3300025940 Unclassified 778
174 Ga0207711_10269869 3300025941 Bacteria 1565
175 Ga0207711_11537759 3300025941 Bacteria 608
176 Ga0207689_10717360 3300025942 Bacteria 843
177 Ga0207679_10028248 3300025945 Bacteria 3890
178 Ga0207667_10293982 3300025949 Bacteria 1659
179 Ga0207667_10713764 3300025949 Bacteria 1004
180 Ga0207651_10195949 3300025960 Bacteria 1615
181 Ga0207712_10081066 3300025961 Bacteria 2362
182 Ga0207668_10351426 3300025972 Bacteria 1233
183 Ga0207640_10290500 3300025981 Bacteria 1289
184 Ga0207658_10059628 3300025986 Bacteria 2844
185 Ga0207658_10102595 3300025986 Bacteria 2244
186 Ga0207658_10622904 3300025986 Bacteria 971
187 Ga0207677_11574832 3300026023 Bacteria 608
188 Ga0207703_10271230 3300026035 Bacteria 1537
189 Ga0207703_10576725 3300026035 Bacteria 1063
190 Ga0207703_11467579 3300026035 Bacteria 656
191 Ga0207639_11228906 3300026041 Bacteria 703
192 Ga0207678_10087280 3300026067 Bacteria 2666
193 Ga0207678_10251468 3300026067 Bacteria 1514
194 Ga0207702_10000993 3300026078 Bacteria 29058
195 Ga0207702_10021105 3300026078 Bacteria 5390
196 Ga0207702_10533736 3300026078 Bacteria 1146
197 Ga0207648_10538873 3300026089 Bacteria 1071
198 Ga0207674_10114495 3300026116 Bacteria 2669
199 Ga0207674_10511119 3300026116 Bacteria 1160
200 Ga0207674_10581150 3300026116 Bacteria 1082
201 Ga0207683_10130326 3300026121 Bacteria 2262
202 Ga0207698_10337872 3300026142 Bacteria 1417
203 Ga0209389_1000008 3300027296 Bacteria 227385
204 Ga0209489_103917 3300027361 Bacteria 28294
205 Ga0209700_100036 3300027363 Bacteria 187888
206 Ga0209813_10062209 3300027866 Bacteria 1194
207 Ga0268266_10144787 3300028379 Bacteria 2135
208 Ga0268266_10214744 3300028379 Bacteria 1766
209 Ga0268264_10022569 3300028381 Bacteria 5137
210 Ga0265338_10013374 3300028800 Bacteria 9272
211 Ga0265325_10000451 3300031241 Bacteria 29659
212 Ga0265339_10004264 3300031249 Bacteria 9781
213 Ga0265316_10030700 3300031344 Bacteria 4402
214 Ga0307408_100249104 3300031548 Bacteria 1464
215 Ga0265313_10001684 3300031595 Bacteria 20414
216 Ga0316579_10006447 3300031691 Bacteria 4790
217 Ga0265314_10003943 3300031711 Bacteria 14082
218 Ga0316578_10019617 3300031728 Bacteria 3726
219 Ga0307416_101012301 3300032002 Bacteria 934
220 Ga0307510_10007884 3300033180 Bacteria 12686
221 Ga0316574_0409911 3300035398 Unclassified 853
222 Ga0316574_0667428 3300035398 Unclassified 639
223 Ga0373933_0897960 3300035724 Unclassified 583
224 Ga0395900_0001114 3300037418 Bacteria 34044
225 Ga0395900_0156313 3300037418 Bacteria 2329
226 Ga0395900_0395246 3300037418 Bacteria 1348
227 Ga0395898_0008436 3300037466 Bacteria 10891
228 Ga0395898_0378588 3300037466 Bacteria 1350
229 Ga0395905_0044671 3300037471 Bacteria 4157
230 Ga0395905_0238134 3300037471 Bacteria 1701
231 Ga0316581_0033206 3300037588 Bacteria 1558
232 Ga0436364_1295084 3300037853 Bacteria 2009
233 Ga0395901_0071243 3300038443 Bacteria 3622
234 Ga0395901_0760654 3300038443 Bacteria 961
235 Ga0436361_1084244 3300039447 Bacteria 594
236 Ga0466969_0152761 3300044656 Bacteria 1063
237 Ga0466972_0000142 3300044658 Bacteria 58711
238 Ga0466972_0219489 3300044658 Bacteria 889
239 Ga0466965_0065069 3300044683 Bacteria 1826
240 Ga0466965_0077284 3300044683 Bacteria 1681
241 Ga0466965_0305537 3300044683 Bacteria 864
242 Ga0466966_0016700 3300044684 Bacteria 4849
243 Ga0466966_0064757 3300044684 Bacteria 2300
244 Ga0466961_0210727 3300044693 Bacteria 1199
245 Ga0466968_0005776 3300044735 Bacteria 4641
246 Ga0466968_0136335 3300044735 Bacteria 1120
247 Ga0466970_0022116 3300044765 Bacteria 3319
248 Ga0466970_0059184 3300044765 Bacteria 2052
249 Ga0466957_0553222 3300044842 Bacteria 802
250 Ga0466960_0031341 3300044901 Bacteria 2453
251 Ga0466960_0543422 3300044901 Bacteria 685
252 Ga0466959_0300790 3300045049 Bacteria 1099
253 Ga0466958_0073290 3300045836 Bacteria 2098
254 Ga0495603_0426001 3300046455 Bacteria 760
255 Ga0495638_0000398 3300046460 Bacteria 53469
256 Ga0495605_0233551 3300046474 Bacteria 791
257 Ga0495583_0122799 3300046506 Bacteria 1092
258 Ga0495606_0126837 3300046507 Bacteria 1521
259 Ga0495610_0036754 3300046512 Bacteria 2500
260 Ga0495632_0108434 3300046519 Bacteria 1305
261 Ga0495643_0054782 3300046522 Bacteria 2133
262 Ga0495643_0079759 3300046522 Bacteria 1706
263 Ga0495648_0213841 3300046524 Bacteria 956
264 Ga0495648_0243905 3300046524 Bacteria 871
265 Ga0495597_0158803 3300046542 Bacteria 924
266 Ga0495622_0270056 3300046557 Bacteria 745
267 Ga0495668_0032962 3300046616 Bacteria 2912
268 Ga0495668_0592950 3300046616 Bacteria 612
269 Ga0495611_0127568 3300046648 Bacteria 1187
270 Ga0495625_0243766 3300046660 Bacteria 1169
271 Ga0495625_0462246 3300046660 Bacteria 782
272 Ga0495661_0252063 3300046665 Bacteria 901
273 Ga0495661_0300726 3300046665 Bacteria 803
274 Ga0495588_0264004 3300046674 Bacteria 907
275 Ga0495649_0000802 3300046694 Bacteria 25323
276 Ga0495683_0013708 3300047323 Bacteria 4234
277 Ga0495687_003920 3300047443 Bacteria 10425
278 Ga0495687_076472 3300047443 Bacteria 1325
279 Ga0495673_0116035 3300047469 Bacteria 1065
280 Ga0496100_0124002 3300048903 Bacteria 1811
281 Ga0496100_0482436 3300048903 Bacteria 954
282 Ga0496101_0055608 3300048904 Bacteria 2859
283 Ga0496101_0568468 3300048904 Bacteria 896
284 Ga0496103_0616495 3300048906 Bacteria 691
285 Ga0496104_0149248 3300048907 Bacteria 2245
286 Ga0496105_0082518 3300048908 Bacteria 2655
287 Ga0496105_0176064 3300048908 Bacteria 1752
288 Ga0496108_0043991 3300048911 Bacteria 3729
289 Ga0496109_0049410 3300048912 Bacteria 3829
290 Ga0496109_1209096 3300048912 Unclassified 692
291 Ga0496110_0147859 3300048913 Bacteria 2126
292 Ga0496112_0048748 3300048915 Bacteria 4151
293 Ga0496112_0153753 3300048915 Bacteria 2268
294 Ga0496112_0409530 3300048915 Bacteria 1295
295 Ga0496113_0023123 3300048916 Bacteria 4405
296 Ga0496113_0710273 3300048916 Bacteria 802
297 Ga0496114_0225581 3300048917 Bacteria 1645
298 Ga0496115_0262377 3300048918 Bacteria 1420
299 Ga0496115_0330296 3300048918 Bacteria 1246
300 Ga0496117_0140912 3300048920 Bacteria 1444
301 Ga0496118_0070532 3300048921 Bacteria 2522
302 Ga0496118_0073567 3300048921 Bacteria 2447
303 Ga0496118_0368994 3300048921 Bacteria 758
304 Ga0496119_0033756 3300048922 Bacteria 3386
305 Ga0496119_0047798 3300048922 Bacteria 2659
306 Ga0496121_0000024 3300048924 Bacteria 462959
307 Ga0496121_0056775 3300048924 Bacteria 3249
308 Ga0496121_0059648 3300048924 Bacteria 3144
309 Ga0496121_0487868 3300048924 Bacteria 785
310 Ga0496122_0493527 3300048925 Bacteria 597
311 Ga0496124_0251277 3300048927 Bacteria 1308
312 Ga0496125_0070386 3300048928 Bacteria 2739
313 Ga0496126_0132738 3300048929 Bacteria 2150
314 Ga0501034_0072565 3300049571 Bacteria 3451
315 Ga0501038_0008008 3300049574 Bacteria 9736
316 Ga0501249_001010 3300049679 Bacteria 6048
317 Ga0501219_018980 3300049703 Bacteria 584
318 nmdc:mga00v17_629406_c1 3300050491 Bacteria 691
319 nmdc:mga0yw44_14162_c1 3300050492 Bacteria 4223
320 nmdc:mga0yw44_952674_c1 3300050492 Bacteria 581
321 nmdc:mga04h51_6268_c1 3300050495 Bacteria 3075
322 nmdc:mga05p37_1301131_c1 3300050507 Unclassified 741
323 nmdc:mga06r32_455485_c1 3300050510 Bacteria 1259
324 nmdc:mga08y16_687703_c1 3300050511 Bacteria 1024
325 nmdc:mga0sz30_281573_c1 3300050516 Bacteria 741
326 nmdc:mga0sz30_95437_c1 3300050516 Bacteria 1297
327 Ga0500578_0112634 3300053086 Bacteria 1714
328 Ga0500643_000015 3300053087 Bacteria 310312
329 Ga0500644_0512244 3300053088 Bacteria 528
330 Ga0500646_0053069 3300053090 Bacteria 1175
331 Ga0500647_0276402 3300053091 Bacteria 727
332 Ga0500647_0309701 3300053091 Bacteria 672
333 Ga0500583_0227630 3300053092 Bacteria 923
334 Ga0500651_0166756 3300053093 Bacteria 1315
335 Ga0500566_0000082 3300053094 Bacteria 47150
336 Ga0500640_061099 3300053095 Bacteria 1633
337 Ga0500650_0175755 3300053098 Bacteria 983
338 Ga0500555_004293 3300053103 Bacteria 4055
339 Ga0500556_0011101 3300053104 Bacteria 2660
340 Ga0500557_000015 3300053105 Bacteria 106282
341 Ga0500562_032755 3300053108 Bacteria 1372
342 Ga0500569_036834 3300053109 Bacteria 1410
343 Ga0500592_008233 3300053116 Bacteria 1654
344 Ga0500594_0232062 3300053118 Bacteria 611
345 Ga0500607_073965 3300053121 Bacteria 1752
346 Ga0500642_0006650 3300053130 Bacteria 3824
347 Ga0500655_051196 3300053133 Bacteria 823
348 Ga0500655_107526 3300053133 Bacteria 587
349 Ga0500559_0042017 3300053136 Bacteria 1993
350 Ga0500568_0021270 3300053139 Bacteria 2793
351 Ga0500577_0044024 3300053142 Bacteria 1643
352 Ga0500585_062506 3300053144 Bacteria 1341
353 Ga0500588_0040153 3300053146 Bacteria 1405
354 Ga0500588_0168043 3300053146 Bacteria 801
355 Ga0500589_160056 3300053147 Bacteria 906
356 Ga0500604_0131197 3300053151 Bacteria 843
357 Ga0500604_0197665 3300053151 Bacteria 691
358 Ga0500616_0092727 3300053153 Bacteria 1492
359 Ga0500619_066977 3300053154 Bacteria 1189
360 Ga0500624_024237 3300053157 Bacteria 1001
361 Ga0500627_0191922 3300053158 Bacteria 917
362 Ga0500639_057275 3300053163 Bacteria 2016
363 Ga0500636_0381057 3300053177 Bacteria 661
364 Ga0500645_023897 3300053730 Bacteria 1872
365 Ga0500645_195972 3300053730 Bacteria 546
366 Ga0500601_043370 3300053737 Bacteria 550
367 Ga0500661_010451 3300055283 Bacteria 1691
368 Ga0466962_0656068 3300061719 Bacteria 537

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019638758 8019645276 129
2 3300026142 Ga0207698_10337872 Ga0207698_103378721 134
3 iso_pu_bacteria 2842038055 2842039063 136
4 iso_pu_bacteria 2842045827 2842047990 136
5 3300005445 Ga0070708_100098743 Ga0070708_1000987432 137
6 3300005471 Ga0070698_100125232 Ga0070698_1001252323 137
7 3300005545 Ga0070695_100064803 Ga0070695_1000648032 137
8 3300005546 Ga0070696_100354829 Ga0070696_1003548292 137
9 3300005336 Ga0070680_100236039 Ga0070680_1002360393 138
10 3300005336 Ga0070680_100508089 Ga0070680_1005080892 138
11 3300005434 Ga0070709_10001247 Ga0070709_100012475 138
12 3300005436 Ga0070713_100000233 Ga0070713_10000023322 138
13 3300005436 Ga0070713_100104750 Ga0070713_1001047502 138
14 3300005458 Ga0070681_10055383 Ga0070681_100553834 138
15 3300005530 Ga0070679_100244072 Ga0070679_1002440722 138
16 3300005577 Ga0068857_100786323 Ga0068857_1007863232 138
17 3300005614 Ga0068856_100026975 Ga0068856_1000269755 138
18 3300005616 Ga0068852_100604323 Ga0068852_1006043233 138
19 3300006163 Ga0070715_10246376 Ga0070715_102463762 138
20 3300006173 Ga0070716_100000644 Ga0070716_1000006445 138
21 3300006175 Ga0070712_100000024 Ga0070712_1000000246 138
22 3300006358 Ga0068871_101363038 Ga0068871_1013630381 138
23 3300006914 Ga0075436_101008089 Ga0075436_1010080891 138
24 3300009093 Ga0105240_10022911 Ga0105240_100229116 138
25 3300009174 Ga0105241_10139225 Ga0105241_101392252 138
26 3300013105 Ga0157369_10361915 Ga0157369_103619152 138
27 3300013105 Ga0157369_10610258 Ga0157369_106102582 138
28 3300013297 Ga0157378_13315440 Ga0157378_133154401 138
29 3300013307 Ga0157372_10539685 Ga0157372_105396851 138
30 3300013307 Ga0157372_11831362 Ga0157372_118313622 138
31 3300013308 Ga0157375_10030275 Ga0157375_100302753 138
32 3300014497 Ga0182008_10300230 Ga0182008_103002301 138
33 3300025906 Ga0207699_10000729 Ga0207699_100007295 138
34 3300025913 Ga0207695_10073276 Ga0207695_100732762 138
35 3300025914 Ga0207671_11042516 Ga0207671_110425162 138
36 3300025915 Ga0207693_10000528 Ga0207693_100005287 138
37 3300025917 Ga0207660_10127087 Ga0207660_101270872 138
38 3300025917 Ga0207660_10495489 Ga0207660_104954893 138
39 3300025921 Ga0207652_10458614 Ga0207652_104586142 138
40 3300025928 Ga0207700_10003329 Ga0207700_100033297 138
41 3300025928 Ga0207700_10853972 Ga0207700_108539722 138
42 3300025928 Ga0207700_10938869 Ga0207700_109388692 138
43 3300025939 Ga0207665_10014123 Ga0207665_100141233 138
44 3300026078 Ga0207702_10000993 Ga0207702_1000099311 138
45 3300026116 Ga0207674_10511119 Ga0207674_105111192 138
46 iso_pu_bacteria 2511231028 2511401276 138
47 iso_pu_bacteria 2513237094 2513638973 138
48 iso_pu_bacteria 2513237095 2513645835 138
49 iso_pu_bacteria 2528768022 2528856088 138
50 iso_pu_bacteria 2617270741 2617375776 138
51 iso_pu_bacteria 2816332527 2818238881 138
52 iso_pu_bacteria 2824600985 2824605749 138
53 iso_pu_bacteria 2824609381 2824614454 138
54 iso_pu_bacteria 2824653114 2824657745 138
55 iso_pu_bacteria 2824661429 2824667129 138
56 iso_pu_bacteria 2824753945 2824758200 138
57 iso_pu_bacteria 2824763712 2824768181 138
58 iso_pu_bacteria 2839989709 2839992680 138
59 iso_pu_bacteria 2847930680 2847936212 138
60 iso_pu_bacteria 2849076700 2849079307 138
61 iso_pu_bacteria 2857509624 2857514308 138
62 iso_pu_bacteria 2874612657 2874615411 138
63 iso_pu_bacteria 2874620515 2874627825 138
64 iso_pu_bacteria 2874628541 2874631860 138
65 iso_pu_bacteria 2879083081 2879083708 138
66 iso_pu_bacteria 2885366525 2885373161 138
67 iso_pu_bacteria 2885409591 2885410436 138
68 iso_pu_bacteria 2888378607 2888384070 138
69 iso_pu_bacteria 2888388044 2888393791 138
70 iso_pu_bacteria 2888419890 2888424531 138
71 iso_pu_bacteria 2904666416 2904672855 138
72 iso_pu_bacteria 2906643746 2906651450 138
73 iso_pu_bacteria 2908775508 2908780168 138
74 iso_pu_bacteria 2932784394 2932790358 138
75 iso_pu_bacteria 2932828146 2932829991 138
76 iso_pu_bacteria 2935616580 2935623055 138
77 iso_pu_bacteria 2935638405 2935642419 138
78 iso_pu_bacteria 2935665750 2935668278 138
79 iso_pu_bacteria 2935675223 2935676309 138
80 iso_pu_bacteria 2935684952 2935686386 138
81 iso_pu_bacteria 2935694250 2935701081 138
82 iso_pu_bacteria 2935703347 2935706138 138
83 iso_pu_bacteria 2935713505 2935722279 138
84 iso_pu_bacteria 2935722832 2935731692 138
85 iso_pu_bacteria 2935732158 2935732174 138
86 iso_pu_bacteria 2935741537 2935741553 138
87 iso_pu_bacteria 2935750917 2935752351 138
88 iso_pu_bacteria 2935769743 2935773300 138
89 iso_pu_bacteria 2935785616 2935792746 138
90 iso_pu_bacteria 2935793552 2935800773 138
91 iso_pu_bacteria 2935801545 2935803137 138
92 iso_pu_bacteria 2935810662 2935814453 138
93 iso_pu_bacteria 2935819856 2935822048 138
94 iso_pu_bacteria 2935827899 2935831591 138
95 iso_pu_bacteria 2935837841 2935838451 138
96 iso_pu_bacteria 2935847175 2935847630 138
97 iso_pu_bacteria 2935855204 2935861303 138
98 iso_pu_bacteria 2935864058 2935865841 138
99 iso_pu_bacteria 2935873716 2935878342 138
100 iso_pu_bacteria 2935959822 2935965841 138
101 iso_pu_bacteria 2935975950 2935982668 138
102 iso_pu_bacteria 2935992306 2935994655 138
103 iso_pu_bacteria 2936002035 2936007482 138
104 iso_pu_bacteria 2936037263 2936040010 138
105 iso_pu_bacteria 2940556831 2940556847 138
106 iso_pu_bacteria 2941538514 2941538881 138
107 iso_pu_bacteria 3005587118 3005592648 138
108 iso_pu_bacteria 3005710791 3005714915 138
109 iso_pu_bacteria 3005718088 3005722329 138
110 iso_pu_bacteria 8016511872 8016522328 138
111 iso_pu_bacteria 8016522445 8016529609 138
112 iso_pu_bacteria 8016530956 8016534826 138
113 iso_pu_bacteria 8016548790 8016554090 138
114 iso_pu_bacteria 8016557553 8016562465 138
115 iso_pu_bacteria 8016566248 8016573174 138
116 iso_pu_bacteria 8016575299 8016577316 138
117 iso_pu_bacteria 8016595262 8016600260 138
118 iso_pu_bacteria 8016622563 8016626551 138
119 iso_pu_bacteria 8017057580 8017063231 138
120 iso_pu_bacteria 8019530166 8019534590 138
121 iso_pu_bacteria 8019547302 8019553652 138
122 iso_pu_bacteria 8019576017 8019582658 138
123 iso_pu_bacteria 8019586578 8019590449 138
124 iso_pu_bacteria 8019597564 8019600904 138
125 iso_pu_bacteria 8019608314 8019617647 138
126 iso_pu_bacteria 8019659431 8019662345 138
127 iso_pu_bacteria 8019668869 8019671846 138
128 iso_pu_bacteria 8056967851 8056968046 138
129 3300005353 Ga0070669_100107030 Ga0070669_1001070302 139
130 3300005543 Ga0070672_100719060 Ga0070672_1007190602 139
131 3300014326 Ga0157380_10526523 Ga0157380_105265232 139
132 3300025972 Ga0207668_10351426 Ga0207668_103514262 139
133 3300028800 Ga0265338_10013374 Ga0265338_100133743 139
134 3300031241 Ga0265325_10000451 Ga0265325_1000045123 139
135 3300031249 Ga0265339_10004264 Ga0265339_100042643 139
136 3300031344 Ga0265316_10030700 Ga0265316_100307003 139
137 3300031595 Ga0265313_10001684 Ga0265313_1000168418 139
138 3300032002 Ga0307416_101012301 Ga0307416_1010123012 139
139 3300037466 Ga0395898_0378588 Ga0395898_0378588_271_696 139
140 3300044684 Ga0466966_0016700 Ga0466966_0016700_2186_2617 139
141 3300044765 Ga0466970_0022116 Ga0466970_0022116_487_918 139
142 3300045049 Ga0466959_0300790 Ga0466959_0300790_538_969 139
143 3300048915 Ga0496112_0153753 Ga0496112_0153753_1091_1513 139
144 3300044683 Ga0466965_0077284 Ga0466965_0077284_289_717 140
145 3300044693 Ga0466961_0210727 Ga0466961_0210727_187_615 140
146 3300044735 Ga0466968_0136335 Ga0466968_0136335_371_799 140
147 3300045836 Ga0466958_0073290 Ga0466958_0073290_372_800 140
148 3300048924 Ga0496121_0000024 Ga0496121_0000024_41643_42080 140
149 3300005467 Ga0070706_100737207 Ga0070706_1007372071 141
150 3300005985 Ga0081539_10010966 Ga0081539_100109663 141
151 3300006237 Ga0097621_100963230 Ga0097621_1009632302 141
152 3300006847 Ga0075431_100481949 Ga0075431_1004819492 141
153 3300014968 Ga0157379_10244318 Ga0157379_102443181 141
154 3300025922 Ga0207646_10523410 Ga0207646_105234101 141
155 3300025986 Ga0207658_10102595 Ga0207658_101025953 141
156 3300026035 Ga0207703_10271230 Ga0207703_102712302 141
157 3300044842 Ga0466957_0553222 Ga0466957_0553222_106_558 141
158 3300046694 Ga0495649_0000802 Ga0495649_0000802_18362_18790 141
159 3300001989 JGI24739J22299_10024675 JGI24739J22299_100246753 142
160 3300001990 JGI24737J22298_10147813 JGI24737J22298_101478131 142
161 3300003215 JGI25153J46596_10000531 JGI25153J46596_1000053126 142
162 3300003215 JGI25153J46596_10086934 JGI25153J46596_100869341 142
163 3300004625 Ga0055543_1003684 Ga0055543_10036845 142
164 3300005262 Ga0065165_1000780 Ga0065165_10007809 142
165 3300005262 Ga0065165_1000826 Ga0065165_100082614 142
166 3300005262 Ga0065165_1020047 Ga0065165_10200472 142
167 3300005331 Ga0070670_100053143 Ga0070670_1000531432 142
168 3300005331 Ga0070670_100448409 Ga0070670_1004484093 142
169 3300005331 Ga0070670_101782643 Ga0070670_1017826431 142
170 3300005338 Ga0068868_100324211 Ga0068868_1003242112 142
171 3300005345 Ga0070692_10836234 Ga0070692_108362342 142
172 3300005347 Ga0070668_100021775 Ga0070668_1000217756 142
173 3300005347 Ga0070668_100516004 Ga0070668_1005160042 142
174 3300005353 Ga0070669_100327154 Ga0070669_1003271542 142
175 3300005354 Ga0070675_100048053 Ga0070675_1000480532 142
176 3300005354 Ga0070675_100375683 Ga0070675_1003756832 142
177 3300005355 Ga0070671_100151444 Ga0070671_1001514442 142
178 3300005364 Ga0070673_100232193 Ga0070673_1002321932 142
179 3300005367 Ga0070667_100019257 Ga0070667_1000192575 142
180 3300005367 Ga0070667_100111188 Ga0070667_1001111882 142
181 3300005441 Ga0070700_100538139 Ga0070700_1005381391 142
182 3300005455 Ga0070663_100060896 Ga0070663_1000608962 142
183 3300005455 Ga0070663_100218721 Ga0070663_1002187212 142
184 3300005455 Ga0070663_101142470 Ga0070663_1011424701 142
185 3300005459 Ga0068867_100226107 Ga0068867_1002261072 142
186 3300005459 Ga0068867_100510395 Ga0068867_1005103951 142
187 3300005539 Ga0068853_101102358 Ga0068853_1011023581 142
188 3300005539 Ga0068853_101212525 Ga0068853_1012125251 142
189 3300005543 Ga0070672_100948002 Ga0070672_1009480021 142
190 3300005544 Ga0070686_100448910 Ga0070686_1004489101 142
191 3300005548 Ga0070665_100032656 Ga0070665_1000326564 142
192 3300005548 Ga0070665_100794606 Ga0070665_1007946062 142
193 3300005563 Ga0068855_100418488 Ga0068855_1004184883 142
194 3300005563 Ga0068855_100549860 Ga0068855_1005498602 142
195 3300005564 Ga0070664_100430547 Ga0070664_1004305471 142
196 3300005564 Ga0070664_100445397 Ga0070664_1004453971 142
197 3300005577 Ga0068857_100093990 Ga0068857_1000939902 142
198 3300005577 Ga0068857_100444951 Ga0068857_1004449512 142
199 3300005578 Ga0068854_100100778 Ga0068854_1001007783 142
200 3300005614 Ga0068856_100087920 Ga0068856_1000879203 142
201 3300005616 Ga0068852_101140165 Ga0068852_1011401651 142
202 3300005617 Ga0068859_100065505 Ga0068859_1000655052 142
203 3300005617 Ga0068859_100259497 Ga0068859_1002594972 142
204 3300005618 Ga0068864_100777004 Ga0068864_1007770042 142
205 3300005841 Ga0068863_100735157 Ga0068863_1007351572 142
206 3300005842 Ga0068858_100288122 Ga0068858_1002881222 142
207 3300005843 Ga0068860_100027100 Ga0068860_1000271002 142
208 3300005983 Ga0081540_1053755 Ga0081540_10537552 142
209 3300006038 Ga0075365_10225717 Ga0075365_102257171 142
210 3300006042 Ga0075368_10007965 Ga0075368_100079653 142
211 3300006048 Ga0075363_100039423 Ga0075363_1000394232 142
212 3300006051 Ga0075364_10106450 Ga0075364_101064502 142
213 3300006178 Ga0075367_10117086 Ga0075367_101170862 142
214 3300006186 Ga0075369_10130778 Ga0075369_101307782 142
215 3300006195 Ga0075366_10057401 Ga0075366_100574011 142
216 3300006237 Ga0097621_100525081 Ga0097621_1005250812 142
217 3300006353 Ga0075370_10199708 Ga0075370_101997082 142
218 3300006844 Ga0075428_102339997 Ga0075428_1023399971 142
219 3300006847 Ga0075431_100066871 Ga0075431_1000668712 142
220 3300006881 Ga0068865_100178100 Ga0068865_1001781001 142
221 3300006931 Ga0097620_100065506 Ga0097620_1000655062 142
222 3300006931 Ga0097620_100259492 Ga0097620_1002594922 142
223 3300006942 Ga0099824_1029046 Ga0099824_10290463 142
224 3300006944 Ga0099823_1016643 Ga0099823_10166432 142
225 3300009098 Ga0105245_10817684 Ga0105245_108176841 142
226 3300009101 Ga0105247_10154490 Ga0105247_101544902 142
227 3300009147 Ga0114129_11740026 Ga0114129_117400261 142
228 3300009147 Ga0114129_12583464 Ga0114129_125834642 142
229 3300009148 Ga0105243_10133082 Ga0105243_101330822 142
230 3300009148 Ga0105243_11294830 Ga0105243_112948301 142
231 3300009176 Ga0105242_11747466 Ga0105242_117474661 142
232 3300009177 Ga0105248_10102158 Ga0105248_101021582 142
233 3300009545 Ga0105237_10103257 Ga0105237_101032572 142
234 3300009545 Ga0105237_11271734 Ga0105237_112717342 142
235 3300009545 Ga0105237_11655442 Ga0105237_116554421 142
236 3300009551 Ga0105238_10529250 Ga0105238_105292501 142
237 3300009551 Ga0105238_10529790 Ga0105238_105297902 142
238 3300009553 Ga0105249_11533378 Ga0105249_115333781 142
239 3300010375 Ga0105239_10137660 Ga0105239_101376602 142
240 3300010375 Ga0105239_10408629 Ga0105239_104086291 142
241 3300010375 Ga0105239_10576323 Ga0105239_105763232 142
242 3300011119 Ga0105246_10103876 Ga0105246_101038762 142
243 3300013297 Ga0157378_10576289 Ga0157378_105762891 142
244 3300013297 Ga0157378_10743172 Ga0157378_107431722 142
245 3300013306 Ga0163162_11504809 Ga0163162_115048091 142
246 3300013308 Ga0157375_10524451 Ga0157375_105244512 142
247 3300014325 Ga0163163_10051180 Ga0163163_100511804 142
248 3300014325 Ga0163163_10080821 Ga0163163_100808212 142
249 3300014968 Ga0157379_10153320 Ga0157379_101533202 142
250 3300014968 Ga0157379_10345374 Ga0157379_103453742 142
251 3300017792 Ga0163161_10745314 Ga0163161_107453141 142
252 3300021321 Ga0214542_1000001 Ga0214542_1000001791 142
253 3300021324 Ga0214545_1000001 Ga0214545_1000001857 142
254 3300021327 Ga0214543_1000001 Ga0214543_1000001338 142
255 3300025230 Ga0209563_103040 Ga0209563_1030402 142
256 3300025253 Ga0209677_101583 Ga0209677_1015834 142
257 3300025254 Ga0209148_1000289 Ga0209148_100028914 142
258 3300025261 Ga0209233_1002174 Ga0209233_10021744 142
259 3300025272 Ga0209455_1000612 Ga0209455_10006122 142
260 3300025297 Ga0209758_1000160 Ga0209758_100016049 142
261 3300025297 Ga0209758_1041384 Ga0209758_10413843 142
262 3300025297 Ga0209758_1049219 Ga0209758_10492192 142
263 3300025302 Ga0207426_1003500 Ga0207426_10035002 142
264 3300025302 Ga0207426_1060622 Ga0207426_10606222 142
265 3300025900 Ga0207710_10048868 Ga0207710_100488682 142
266 3300025904 Ga0207647_10018357 Ga0207647_100183572 142
267 3300025904 Ga0207647_10219805 Ga0207647_102198051 142
268 3300025911 Ga0207654_10054765 Ga0207654_100547652 142
269 3300025914 Ga0207671_10019111 Ga0207671_100191112 142
270 3300025919 Ga0207657_10437850 Ga0207657_104378502 142
271 3300025919 Ga0207657_10456492 Ga0207657_104564922 142
272 3300025923 Ga0207681_10061687 Ga0207681_100616872 142
273 3300025923 Ga0207681_10295468 Ga0207681_102954682 142
274 3300025924 Ga0207694_10303452 Ga0207694_103034522 142
275 3300025925 Ga0207650_10151534 Ga0207650_101515342 142
276 3300025925 Ga0207650_10850043 Ga0207650_108500432 142
277 3300025926 Ga0207659_10049753 Ga0207659_100497533 142
278 3300025926 Ga0207659_10508734 Ga0207659_105087342 142
279 3300025931 Ga0207644_10292493 Ga0207644_102924931 142
280 3300025934 Ga0207686_10205145 Ga0207686_102051451 142
281 3300025935 Ga0207709_10072710 Ga0207709_100727102 142
282 3300025938 Ga0207704_10459984 Ga0207704_104599841 142
283 3300025940 Ga0207691_10825029 Ga0207691_108250291 142
284 3300025941 Ga0207711_10269869 Ga0207711_102698692 142
285 3300025941 Ga0207711_11537759 Ga0207711_115377592 142
286 3300025942 Ga0207689_10717360 Ga0207689_107173601 142
287 3300025945 Ga0207679_10028248 Ga0207679_100282483 142
288 3300025949 Ga0207667_10293982 Ga0207667_102939823 142
289 3300025949 Ga0207667_10713764 Ga0207667_107137641 142
290 3300025960 Ga0207651_10195949 Ga0207651_101959492 142
291 3300025961 Ga0207712_10081066 Ga0207712_100810662 142
292 3300025981 Ga0207640_10290500 Ga0207640_102905001 142
293 3300025986 Ga0207658_10059628 Ga0207658_100596282 142
294 3300025986 Ga0207658_10622904 Ga0207658_106229042 142
295 3300026023 Ga0207677_11574832 Ga0207677_115748321 142
296 3300026035 Ga0207703_10576725 Ga0207703_105767252 142
297 3300026035 Ga0207703_11467579 Ga0207703_114675791 142
298 3300026041 Ga0207639_11228906 Ga0207639_112289062 142
299 3300026067 Ga0207678_10087280 Ga0207678_100872802 142
300 3300026067 Ga0207678_10251468 Ga0207678_102514682 142
301 3300026078 Ga0207702_10021105 Ga0207702_100211054 142
302 3300026078 Ga0207702_10533736 Ga0207702_105337362 142
303 3300026089 Ga0207648_10538873 Ga0207648_105388731 142
304 3300026116 Ga0207674_10114495 Ga0207674_101144952 142
305 3300026116 Ga0207674_10581150 Ga0207674_105811502 142
306 3300026121 Ga0207683_10130326 Ga0207683_101303263 142
307 3300027296 Ga0209389_1000008 Ga0209389_1000008132 142
308 3300027361 Ga0209489_103917 Ga0209489_10391718 142
309 3300027363 Ga0209700_100036 Ga0209700_10003618 142
310 3300027866 Ga0209813_10062209 Ga0209813_100622092 142
311 3300028379 Ga0268266_10144787 Ga0268266_101447872 142
312 3300028379 Ga0268266_10214744 Ga0268266_102147442 142
313 3300028381 Ga0268264_10022569 Ga0268264_100225697 142
314 3300031548 Ga0307408_100249104 Ga0307408_1002491041 142
315 3300031691 Ga0316579_10006447 Ga0316579_100064472 142
316 3300031711 Ga0265314_10003943 Ga0265314_1000394310 142
317 3300031728 Ga0316578_10019617 Ga0316578_100196176 142
318 3300033180 Ga0307510_10007884 Ga0307510_1000788413 142
319 3300035398 Ga0316574_0409911 Ga0316574_0409911_115_567 142
320 3300035398 Ga0316574_0667428 Ga0316574_0667428_56_562 142
321 3300035724 Ga0373933_0897960 Ga0373933_0897960_44_508 142
322 3300037418 Ga0395900_0001114 Ga0395900_0001114_9529_9969 142
323 3300037418 Ga0395900_0156313 Ga0395900_0156313_20_457 142
324 3300037418 Ga0395900_0395246 Ga0395900_0395246_869_1306 142
325 3300037466 Ga0395898_0008436 Ga0395898_0008436_5906_6346 142
326 3300037471 Ga0395905_0044671 Ga0395905_0044671_887_1324 142
327 3300037471 Ga0395905_0238134 Ga0395905_0238134_965_1405 142
328 3300037588 Ga0316581_0033206 Ga0316581_0033206_618_1124 142
329 3300037853 Ga0436364_1295084 Ga0436364_1295084_481_918 142
330 3300038443 Ga0395901_0071243 Ga0395901_0071243_1580_2020 142
331 3300038443 Ga0395901_0760654 Ga0395901_0760654_125_562 142
332 3300039447 Ga0436361_1084244 Ga0436361_1084244_53_526 142
333 3300044656 Ga0466969_0152761 Ga0466969_0152761_59_499 142
334 3300044658 Ga0466972_0000142 Ga0466972_0000142_7849_8286 142
335 3300044658 Ga0466972_0219489 Ga0466972_0219489_371_811 142
336 3300044683 Ga0466965_0065069 Ga0466965_0065069_261_698 142
337 3300044683 Ga0466965_0305537 Ga0466965_0305537_396_827 142
338 3300044684 Ga0466966_0064757 Ga0466966_0064757_841_1302 142
339 3300044735 Ga0466968_0005776 Ga0466968_0005776_510_950 142
340 3300044765 Ga0466970_0059184 Ga0466970_0059184_145_582 142
341 3300044901 Ga0466960_0031341 Ga0466960_0031341_28_468 142
342 3300044901 Ga0466960_0543422 Ga0466960_0543422_16_453 142
343 3300046455 Ga0495603_0426001 Ga0495603_0426001_35_475 142
344 3300046460 Ga0495638_0000398 Ga0495638_0000398_8551_8991 142
345 3300046474 Ga0495605_0233551 Ga0495605_0233551_31_468 142
346 3300046506 Ga0495583_0122799 Ga0495583_0122799_429_869 142
347 3300046507 Ga0495606_0126837 Ga0495606_0126837_974_1411 142
348 3300046512 Ga0495610_0036754 Ga0495610_0036754_2037_2474 142
349 3300046519 Ga0495632_0108434 Ga0495632_0108434_384_821 142
350 3300046522 Ga0495643_0054782 Ga0495643_0054782_181_618 142
351 3300046522 Ga0495643_0079759 Ga0495643_0079759_187_627 142
352 3300046524 Ga0495648_0213841 Ga0495648_0213841_87_527 142
353 3300046524 Ga0495648_0243905 Ga0495648_0243905_272_712 142
354 3300046542 Ga0495597_0158803 Ga0495597_0158803_226_666 142
355 3300046557 Ga0495622_0270056 Ga0495622_0270056_140_580 142
356 3300046616 Ga0495668_0032962 Ga0495668_0032962_1445_1882 142
357 3300046616 Ga0495668_0592950 Ga0495668_0592950_127_567 142
358 3300046648 Ga0495611_0127568 Ga0495611_0127568_114_554 142
359 3300046660 Ga0495625_0243766 Ga0495625_0243766_21_461 142
360 3300046660 Ga0495625_0462246 Ga0495625_0462246_227_664 142
361 3300046665 Ga0495661_0252063 Ga0495661_0252063_372_812 142
362 3300046665 Ga0495661_0300726 Ga0495661_0300726_114_554 142
363 3300046674 Ga0495588_0264004 Ga0495588_0264004_187_627 142
364 3300047323 Ga0495683_0013708 Ga0495683_0013708_2224_2661 142
365 3300047443 Ga0495687_003920 Ga0495687_003920_9600_10073 142
366 3300047443 Ga0495687_076472 Ga0495687_076472_858_1298 142
367 3300047469 Ga0495673_0116035 Ga0495673_0116035_592_1032 142
368 3300048903 Ga0496100_0124002 Ga0496100_0124002_437_877 142
369 3300048903 Ga0496100_0482436 Ga0496100_0482436_460_897 142
370 3300048904 Ga0496101_0055608 Ga0496101_0055608_1120_1560 142
371 3300048904 Ga0496101_0568468 Ga0496101_0568468_180_617 142
372 3300048906 Ga0496103_0616495 Ga0496103_0616495_48_488 142
373 3300048907 Ga0496104_0149248 Ga0496104_0149248_95_535 142
374 3300048908 Ga0496105_0082518 Ga0496105_0082518_1565_2005 142
375 3300048908 Ga0496105_0176064 Ga0496105_0176064_1219_1656 142
376 3300048911 Ga0496108_0043991 Ga0496108_0043991_2412_2849 142
377 3300048912 Ga0496109_0049410 Ga0496109_0049410_180_617 142
378 3300048912 Ga0496109_1209096 Ga0496109_1209096_141_581 142
379 3300048913 Ga0496110_0147859 Ga0496110_0147859_212_652 142
380 3300048915 Ga0496112_0048748 Ga0496112_0048748_508_945 142
381 3300048915 Ga0496112_0409530 Ga0496112_0409530_103_543 142
382 3300048916 Ga0496113_0023123 Ga0496113_0023123_1106_1543 142
383 3300048916 Ga0496113_0710273 Ga0496113_0710273_135_572 142
384 3300048917 Ga0496114_0225581 Ga0496114_0225581_373_813 142
385 3300048918 Ga0496115_0262377 Ga0496115_0262377_359_799 142
386 3300048918 Ga0496115_0330296 Ga0496115_0330296_464_901 142
387 3300048920 Ga0496117_0140912 Ga0496117_0140912_115_552 142
388 3300048921 Ga0496118_0070532 Ga0496118_0070532_874_1314 142
389 3300048921 Ga0496118_0073567 Ga0496118_0073567_960_1400 142
390 3300048921 Ga0496118_0368994 Ga0496118_0368994_253_690 142
391 3300048922 Ga0496119_0033756 Ga0496119_0033756_33_470 142
392 3300048922 Ga0496119_0047798 Ga0496119_0047798_918_1358 142
393 3300048924 Ga0496121_0056775 Ga0496121_0056775_1356_1796 142
394 3300048924 Ga0496121_0059648 Ga0496121_0059648_741_1178 142
395 3300048924 Ga0496121_0487868 Ga0496121_0487868_286_726 142
396 3300048925 Ga0496122_0493527 Ga0496122_0493527_18_455 142
397 3300048927 Ga0496124_0251277 Ga0496124_0251277_677_1114 142
398 3300048928 Ga0496125_0070386 Ga0496125_0070386_2241_2678 142
399 3300048929 Ga0496126_0132738 Ga0496126_0132738_1360_1797 142
400 3300049571 Ga0501034_0072565 Ga0501034_0072565_2260_2697 142
401 3300049574 Ga0501038_0008008 Ga0501038_0008008_3422_3880 142
402 3300049679 Ga0501249_001010 Ga0501249_001010_5075_5518 142
403 3300049703 Ga0501219_018980 Ga0501219_018980_26_469 142
404 3300050491 nmdc:mga00v17_629406_c1 nmdc:mga00v17_629406_c1_130_567 142
405 3300050492 nmdc:mga0yw44_14162_c1 nmdc:mga0yw44_14162_c1_2292_2729 142
406 3300050492 nmdc:mga0yw44_952674_c1 nmdc:mga0yw44_952674_c1_90_533 142
407 3300050495 nmdc:mga04h51_6268_c1 nmdc:mga04h51_6268_c1_423_860 142
408 3300050507 nmdc:mga05p37_1301131_c1 nmdc:mga05p37_1301131_c1_200_637 142
409 3300050510 nmdc:mga06r32_455485_c1 nmdc:mga06r32_455485_c1_687_1124 142
410 3300050511 nmdc:mga08y16_687703_c1 nmdc:mga08y16_687703_c1_467_943 142
411 3300050516 nmdc:mga0sz30_281573_c1 nmdc:mga0sz30_281573_c1_254_691 142
412 3300050516 nmdc:mga0sz30_95437_c1 nmdc:mga0sz30_95437_c1_373_810 142
413 3300053086 Ga0500578_0112634 Ga0500578_0112634_1164_1604 142
414 3300053087 Ga0500643_000015 Ga0500643_000015_14942_15382 142
415 3300053088 Ga0500644_0512244 Ga0500644_0512244_34_474 142
416 3300053090 Ga0500646_0053069 Ga0500646_0053069_162_602 142
417 3300053091 Ga0500647_0276402 Ga0500647_0276402_76_516 142
418 3300053091 Ga0500647_0309701 Ga0500647_0309701_161_598 142
419 3300053092 Ga0500583_0227630 Ga0500583_0227630_125_565 142
420 3300053093 Ga0500651_0166756 Ga0500651_0166756_31_468 142
421 3300053094 Ga0500566_0000082 Ga0500566_0000082_10705_11142 142
422 3300053095 Ga0500640_061099 Ga0500640_061099_229_666 142
423 3300053098 Ga0500650_0175755 Ga0500650_0175755_530_967 142
424 3300053103 Ga0500555_004293 Ga0500555_004293_740_1180 142
425 3300053104 Ga0500556_0011101 Ga0500556_0011101_1103_1543 142
426 3300053105 Ga0500557_000015 Ga0500557_000015_3327_3767 142
427 3300053108 Ga0500562_032755 Ga0500562_032755_435_875 142
428 3300053109 Ga0500569_036834 Ga0500569_036834_728_1165 142
429 3300053116 Ga0500592_008233 Ga0500592_008233_40_480 142
430 3300053118 Ga0500594_0232062 Ga0500594_0232062_78_518 142
431 3300053121 Ga0500607_073965 Ga0500607_073965_119_556 142
432 3300053130 Ga0500642_0006650 Ga0500642_0006650_1209_1649 142
433 3300053133 Ga0500655_051196 Ga0500655_051196_104_541 142
434 3300053133 Ga0500655_107526 Ga0500655_107526_64_504 142
435 3300053136 Ga0500559_0042017 Ga0500559_0042017_1341_1778 142
436 3300053139 Ga0500568_0021270 Ga0500568_0021270_1530_1970 142
437 3300053142 Ga0500577_0044024 Ga0500577_0044024_1062_1502 142
438 3300053144 Ga0500585_062506 Ga0500585_062506_471_908 142
439 3300053146 Ga0500588_0040153 Ga0500588_0040153_669_1106 142
440 3300053146 Ga0500588_0168043 Ga0500588_0168043_127_567 142
441 3300053147 Ga0500589_160056 Ga0500589_160056_379_819 142
442 3300053151 Ga0500604_0131197 Ga0500604_0131197_309_749 142
443 3300053151 Ga0500604_0197665 Ga0500604_0197665_206_646 142
444 3300053153 Ga0500616_0092727 Ga0500616_0092727_750_1190 142
445 3300053154 Ga0500619_066977 Ga0500619_066977_37_474 142
446 3300053157 Ga0500624_024237 Ga0500624_024237_145_582 142
447 3300053158 Ga0500627_0191922 Ga0500627_0191922_270_710 142
448 3300053163 Ga0500639_057275 Ga0500639_057275_205_642 142
449 3300053177 Ga0500636_0381057 Ga0500636_0381057_206_646 142
450 3300053730 Ga0500645_023897 Ga0500645_023897_196_636 142
451 3300053730 Ga0500645_195972 Ga0500645_195972_20_460 142
452 3300053737 Ga0500601_043370 Ga0500601_043370_62_502 142
453 3300055283 Ga0500661_010451 Ga0500661_010451_579_1016 142
454 3300061719 Ga0466962_0656068 Ga0466962_0656068_40_471 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

23

158

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9963 3 139
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9681 3 139
7ep0-assembly1.cif.gz_A crystal structure of zyg11b bound to gste degron 0.4601 1 124
6ve7-assembly1.cif.gz_d the inner junction complex of chlamydomonas reinhardtii doublet microtubule 0.4412 33 128
5aff-assembly1.cif.gz_A symportin 1 chaperones 5s rnp assembly during ribosome biogenesis by occupying an essential rrna binding site 0.4298 6 128
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9963 3 139 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9681 3 139 1.25.40.380
af_Q8VE52_114_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5858 6 125 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5844 15 127 1.25.10.10
af_A0A1D6I621_113_222_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.517 59 127 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A1I3IZ37-F1-model_v4 Uncharacterized protein 1.005 51 141
AF-A0A0S6UUP6-F1-model_v4 Calpastatin 1.003 1 141
AF-A0A2S9GFW1-F1-model_v4 DUF1810 domain-containing protein 1.003 29 110
AF-A0A7V7TXD8-F1-model_v4 DUF1810 domain-containing protein 1.002 1 139
AF-A0A1H7GQQ3-F1-model_v4 Calpastatin 0.9999 6 84

Feature Viewer

pLDDT pTM Quality
96.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map