F447198

General Info

Members Datasets Scaffolds Average Seq Length
453 238 410 245

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10000527|Ga0207695_1000052733
Length 278
Sequence MEWGGTTSLHPSCSLPASIPIMKLRKTLRRAIATACVAWLGYLATPAVASVVIGGTRVIYGASESEVTLKLSNAGQSPALVQSWVDAGDVRSAPSTIKVPFTVTPPIARIDPSKSQTLRIVYTGEPMPQDRESVFWLNVLEVPPKPGAADADMNHIQLAFRSRIKLFYRPEKLKGSSADAPAQLTWRLTQADGKPAIEAHNPTPFHVSLTMISVQSGGRSAIFDDGGMVGPGETRAFPLKGDVPGAAGASVRYTALNDYGGSVSGETPLRSGPAAPSR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
7 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
8 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
9 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
10 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
11 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
14 2739367700 Dyella sp. YR388 Isolate Unclassified
15 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
16 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
17 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
18 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
19 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
20 2818991452 Burkholderia cepacia 561 Isolate Unclassified
21 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
22 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
23 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
24 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
25 2919150387 Rahnella aceris 1817 Isolate Unclassified
26 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
27 2927143783 Rahnella sp. 2050 Isolate Unclassified
28 2928170801 Burkholderia sp. 572 Isolate Unclassified
29 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
30 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
31 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
32 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
33 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
43 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
137 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
236 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
237 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
238 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.51
Metatranscriptomes 0
Isolates 9.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.97
Nodule 1.77
Rhizoplane 5.3
Rhizosphere 49.45
Stem 0
Stem Tuber 0
Unclassified 22.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1740182 2162886007 Bacteria 7029
2 SwRhRL2b_contig_620035 2162886007 Bacteria 4090
3 JGI25156J39149_1017169 3300002705 Unclassified 1380
4 JGI25162J39368_1000003 3300002737 Bacteria 575218
5 JGI25162J39368_1000007 3300002737 Bacteria 403947
6 JGI25162J39368_1000336 3300002737 Bacteria 41116
7 JGI25163J39215_1000012 3300002771 Bacteria 86410
8 JGI25163J39215_1000023 3300002771 Bacteria 73384
9 JGI25164J39214_1000009 3300002772 Bacteria 303437
10 JGI25164J39214_1000010 3300002772 Bacteria 288863
11 JGI25164J39214_1000013 3300002772 Bacteria 253470
12 JGI25151J46595_10032987 3300003187 Bacteria 2000
13 rootL2_10047525 3300003322 Bacteria 3380
14 rootL2_10209754 3300003322 Bacteria 5635
15 Ga0055538_1000005 3300003751 Bacteria 575218
16 Ga0055538_1000006 3300003751 Bacteria 403947
17 Ga0055539_1000007 3300003752 Bacteria 575218
18 Ga0055539_1000010 3300003752 Bacteria 403947
19 Ga0055539_1000511 3300003752 Bacteria 11963
20 Ga0055533_1000009 3300003756 Bacteria 575218
21 Ga0055533_1000013 3300003756 Bacteria 403947
22 Ga0055533_1001152 3300003756 Bacteria 7499
23 Ga0055532_1000442 3300003758 Bacteria 19436
24 Ga0055532_1000628 3300003758 Bacteria 13804
25 Ga0055525_1000010 3300003759 Bacteria 575218
26 Ga0055525_1000015 3300003759 Bacteria 403947
27 Ga0055527_1000051 3300003760 Bacteria 100861
28 Ga0055527_1000095 3300003760 Bacteria 67909
29 Ga0055527_1000338 3300003760 Bacteria 23934
30 Ga0055535_1000091 3300003761 Bacteria 100865
31 Ga0055535_1001138 3300003761 Bacteria 15784
32 Ga0055535_1001682 3300003761 Bacteria 10140
33 Ga0055542_1000116 3300003762 Bacteria 106105
34 Ga0055542_1000124 3300003762 Bacteria 100865
35 Ga0055542_1000193 3300003762 Bacteria 74642
36 Ga0055542_1000878 3300003762 Bacteria 20838
37 Ga0055529_1000147 3300003763 Bacteria 100861
38 Ga0055529_1000541 3300003763 Bacteria 32405
39 Ga0055529_1001121 3300003763 Bacteria 11701
40 Ga0055524_1002558 3300003775 Bacteria 9281
41 Ga0055531_10002086 3300003794 Bacteria 13730
42 Ga0055531_10002964 3300003794 Bacteria 11033
43 Ga0055541_1000005 3300003841 Bacteria 575218
44 Ga0055541_1000007 3300003841 Bacteria 403947
45 Ga0065704_10000419 3300005289 Bacteria 44792
46 Ga0065704_10000639 3300005289 Bacteria 25902
47 Ga0070666_10063879 3300005335 Bacteria 2496
48 Ga0070660_100000022 3300005339 Bacteria 97443
49 Ga0070660_100000416 3300005339 Bacteria 28388
50 Ga0070689_100152475 3300005340 Bacteria 1864
51 Ga0070661_100050475 3300005344 Bacteria 3044
52 Ga0070668_100025655 3300005347 Bacteria 4470
53 Ga0070659_100000015 3300005366 Bacteria 176475
54 Ga0070659_100004374 3300005366 Bacteria 10087
55 Ga0070663_100000950 3300005455 Bacteria 15758
56 Ga0070663_100007097 3300005455 Bacteria 6796
57 Ga0068855_100004605 3300005563 Bacteria 16834
58 Ga0070664_100503102 3300005564 Bacteria 1117
59 Ga0068856_100002368 3300005614 Bacteria 19390
60 Ga0068858_100122492 3300005842 Bacteria 2433
61 Ga0068860_100069544 3300005843 Bacteria 3346
62 Ga0075369_10012594 3300006186 Bacteria 3341
63 Ga0079104_1020931 3300006946 Bacteria 1790
64 Ga0099826_10000004 3300006948 Bacteria 802669
65 Ga0099826_10000009 3300006948 Bacteria 336081
66 Ga0105251_10057240 3300009011 Bacteria 1843
67 Ga0105244_10000275 3300009036 Bacteria 51753
68 Ga0105244_10000840 3300009036 Bacteria 25982
69 Ga0105250_10000731 3300009092 Bacteria 20061
70 Ga0105250_10001095 3300009092 Bacteria 15282
71 Ga0105240_10002352 3300009093 Bacteria 30510
72 Ga0105240_10013149 3300009093 Bacteria 11387
73 Ga0105240_10025820 3300009093 Bacteria 7714
74 Ga0105240_10275944 3300009093 Bacteria 1934
75 Ga0105248_11286112 3300009177 Bacteria 827
76 Ga0105237_10016868 3300009545 Bacteria 7578
77 Ga0105237_10119209 3300009545 Bacteria 2633
78 Ga0105238_10002287 3300009551 Bacteria 19305
79 Ga0105238_10129429 3300009551 Bacteria 2503
80 Ga0105238_10133012 3300009551 Bacteria 2465
81 Ga0105239_10001809 3300010375 Bacteria 28080
82 Ga0105239_10004936 3300010375 Bacteria 15746
83 Ga0157371_10000007 3300013102 Bacteria 401847
84 Ga0157371_10000214 3300013102 Bacteria 84248
85 Ga0157370_10004459 3300013104 Bacteria 16039
86 Ga0157370_10401971 3300013104 Bacteria 1261
87 Ga0157369_10001560 3300013105 Bacteria 28053
88 Ga0157369_10009216 3300013105 Bacteria 11291
89 Ga0163162_10017627 3300013306 Bacteria 6986
90 Ga0163162_10089167 3300013306 Bacteria 3164
91 Ga0163162_10265869 3300013306 Bacteria 1847
92 Ga0163162_10491803 3300013306 Bacteria 1358
93 Ga0157376_10042677 3300014969 Bacteria 3718
94 Ga0157376_10236596 3300014969 Bacteria 1699
95 Ga0182006_1003040 3300015261 Bacteria 8822
96 Ga0182005_1000727 3300015265 Bacteria 15111
97 Ga0182005_1001008 3300015265 Bacteria 12046
98 Ga0182005_1001199 3300015265 Bacteria 10725
99 Ga0182005_1001204 3300015265 Bacteria 10697
100 Ga0183362_10001 3300015683 Bacteria 2046624
101 Ga0183360_10003 3300015689 Bacteria 713221
102 Ga0163161_10010729 3300017792 Bacteria 6346
103 Ga0163161_10022017 3300017792 Bacteria 4483
104 Ga0209435_102713 3300025206 Bacteria 2055
105 Ga0209760_100029 3300025207 Bacteria 149076
106 Ga0209760_100135 3300025207 Bacteria 47028
107 Ga0209784_100001 3300025224 Bacteria 3600592
108 Ga0209784_100022 3300025224 Bacteria 403999
109 Ga0209566_100001 3300025225 Bacteria 3600765
110 Ga0209566_100021 3300025225 Bacteria 403999
111 Ga0209566_100187 3300025225 Bacteria 65446
112 Ga0209566_102284 3300025225 Plasmid 3721
113 Ga0209674_100002 3300025226 Bacteria 3600592
114 Ga0209674_100038 3300025226 Bacteria 403999
115 Ga0209674_100059 3300025226 Bacteria 282517
116 Ga0209674_100107 3300025226 Bacteria 151298
117 Ga0209674_100504 3300025226 Bacteria 16095
118 Ga0209674_101019 3300025226 Bacteria 8564
119 Ga0209672_100005 3300025228 Bacteria 1069303
120 Ga0209672_100016 3300025228 Bacteria 522604
121 Ga0209672_100403 3300025228 Bacteria 25671
122 Ga0209672_101123 3300025228 Bacteria 11161
123 Ga0209672_111161 3300025228 Bacteria 1176
124 Ga0209147_100116 3300025229 Bacteria 143881
125 Ga0209147_100251 3300025229 Bacteria 51071
126 Ga0209563_100008 3300025230 Bacteria 1554545
127 Ga0209563_100042 3300025230 Bacteria 403999
128 Ga0207427_100002 3300025231 Bacteria 1355321
129 Ga0207427_100027 3300025231 Bacteria 403999
130 Ga0207427_103093 3300025231 Bacteria 3753
131 Ga0209437_100007 3300025233 Bacteria 938377
132 Ga0209437_100049 3300025233 Bacteria 403999
133 Ga0209437_100271 3300025233 Bacteria 77542
134 Ga0209258_100006 3300025242 Bacteria 1069303
135 Ga0209258_100012 3300025242 Bacteria 825544
136 Ga0209258_100104 3300025242 Bacteria 208582
137 Ga0209258_101780 3300025242 Bacteria 6613
138 Ga0209677_100004 3300025253 Bacteria 1554545
139 Ga0209677_100025 3300025253 Bacteria 403999
140 Ga0209677_100863 3300025253 Bacteria 14966
141 Ga0209148_1000012 3300025254 Bacteria 1069303
142 Ga0209148_1000014 3300025254 Bacteria 925277
143 Ga0209148_1000106 3300025254 Bacteria 208597
144 Ga0209148_1000144 3300025254 Bacteria 161633
145 Ga0209759_1002102 3300025256 Bacteria 9257
146 Ga0209233_1001311 3300025261 Bacteria 9928
147 Ga0209233_1020099 3300025261 Bacteria 1758
148 Ga0209565_1015037 3300025263 Bacteria 1757
149 Ga0209455_1000008 3300025272 Bacteria 1069303
150 Ga0209455_1000014 3300025272 Bacteria 806601
151 Ga0209455_1003862 3300025272 Bacteria 5115
152 Ga0209673_1003507 3300025273 Bacteria 9196
153 Ga0209675_1002344 3300025291 Bacteria 9779
154 Ga0209676_1001893 3300025292 Bacteria 17064
155 Ga0209025_1001262 3300025294 Bacteria 34940
156 Ga0209025_1032150 3300025294 Bacteria 2461
157 Ga0209256_1008380 3300025299 Bacteria 4811
158 Ga0209257_1001058 3300025304 Bacteria 36428
159 Ga0209257_1002170 3300025304 Bacteria 20336
160 Ga0207696_1000249 3300025711 Bacteria 72322
161 Ga0207696_1000273 3300025711 Bacteria 61851
162 Ga0207655_1000471 3300025728 Bacteria 52027
163 Ga0207655_1000521 3300025728 Bacteria 49022
164 Ga0207680_10057109 3300025903 Bacteria 2360
165 Ga0207705_10281241 3300025909 Bacteria 1274
166 Ga0207695_10000527 3300025913 Bacteria 80644
167 Ga0207695_10007214 3300025913 Bacteria 14210
168 Ga0207695_10156503 3300025913 Bacteria 2213
169 Ga0207695_10188967 3300025913 Bacteria 1978
170 Ga0207671_10012481 3300025914 Bacteria 6826
171 Ga0207657_10000014 3300025919 Bacteria 175779
172 Ga0207657_10001134 3300025919 Bacteria 28288
173 Ga0207649_10075636 3300025920 Bacteria 2165
174 Ga0207694_10002333 3300025924 Bacteria 15520
175 Ga0207694_10020627 3300025924 Bacteria 4989
176 Ga0207694_10035741 3300025924 Bacteria 3811
177 Ga0207690_10000023 3300025932 Bacteria 196155
178 Ga0207690_10000152 3300025932 Bacteria 54731
179 Ga0207670_10002413 3300025936 Bacteria 9794
180 Ga0207691_10228134 3300025940 Bacteria 1613
181 Ga0207667_10005415 3300025949 Bacteria 15561
182 Ga0207668_10073579 3300025972 Bacteria 2449
183 Ga0207703_10147194 3300026035 Bacteria 2050
184 Ga0207678_10000757 3300026067 Bacteria 29532
185 Ga0207678_10014712 3300026067 Bacteria 6885
186 Ga0209371_1029760 3300027312 Bacteria 1203
187 Ga0209282_1000017 3300027666 Bacteria 191482
188 Ga0209282_1000035 3300027666 Bacteria 137066
189 Ga0268265_10099370 3300028380 Bacteria 2346
190 Ga0265338_10000022 3300028800 Bacteria 308414
191 Ga0268256_1033866 3300030500 Bacteria 1203
192 Ga0265327_10001016 3300031251 Bacteria 39662
193 Ga0307413_10001780 3300031824 Bacteria 8433
194 Ga0307412_10000325 3300031911 Bacteria 30136
195 Ga0307414_10000750 3300032004 Bacteria 16649
196 Ga0395899_0039349 3300037312 Bacteria 3539
197 Ga0395898_0000241 3300037466 Bacteria 138133
198 Ga0439449_0038948 3300042007 Bacteria 1767
199 Ga0450893_0005917 3300042532 Bacteria 1972
200 Ga0450901_000051 3300042533 Bacteria 11428
201 Ga0466969_0067971 3300044656 Bacteria 1718
202 Ga0466965_0004705 3300044683 Bacteria 6084
203 Ga0466961_0009502 3300044693 Bacteria 6192
204 Ga0466963_0057292 3300044694 Bacteria 2595
205 Ga0466971_0001437 3300044719 Bacteria 10021
206 Ga0466957_0016854 3300044842 Plasmid 4275
207 Ga0466959_0490207 3300045049 Unclassified 831
208 Ga0466958_0002069 3300045836 Bacteria 9923
209 Ga0466958_0016263 3300045836 Plasmid 4280
210 Ga0466967_0022968 3300045976 Bacteria 5103
211 Ga0495592_0142272 3300046454 Bacteria 1667
212 Ga0495629_0000518 3300046459 Bacteria 32251
213 Ga0495653_0001810 3300046463 Bacteria 16843
214 Ga0495653_0014585 3300046463 Bacteria 6414
215 Ga0495650_0000004 3300046471 Bacteria 779487
216 Ga0495650_0000039 3300046471 Bacteria 375501
217 Ga0495580_0000907 3300046472 Bacteria 25816
218 Ga0495582_0001638 3300046473 Bacteria 12619
219 Ga0495605_0000547 3300046474 Bacteria 30862
220 Ga0495605_0002167 3300046474 Bacteria 12269
221 Ga0495639_0008276 3300046475 Bacteria 4464
222 Ga0495664_0065158 3300046477 Bacteria 2172
223 Ga0495596_0000024 3300046500 Bacteria 108222
224 Ga0495596_0000555 3300046500 Bacteria 23359
225 Ga0495607_0002813 3300046501 Bacteria 13826
226 Ga0495607_0004714 3300046501 Bacteria 9976
227 Ga0495607_0012686 3300046501 Bacteria 5550
228 Ga0495606_0001592 3300046507 Bacteria 29624
229 Ga0495606_0255943 3300046507 Bacteria 969
230 Ga0495610_0000337 3300046512 Bacteria 49536
231 Ga0495610_0000399 3300046512 Bacteria 45092
232 Ga0495610_0001052 3300046512 Bacteria 25386
233 Ga0495610_0016806 3300046512 Bacteria 4198
234 Ga0495616_0000563 3300046513 Bacteria 28025
235 Ga0495616_0000859 3300046513 Bacteria 22075
236 Ga0495618_0010505 3300046514 Bacteria 5600
237 Ga0495628_0005016 3300046516 Bacteria 11635
238 Ga0495631_0057484 3300046518 Bacteria 1693
239 Ga0495632_0119611 3300046519 Bacteria 1232
240 Ga0495648_0012851 3300046524 Bacteria 6218
241 Ga0495648_0015455 3300046524 Bacteria 5543
242 Ga0495648_0023655 3300046524 Bacteria 4201
243 Ga0495663_0000182 3300046525 Bacteria 25072
244 Ga0495663_0000791 3300046525 Bacteria 10822
245 Ga0495666_0004879 3300046526 Bacteria 6782
246 Ga0495642_0084509 3300046528 Bacteria 1339
247 Ga0495642_0125931 3300046528 Bacteria 1101
248 Ga0495652_0001577 3300046529 Bacteria 24927
249 Ga0495652_0009914 3300046529 Bacteria 8638
250 Ga0495640_0094883 3300046533 Bacteria 1964
251 Ga0495586_0002433 3300046535 Bacteria 10094
252 Ga0495587_0000735 3300046536 Bacteria 21967
253 Ga0495609_0000513 3300046538 Bacteria 31184
254 Ga0495609_0000781 3300046538 Bacteria 23802
255 Ga0495597_0031434 3300046542 Bacteria 2416
256 Ga0495597_0064063 3300046542 Bacteria 1597
257 Ga0495622_0000369 3300046557 Bacteria 31409
258 Ga0495622_0049277 3300046557 Unclassified 1955
259 Ga0495633_0001409 3300046558 Bacteria 18752
260 Ga0495633_0002518 3300046558 Bacteria 12882
261 Ga0495633_0011553 3300046558 Bacteria 4754
262 Ga0495633_0128467 3300046558 Bacteria 1172
263 Ga0495633_0250624 3300046558 Bacteria 808
264 Ga0495656_0020474 3300046615 Bacteria 2566
265 Ga0495634_0006477 3300046642 Bacteria 8894
266 Ga0495611_0291473 3300046648 Bacteria 753
267 Ga0495625_0082626 3300046660 Unclassified 2234
268 Ga0495625_0330774 3300046660 Bacteria 968
269 Ga0495635_0009273 3300046663 Bacteria 6875
270 Ga0495661_0000801 3300046665 Bacteria 29760
271 Ga0495661_0002255 3300046665 Bacteria 14927
272 Ga0495661_0013086 3300046665 Bacteria 5582
273 Ga0495588_0035708 3300046674 Bacteria 2520
274 Ga0495623_0041996 3300046679 Bacteria 2915
275 Ga0495646_0001272 3300046680 Bacteria 14827
276 Ga0495646_0008296 3300046680 Bacteria 6605
277 Ga0495646_0063943 3300046680 Bacteria 2182
278 Ga0495613_0074756 3300046689 Bacteria 2467
279 Ga0495624_0049725 3300046690 Bacteria 2658
280 Ga0495671_0000373 3300046692 Bacteria 36795
281 Ga0495671_0001541 3300046692 Bacteria 15359
282 Ga0495649_0004836 3300046694 Bacteria 8714
283 Ga0495649_0006209 3300046694 Bacteria 7459
284 Ga0495649_0008923 3300046694 Bacteria 5999
285 Ga0495589_0021781 3300046794 Bacteria 3275
286 Ga0495600_0102916 3300046809 Bacteria 1861
287 Ga0495660_0000061 3300046810 Bacteria 129945
288 Ga0495660_0000062 3300046810 Bacteria 129883
289 Ga0495581_0035571 3300047315 Bacteria 2881
290 Ga0495604_0005319 3300047317 Bacteria 10210
291 Ga0495636_0004549 3300047318 Bacteria 5433
292 Ga0495674_0030742 3300047319 Bacteria 4880
293 Ga0495674_0051790 3300047319 Bacteria 3617
294 Ga0495672_0007776 3300047320 Bacteria 8015
295 Ga0495672_0012594 3300047320 Bacteria 5892
296 Ga0495680_0034652 3300047322 Bacteria 4073
297 Ga0495680_0099320 3300047322 Bacteria 2170
298 Ga0495675_0087183 3300047444 Bacteria 1961
299 Ga0495679_000756 3300047446 Bacteria 20578
300 Ga0495685_000362 3300047447 Bacteria 14444
301 Ga0495685_006897 3300047447 Bacteria 3735
302 Ga0495681_0128905 3300047470 Bacteria 1078
303 Ga0495684_0010489 3300047471 Bacteria 7166
304 Ga0495593_0000661 3300047673 Bacteria 19852
305 Ga0495602_0095889 3300048088 Bacteria 2447
306 Ga0496100_0021425 3300048903 Bacteria 3892
307 Ga0496102_0002452 3300048905 Bacteria 15829
308 Ga0496102_0006332 3300048905 Bacteria 10091
309 Ga0496102_0247341 3300048905 Bacteria 1681
310 Ga0496103_0008069 3300048906 Bacteria 6253
311 Ga0496103_0020672 3300048906 Bacteria 3956
312 Ga0496104_0000075 3300048907 Bacteria 102426
313 Ga0496104_0014092 3300048907 Bacteria 7216
314 Ga0496104_0020479 3300048907 Bacteria 6063
315 Ga0496104_0577294 3300048907 Bacteria 1035
316 Ga0496105_0002217 3300048908 Bacteria 14074
317 Ga0496105_0006654 3300048908 Bacteria 8896
318 Ga0496108_0252791 3300048911 Bacteria 1533
319 Ga0496109_0082262 3300048912 Bacteria 2967
320 Ga0496110_0007166 3300048913 Bacteria 8879
321 Ga0496111_0101386 3300048914 Bacteria 2115
322 Ga0496113_0176635 3300048916 Bacteria 1692
323 Ga0496114_0139118 3300048917 Bacteria 2101
324 Ga0496115_0001433 3300048918 Bacteria 17085
325 Ga0496115_0009863 3300048918 Bacteria 7112
326 Ga0496115_0038435 3300048918 Bacteria 3798
327 Ga0496116_0000095 3300048919 Bacteria 202967
328 Ga0496116_0000440 3300048919 Bacteria 58324
329 Ga0496116_0001115 3300048919 Bacteria 32161
330 Ga0496116_0001407 3300048919 Bacteria 27028
331 Ga0496116_0001895 3300048919 Bacteria 22579
332 Ga0496116_0188044 3300048919 Bacteria 1097
333 Ga0496116_0190991 3300048919 Bacteria 1084
334 Ga0496117_0000172 3300048920 Bacteria 134425
335 Ga0496117_0004764 3300048920 Bacteria 14721
336 Ga0496117_0004829 3300048920 Bacteria 14570
337 Ga0496117_0005047 3300048920 Bacteria 14150
338 Ga0496117_0009875 3300048920 Bacteria 8788
339 Ga0496117_0011273 3300048920 Bacteria 8018
340 Ga0496117_0017225 3300048920 Bacteria 6045
341 Ga0496117_0028900 3300048920 Bacteria 4284
342 Ga0496117_0182797 3300048920 Bacteria 1203
343 Ga0496118_0000633 3300048921 Bacteria 57648
344 Ga0496118_0000671 3300048921 Bacteria 55606
345 Ga0496118_0001546 3300048921 Bacteria 34207
346 Ga0496118_0004296 3300048921 Bacteria 17034
347 Ga0496118_0008814 3300048921 Bacteria 10335
348 Ga0496118_0010419 3300048921 Bacteria 9211
349 Ga0496118_0010793 3300048921 Bacteria 9003
350 Ga0496118_0011278 3300048921 Bacteria 8744
351 Ga0496118_0014792 3300048921 Bacteria 7278
352 Ga0496118_0109229 3300048921 Bacteria 1841
353 Ga0496118_0182206 3300048921 Bacteria 1267
354 Ga0496119_0003119 3300048922 Bacteria 17470
355 Ga0496119_0003491 3300048922 Bacteria 16273
356 Ga0496119_0005390 3300048922 Bacteria 12284
357 Ga0496119_0040989 3300048922 Bacteria 2954
358 Ga0496120_0002343 3300048923 Bacteria 19473
359 Ga0496120_0003217 3300048923 Bacteria 15157
360 Ga0496120_0089170 3300048923 Bacteria 1651
361 Ga0496121_0000119 3300048924 Bacteria 175072
362 Ga0496121_0000645 3300048924 Bacteria 65143
363 Ga0496121_0000956 3300048924 Bacteria 52211
364 Ga0496121_0001818 3300048924 Bacteria 34407
365 Ga0496121_0003583 3300048924 Bacteria 21931
366 Ga0496121_0035141 3300048924 Bacteria 4496
367 Ga0496122_0000056 3300048925 Bacteria 258019
368 Ga0496122_0000131 3300048925 Bacteria 172577
369 Ga0496122_0000963 3300048925 Bacteria 51691
370 Ga0496122_0002448 3300048925 Bacteria 26292
371 Ga0496122_0002710 3300048925 Bacteria 24614
372 Ga0496122_0009483 3300048925 Bacteria 10248
373 Ga0496122_0011047 3300048925 Bacteria 9215
374 Ga0496122_0011357 3300048925 Bacteria 9031
375 Ga0496122_0180667 3300048925 Bacteria 1259
376 Ga0496123_0000041 3300048926 Bacteria 258019
377 Ga0496123_0000098 3300048926 Bacteria 173279
378 Ga0496123_0000208 3300048926 Bacteria 119807
379 Ga0496123_0000608 3300048926 Bacteria 60350
380 Ga0496123_0001663 3300048926 Bacteria 29826
381 Ga0496123_0007160 3300048926 Bacteria 10591
382 Ga0496123_0013261 3300048926 Bacteria 6941
383 Ga0496123_0195720 3300048926 Bacteria 1041
384 Ga0496124_0000010 3300048927 Bacteria 595157
385 Ga0496124_0000168 3300048927 Bacteria 131698
386 Ga0496124_0003315 3300048927 Bacteria 19843
387 Ga0496124_0005775 3300048927 Bacteria 13772
388 Ga0496125_0000100 3300048928 Bacteria 202713
389 Ga0496125_0000113 3300048928 Bacteria 187290
390 Ga0496125_0005719 3300048928 Bacteria 13695
391 Ga0496125_0011330 3300048928 Bacteria 8929
392 Ga0496125_0012837 3300048928 Bacteria 8278
393 Ga0496125_0026175 3300048928 Bacteria 5324
394 Ga0496126_0000605 3300048929 Bacteria 67944
395 Ga0496126_0000880 3300048929 Bacteria 52812
396 Ga0496126_0001486 3300048929 Bacteria 36382
397 Ga0496126_0004854 3300048929 Bacteria 15745
398 Ga0496126_0005105 3300048929 Bacteria 15213
399 Ga0496126_0008071 3300048929 Bacteria 11404
400 Ga0496126_0087072 3300048929 Bacteria 2752
401 Ga0496126_0090278 3300048929 Bacteria 2696
402 Ga0496126_0121712 3300048929 Bacteria 2262
403 Ga0496126_0135977 3300048929 Unclassified 2120
404 Ga0496126_0438370 3300048929 Bacteria 1053
405 Ga0495682_0036929 3300049460 Unclassified 1798
406 Ga0501031_0181124 3300049568 Bacteria 1376
407 Ga0501038_0067356 3300049574 Bacteria 3046
408 Ga0501039_0211459 3300049575 Bacteria 1525
409 nmdc:mga0sz30_1211_c2 3300050516 Bacteria 3340
410 Ga0466962_0059943 3300061719 Bacteria 1816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0577294 Ga0496104_0577294_394_1020 194
2 3300009093 Ga0105240_10025820 Ga0105240_100258202 209
3 3300048921 Ga0496118_0182206 Ga0496118_0182206_432_1064 210
4 3300046558 Ga0495633_0011553 Ga0495633_0011553_2459_3184 211
5 iso_pu_bacteria 2858688981 2858689622 211
6 2162886007 SwRhRL2b_contig_620035 SwRhRL2b_0252.00002790 213
7 3300002737 JGI25162J39368_1000007 JGI25162J39368_1000007298 213
8 3300002771 JGI25163J39215_1000023 JGI25163J39215_100002328 213
9 3300002772 JGI25164J39214_1000010 JGI25164J39214_100001077 213
10 3300002772 JGI25164J39214_1000013 JGI25164J39214_1000013152 213
11 3300003751 Ga0055538_1000006 Ga0055538_1000006298 213
12 3300003752 Ga0055539_1000010 Ga0055539_1000010298 213
13 3300003756 Ga0055533_1000013 Ga0055533_1000013298 213
14 3300003759 Ga0055525_1000015 Ga0055525_1000015298 213
15 3300003841 Ga0055541_1000007 Ga0055541_100000776 213
16 3300005289 Ga0065704_10000419 Ga0065704_1000041937 213
17 3300006946 Ga0079104_1020931 Ga0079104_10209312 213
18 3300009036 Ga0105244_10000275 Ga0105244_1000027527 213
19 3300009092 Ga0105250_10000731 Ga0105250_1000073119 213
20 3300009177 Ga0105248_11286112 Ga0105248_112861121 213
21 3300013102 Ga0157371_10000214 Ga0157371_1000021464 213
22 3300025207 Ga0209760_100135 Ga0209760_10013531 213
23 3300025224 Ga0209784_100022 Ga0209784_10002276 213
24 3300025225 Ga0209566_100021 Ga0209566_10002176 213
25 3300025226 Ga0209674_100038 Ga0209674_10003876 213
26 3300025230 Ga0209563_100042 Ga0209563_10004276 213
27 3300025231 Ga0207427_100027 Ga0207427_10002776 213
28 3300025233 Ga0209437_100049 Ga0209437_10004976 213
29 3300025253 Ga0209677_100025 Ga0209677_10002576 213
30 3300025261 Ga0209233_1001311 Ga0209233_10013114 213
31 3300025711 Ga0207696_1000249 Ga0207696_100024927 213
32 3300025728 Ga0207655_1000471 Ga0207655_100047120 213
33 3300046471 Ga0495650_0000039 Ga0495650_0000039_76573_77259 213
34 3300046810 Ga0495660_0000061 Ga0495660_0000061_59564_60250 213
35 3300048907 Ga0496104_0000075 Ga0496104_0000075_49715_50401 213
36 3300048919 Ga0496116_0000095 Ga0496116_0000095_125722_126408 213
37 3300048920 Ga0496117_0028900 Ga0496117_0028900_3211_3897 213
38 3300048921 Ga0496118_0109229 Ga0496118_0109229_282_968 213
39 3300048922 Ga0496119_0040989 Ga0496119_0040989_138_824 213
40 3300048923 Ga0496120_0089170 Ga0496120_0089170_333_1019 213
41 3300048925 Ga0496122_0000131 Ga0496122_0000131_76576_77262 213
42 3300048926 Ga0496123_0000098 Ga0496123_0000098_95316_96002 213
43 3300048927 Ga0496124_0000168 Ga0496124_0000168_69697_70383 213
44 3300048928 Ga0496125_0000100 Ga0496125_0000100_85626_86312 213
45 3300048929 Ga0496126_0000605 Ga0496126_0000605_36802_37488 213
46 iso_pu_bacteria 2585427591 2585828719 213
47 iso_pu_bacteria 2585427592 2585834149 213
48 iso_pu_bacteria 2667528173 2671109056 213
49 iso_pu_bacteria 2904474040 2904477673 213
50 iso_pu_bacteria 2919150387 2919153620 213
51 iso_pu_bacteria 2927143783 2927147364 213
52 3300046648 Ga0495611_0291473 Ga0495611_0291473_27_695 215
53 3300046794 Ga0495589_0021781 Ga0495589_0021781_31_699 215
54 3300003775 Ga0055524_1002558 Ga0055524_10025584 216
55 3300003794 Ga0055531_10002964 Ga0055531_100029643 216
56 3300025263 Ga0209565_1015037 Ga0209565_10150372 216
57 3300025273 Ga0209673_1003507 Ga0209673_10035075 216
58 3300025291 Ga0209675_1002344 Ga0209675_10023446 216
59 3300025299 Ga0209256_1008380 Ga0209256_10083804 216
60 3300025304 Ga0209257_1002170 Ga0209257_10021704 216
61 3300037312 Ga0395899_0039349 Ga0395899_0039349_1175_1894 216
62 3300015689 Ga0183360_10003 Ga0183360_10003366 218
63 3300048905 Ga0496102_0247341 Ga0496102_0247341_452_1228 218
64 3300048919 Ga0496116_0001407 Ga0496116_0001407_12090_12866 218
65 3300048927 Ga0496124_0003315 Ga0496124_0003315_18909_19607 218
66 iso_pu_bacteria 8055087960 8055091046 218
67 3300048920 Ga0496117_0004764 Ga0496117_0004764_3025_3732 221
68 3300048921 Ga0496118_0004296 Ga0496118_0004296_13303_14010 221
69 iso_pu_bacteria 2576861471 2578459688 221
70 3300048920 Ga0496117_0017225 Ga0496117_0017225_712_1473 222
71 3300048921 Ga0496118_0001546 Ga0496118_0001546_18770_19531 222
72 3300049460 Ga0495682_0036929 Ga0495682_0036929_462_1232 222
73 iso_pu_bacteria 2547132130 2547502220 222
74 iso_pu_bacteria 2547132130 2547502227 222
75 iso_pu_bacteria 2919134579 2919135103 222
76 iso_pu_bacteria 2937610967 2937611108 222
77 iso_pu_bacteria 2961064222 2961065525 222
78 3300037466 Ga0395898_0000241 Ga0395898_0000241_98255_98959 224
79 3300046525 Ga0495663_0000791 Ga0495663_0000791_86_859 224
80 3300046558 Ga0495633_0002518 Ga0495633_0002518_3582_4355 224
81 3300005347 Ga0070668_100025655 Ga0070668_1000256553 225
82 3300025972 Ga0207668_10073579 Ga0207668_100735792 225
83 3300032004 Ga0307414_10000750 Ga0307414_100007505 225
84 3300046558 Ga0495633_0128467 Ga0495633_0128467_254_979 225
85 3300048919 Ga0496116_0188044 Ga0496116_0188044_38_757 225
86 3300048920 Ga0496117_0182797 Ga0496117_0182797_28_747 225
87 3300048921 Ga0496118_0010793 Ga0496118_0010793_2932_3651 225
88 3300048925 Ga0496122_0011047 Ga0496122_0011047_1405_2124 225
89 3300048926 Ga0496123_0007160 Ga0496123_0007160_9535_10254 225
90 3300048927 Ga0496124_0005775 Ga0496124_0005775_7438_8157 225
91 3300048928 Ga0496125_0012837 Ga0496125_0012837_429_1148 225
92 3300006186 Ga0075369_10012594 Ga0075369_100125943 226
93 3300027312 Ga0209371_1029760 Ga0209371_10297601 226
94 3300030500 Ga0268256_1033866 Ga0268256_10338661 226
95 3300031911 Ga0307412_10000325 Ga0307412_1000032514 226
96 3300042533 Ga0450901_000051 Ga0450901_000051_304_1026 226
97 3300046525 Ga0495663_0000182 Ga0495663_0000182_20007_20729 226
98 3300046558 Ga0495633_0001409 Ga0495633_0001409_4368_5090 226
99 3300046558 Ga0495633_0250624 Ga0495633_0250624_35_736 226
100 3300048908 Ga0496105_0006654 Ga0496105_0006654_3019_3741 226
101 3300048920 Ga0496117_0011273 Ga0496117_0011273_7064_7792 226
102 3300048921 Ga0496118_0008814 Ga0496118_0008814_9170_9898 226
103 3300048921 Ga0496118_0011278 Ga0496118_0011278_227_955 226
104 3300048922 Ga0496119_0003119 Ga0496119_0003119_6254_6976 226
105 3300048922 Ga0496119_0005390 Ga0496119_0005390_2019_2750 226
106 3300048923 Ga0496120_0003217 Ga0496120_0003217_5189_5911 226
107 3300048925 Ga0496122_0002710 Ga0496122_0002710_15917_16645 226
108 3300048925 Ga0496122_0011357 Ga0496122_0011357_5291_6013 226
109 3300048925 Ga0496122_0180667 Ga0496122_0180667_337_1059 226
110 3300048926 Ga0496123_0001663 Ga0496123_0001663_21673_22401 226
111 3300048926 Ga0496123_0013261 Ga0496123_0013261_929_1651 226
112 3300048926 Ga0496123_0195720 Ga0496123_0195720_92_820 226
113 3300048928 Ga0496125_0005719 Ga0496125_0005719_950_1678 226
114 3300048928 Ga0496125_0011330 Ga0496125_0011330_3019_3741 226
115 3300048929 Ga0496126_0004854 Ga0496126_0004854_4601_5323 226
116 3300050516 nmdc:mga0sz30_1211_c2 nmdc:mga0sz30_1211_c2_2171_2893 226
117 3300005455 Ga0070663_100007097 Ga0070663_1000070976 227
118 3300005563 Ga0068855_100004605 Ga0068855_1000046056 227
119 3300005842 Ga0068858_100122492 Ga0068858_1001224923 227
120 3300025924 Ga0207694_10020627 Ga0207694_100206272 227
121 3300025949 Ga0207667_10005415 Ga0207667_100054155 227
122 3300026035 Ga0207703_10147194 Ga0207703_101471942 227
123 3300026067 Ga0207678_10014712 Ga0207678_100147122 227
124 3300046680 Ga0495646_0008296 Ga0495646_0008296_1670_2467 227
125 3300047322 Ga0495680_0034652 Ga0495680_0034652_1281_2078 227
126 3300047319 Ga0495674_0030742 Ga0495674_0030742_1786_2514 228
127 3300049568 Ga0501031_0181124 Ga0501031_0181124_610_1350 228
128 3300049574 Ga0501038_0067356 Ga0501038_0067356_2149_2889 228
129 3300049575 Ga0501039_0211459 Ga0501039_0211459_44_784 228
130 3300046512 Ga0495610_0016806 Ga0495610_0016806_2709_3461 229
131 3300048919 Ga0496116_0000440 Ga0496116_0000440_28417_29133 229
132 3300048920 Ga0496117_0000172 Ga0496117_0000172_35823_36539 229
133 3300048921 Ga0496118_0000633 Ga0496118_0000633_27803_28519 229
134 3300048925 Ga0496122_0009483 Ga0496122_0009483_151_885 229
135 3300031824 Ga0307413_10001780 Ga0307413_100017802 230
136 3300048918 Ga0496115_0038435 Ga0496115_0038435_390_1112 230
137 3300005340 Ga0070689_100152475 Ga0070689_1001524752 231
138 3300005344 Ga0070661_100050475 Ga0070661_1000504755 231
139 3300005843 Ga0068860_100069544 Ga0068860_1000695442 231
140 3300009551 Ga0105238_10133012 Ga0105238_101330122 231
141 3300013306 Ga0163162_10491803 Ga0163162_104918031 231
142 3300014969 Ga0157376_10042677 Ga0157376_100426772 231
143 3300025228 Ga0209672_100403 Ga0209672_10040313 231
144 3300025920 Ga0207649_10075636 Ga0207649_100756362 231
145 3300025924 Ga0207694_10035741 Ga0207694_100357413 231
146 3300028380 Ga0268265_10099370 Ga0268265_100993703 231
147 3300028800 Ga0265338_10000022 Ga0265338_10000022121 231
148 3300048917 Ga0496114_0139118 Ga0496114_0139118_1221_1964 231
149 3300048918 Ga0496115_0009863 Ga0496115_0009863_4081_4824 231
150 3300048924 Ga0496121_0035141 Ga0496121_0035141_2137_2880 231
151 3300048929 Ga0496126_0087072 Ga0496126_0087072_1649_2392 231
152 3300048929 Ga0496126_0438370 Ga0496126_0438370_132_875 231
153 iso_pu_bacteria 2739367700 2739733049 232
154 iso_pu_bacteria 2852103415 2852107948 232
155 3300003187 JGI25151J46595_10032987 JGI25151J46595_100329872 233
156 3300003794 Ga0055531_10002086 Ga0055531_100020866 233
157 3300025292 Ga0209676_1001893 Ga0209676_10018934 233
158 3300025294 Ga0209025_1001262 Ga0209025_100126218 233
159 3300025294 Ga0209025_1032150 Ga0209025_10321503 233
160 3300025304 Ga0209257_1001058 Ga0209257_100105814 233
161 3300042007 Ga0439449_0038948 Ga0439449_0038948_486_1226 233
162 3300047447 Ga0495685_006897 Ga0495685_006897_1429_2148 233
163 3300002705 JGI25156J39149_1017169 JGI25156J39149_10171692 235
164 3300005339 Ga0070660_100000022 Ga0070660_10000002248 235
165 3300005366 Ga0070659_100000015 Ga0070659_10000001582 235
166 3300005564 Ga0070664_100503102 Ga0070664_1005031022 235
167 3300009093 Ga0105240_10013149 Ga0105240_100131495 235
168 3300009545 Ga0105237_10119209 Ga0105237_101192092 235
169 3300009551 Ga0105238_10129429 Ga0105238_101294293 235
170 3300010375 Ga0105239_10004936 Ga0105239_100049367 235
171 3300013105 Ga0157369_10009216 Ga0157369_100092166 235
172 3300015261 Ga0182006_1003040 Ga0182006_10030405 235
173 3300025206 Ga0209435_102713 Ga0209435_1027132 235
174 3300025225 Ga0209566_102284 Ga0209566_1022842 235
175 3300025256 Ga0209759_1002102 Ga0209759_10021022 235
176 3300025913 Ga0207695_10007214 Ga0207695_100072148 235
177 3300025919 Ga0207657_10000014 Ga0207657_1000001481 235
178 3300025932 Ga0207690_10000023 Ga0207690_1000002372 235
179 3300044656 Ga0466969_0067971 Ga0466969_0067971_676_1434 235
180 3300046507 Ga0495606_0255943 Ga0495606_0255943_213_950 235
181 3300048921 Ga0496118_0010419 Ga0496118_0010419_6640_7398 235
182 3300002737 JGI25162J39368_1000336 JGI25162J39368_10003363 236
183 3300003322 rootL2_10209754 rootL2_102097546 236
184 3300003762 Ga0055542_1000116 Ga0055542_100011694 236
185 3300013306 Ga0163162_10265869 Ga0163162_102658692 236
186 3300025231 Ga0207427_103093 Ga0207427_1030931 236
187 3300025233 Ga0209437_100271 Ga0209437_10027174 236
188 3300025242 Ga0209258_101780 Ga0209258_1017805 236
189 3300025254 Ga0209148_1000144 Ga0209148_1000144139 236
190 3300025261 Ga0209233_1020099 Ga0209233_10200993 236
191 3300025936 Ga0207670_10002413 Ga0207670_100024134 236
192 3300046557 Ga0495622_0049277 Ga0495622_0049277_978_1718 236
193 3300046660 Ga0495625_0082626 Ga0495625_0082626_30_770 236
194 3300046694 Ga0495649_0008923 Ga0495649_0008923_3609_4349 236
195 3300048918 Ga0496115_0001433 Ga0496115_0001433_6191_6931 236
196 3300048929 Ga0496126_0008071 Ga0496126_0008071_4302_5042 236
197 3300048929 Ga0496126_0135977 Ga0496126_0135977_1216_1956 236
198 iso_pu_bacteria 2513237150 2513956066 236
199 iso_pu_bacteria 2513237165 2514040560 236
200 iso_pu_bacteria 2919456309 2919462326 236
201 iso_pu_bacteria 644736347 644751825 236
202 3300015265 Ga0182005_1000727 Ga0182005_10007274 237
203 3300045976 Ga0466967_0022968 Ga0466967_0022968_2273_3028 237
204 3300009093 Ga0105240_10275944 Ga0105240_102759442 238
205 3300015265 Ga0182005_1001008 Ga0182005_10010087 238
206 3300015265 Ga0182005_1001204 Ga0182005_10012043 238
207 3300025909 Ga0207705_10281241 Ga0207705_102812412 238
208 3300025913 Ga0207695_10156503 Ga0207695_101565032 238
209 3300045049 Ga0466959_0490207 Ga0466959_0490207_12_815 238
210 iso_pu_bacteria 2501025501 2501071445 238
211 iso_pu_bacteria 2501025504 2501410808 238
212 iso_pu_bacteria 2510917014 2511096734 238
213 iso_pu_bacteria 2510917015 2511102638 238
214 iso_pu_bacteria 2751185846 2753565721 238
215 3300003758 Ga0055532_1000442 Ga0055532_100044210 239
216 3300017792 Ga0163161_10010729 Ga0163161_100107292 239
217 3300025228 Ga0209672_111161 Ga0209672_1111612 239
218 3300025229 Ga0209147_100251 Ga0209147_10025113 239
219 3300046529 Ga0495652_0001577 Ga0495652_0001577_18501_19247 239
220 3300046680 Ga0495646_0001272 Ga0495646_0001272_6945_7691 239
221 3300046690 Ga0495624_0049725 Ga0495624_0049725_975_1721 239
222 iso_pu_bacteria 2941489479 2941491364 239
223 3300006948 Ga0099826_10000009 Ga0099826_10000009221 240
224 3300009545 Ga0105237_10016868 Ga0105237_100168685 240
225 3300025914 Ga0207671_10012481 Ga0207671_100124814 240
226 3300027666 Ga0209282_1000017 Ga0209282_1000017127 240
227 3300044693 Ga0466961_0009502 Ga0466961_0009502_66_815 240
228 3300044719 Ga0466971_0001437 Ga0466971_0001437_3479_4228 240
229 3300046501 Ga0495607_0004714 Ga0495607_0004714_8110_8853 240
230 3300046512 Ga0495610_0001052 Ga0495610_0001052_14112_14852 240
231 3300047446 Ga0495679_000756 Ga0495679_000756_15086_15826 240
232 3300061719 Ga0466962_0059943 Ga0466962_0059943_757_1506 240
233 iso_pu_bacteria 2585427591 2585829307 240
234 iso_pu_bacteria 2585427592 2585834601 240
235 iso_pu_bacteria 2599185239 2599736394 240
236 iso_pu_bacteria 2667528173 2671106189 240
237 iso_pu_bacteria 2791355137 2792835324 240
238 iso_pu_bacteria 2808606384 2808968005 240
239 iso_pu_bacteria 2808606390 2809002836 240
240 iso_pu_bacteria 2808606391 2809010114 240
241 iso_pu_bacteria 2818991452 2819634211 240
242 iso_pu_bacteria 2904474040 2904474673 240
243 iso_pu_bacteria 2919150387 2919151019 240
244 iso_pu_bacteria 2919456309 2919461185 240
245 iso_pu_bacteria 2927143783 2927145893 240
246 iso_pu_bacteria 2928170801 2928171190 240
247 iso_pu_bacteria 2995948881 2995954024 240
248 iso_pu_bacteria 8018845410 8018849297 240
249 iso_pu_bacteria 8021120328 8021123325 240
250 3300003752 Ga0055539_1000511 Ga0055539_100051110 241
251 3300003756 Ga0055533_1001152 Ga0055533_10011524 241
252 3300003760 Ga0055527_1000051 Ga0055527_100005114 241
253 3300003760 Ga0055527_1000095 Ga0055527_100009517 241
254 3300003761 Ga0055535_1000091 Ga0055535_100009114 241
255 3300003762 Ga0055542_1000124 Ga0055542_100012463 241
256 3300003763 Ga0055529_1000147 Ga0055529_100014763 241
257 3300003763 Ga0055529_1000541 Ga0055529_100054113 241
258 3300005614 Ga0068856_100002368 Ga0068856_10000236810 241
259 3300009011 Ga0105251_10057240 Ga0105251_100572402 241
260 3300013104 Ga0157370_10401971 Ga0157370_104019711 241
261 3300025226 Ga0209674_100107 Ga0209674_10010745 241
262 3300025228 Ga0209672_100016 Ga0209672_10001616 241
263 3300025242 Ga0209258_100012 Ga0209258_100012157 241
264 3300025254 Ga0209148_1000014 Ga0209148_1000014498 241
265 3300025272 Ga0209455_1000014 Ga0209455_1000014386 241
266 3300031251 Ga0265327_10001016 Ga0265327_100010163 241
267 3300046474 Ga0495605_0002167 Ga0495605_0002167_10638_11381 241
268 3300046500 Ga0495596_0000555 Ga0495596_0000555_17446_18189 241
269 3300046501 Ga0495607_0012686 Ga0495607_0012686_4430_5173 241
270 3300046507 Ga0495606_0001592 Ga0495606_0001592_18045_18806 241
271 3300046512 Ga0495610_0000337 Ga0495610_0000337_32689_33432 241
272 3300046513 Ga0495616_0000563 Ga0495616_0000563_16139_16882 241
273 3300046524 Ga0495648_0012851 Ga0495648_0012851_1292_2035 241
274 3300046528 Ga0495642_0125931 Ga0495642_0125931_318_1061 241
275 3300046538 Ga0495609_0000781 Ga0495609_0000781_7232_7975 241
276 3300046542 Ga0495597_0064063 Ga0495597_0064063_636_1379 241
277 3300046615 Ga0495656_0020474 Ga0495656_0020474_1488_2231 241
278 3300046660 Ga0495625_0330774 Ga0495625_0330774_153_896 241
279 3300046665 Ga0495661_0013086 Ga0495661_0013086_3839_4582 241
280 3300046692 Ga0495671_0000373 Ga0495671_0000373_32809_33552 241
281 3300046694 Ga0495649_0004836 Ga0495649_0004836_1069_1812 241
282 3300047320 Ga0495672_0012594 Ga0495672_0012594_5068_5811 241
283 3300048924 Ga0496121_0000119 Ga0496121_0000119_52853_53623 241
284 3300048924 Ga0496121_0003583 Ga0496121_0003583_809_1552 241
285 3300048925 Ga0496122_0002448 Ga0496122_0002448_7392_8135 241
286 3300048926 Ga0496123_0000208 Ga0496123_0000208_96000_96743 241
287 3300048929 Ga0496126_0121712 Ga0496126_0121712_45_788 241
288 3300003322 rootL2_10047525 rootL2_100475252 242
289 3300003758 Ga0055532_1000628 Ga0055532_10006287 242
290 3300003760 Ga0055527_1000338 Ga0055527_10003384 242
291 3300003761 Ga0055535_1001138 Ga0055535_10011382 242
292 3300003761 Ga0055535_1001682 Ga0055535_10016828 242
293 3300003762 Ga0055542_1000193 Ga0055542_100019344 242
294 3300003762 Ga0055542_1000878 Ga0055542_100087825 242
295 3300003763 Ga0055529_1001121 Ga0055529_100112113 242
296 3300005335 Ga0070666_10063879 Ga0070666_100638792 242
297 3300006948 Ga0099826_10000004 Ga0099826_10000004205 242
298 3300009093 Ga0105240_10002352 Ga0105240_100023527 242
299 3300013306 Ga0163162_10017627 Ga0163162_100176273 242
300 3300014969 Ga0157376_10236596 Ga0157376_102365962 242
301 3300015265 Ga0182005_1001199 Ga0182005_10011993 242
302 3300015683 Ga0183362_10001 Ga0183362_10001401 242
303 3300017792 Ga0163161_10022017 Ga0163161_100220172 242
304 3300025225 Ga0209566_100187 Ga0209566_10018726 242
305 3300025226 Ga0209674_101019 Ga0209674_1010192 242
306 3300025228 Ga0209672_100005 Ga0209672_100005348 242
307 3300025228 Ga0209672_101123 Ga0209672_1011238 242
308 3300025229 Ga0209147_100116 Ga0209147_10011622 242
309 3300025242 Ga0209258_100006 Ga0209258_100006348 242
310 3300025242 Ga0209258_100104 Ga0209258_100104141 242
311 3300025254 Ga0209148_1000012 Ga0209148_1000012348 242
312 3300025254 Ga0209148_1000106 Ga0209148_1000106142 242
313 3300025272 Ga0209455_1000008 Ga0209455_1000008348 242
314 3300025272 Ga0209455_1003862 Ga0209455_10038624 242
315 3300025903 Ga0207680_10057109 Ga0207680_100571092 242
316 3300025913 Ga0207695_10000527 Ga0207695_1000052733 242
317 3300025940 Ga0207691_10228134 Ga0207691_102281342 242
318 3300027666 Ga0209282_1000035 Ga0209282_1000035104 242
319 3300044683 Ga0466965_0004705 Ga0466965_0004705_403_1269 242
320 3300044694 Ga0466963_0057292 Ga0466963_0057292_1645_2424 242
321 3300044842 Ga0466957_0016854 Ga0466957_0016854_570_1361 242
322 3300045836 Ga0466958_0002069 Ga0466958_0002069_1038_1880 242
323 3300045836 Ga0466958_0016263 Ga0466958_0016263_1672_2463 242
324 3300046454 Ga0495592_0142272 Ga0495592_0142272_80_841 242
325 3300046459 Ga0495629_0000518 Ga0495629_0000518_18073_18834 242
326 3300046463 Ga0495653_0001810 Ga0495653_0001810_9148_9909 242
327 3300046463 Ga0495653_0014585 Ga0495653_0014585_3745_4542 242
328 3300046472 Ga0495580_0000907 Ga0495580_0000907_6921_7682 242
329 3300046473 Ga0495582_0001638 Ga0495582_0001638_2689_3450 242
330 3300046474 Ga0495605_0000547 Ga0495605_0000547_3085_3840 242
331 3300046475 Ga0495639_0008276 Ga0495639_0008276_98_847 242
332 3300046477 Ga0495664_0065158 Ga0495664_0065158_248_1009 242
333 3300046500 Ga0495596_0000024 Ga0495596_0000024_11476_12231 242
334 3300046501 Ga0495607_0002813 Ga0495607_0002813_8105_8860 242
335 3300046512 Ga0495610_0000399 Ga0495610_0000399_9379_10134 242
336 3300046513 Ga0495616_0000859 Ga0495616_0000859_9226_9981 242
337 3300046514 Ga0495618_0010505 Ga0495618_0010505_4386_5147 242
338 3300046516 Ga0495628_0005016 Ga0495628_0005016_9096_9857 242
339 3300046518 Ga0495631_0057484 Ga0495631_0057484_755_1510 242
340 3300046524 Ga0495648_0015455 Ga0495648_0015455_3935_4693 242
341 3300046524 Ga0495648_0023655 Ga0495648_0023655_595_1350 242
342 3300046526 Ga0495666_0004879 Ga0495666_0004879_832_1593 242
343 3300046528 Ga0495642_0084509 Ga0495642_0084509_172_945 242
344 3300046529 Ga0495652_0009914 Ga0495652_0009914_7045_7806 242
345 3300046533 Ga0495640_0094883 Ga0495640_0094883_832_1593 242
346 3300046535 Ga0495586_0002433 Ga0495586_0002433_8146_8907 242
347 3300046536 Ga0495587_0000735 Ga0495587_0000735_6995_7756 242
348 3300046538 Ga0495609_0000513 Ga0495609_0000513_9016_9771 242
349 3300046542 Ga0495597_0031434 Ga0495597_0031434_747_1502 242
350 3300046557 Ga0495622_0000369 Ga0495622_0000369_25527_26285 242
351 3300046642 Ga0495634_0006477 Ga0495634_0006477_1188_1949 242
352 3300046663 Ga0495635_0009273 Ga0495635_0009273_1221_1982 242
353 3300046665 Ga0495661_0000801 Ga0495661_0000801_2939_3694 242
354 3300046665 Ga0495661_0002255 Ga0495661_0002255_11335_12096 242
355 3300046674 Ga0495588_0035708 Ga0495588_0035708_1097_1858 242
356 3300046679 Ga0495623_0041996 Ga0495623_0041996_1111_1872 242
357 3300046680 Ga0495646_0063943 Ga0495646_0063943_1188_1949 242
358 3300046689 Ga0495613_0074756 Ga0495613_0074756_534_1295 242
359 3300046692 Ga0495671_0001541 Ga0495671_0001541_9207_9962 242
360 3300046694 Ga0495649_0006209 Ga0495649_0006209_6280_7035 242
361 3300046809 Ga0495600_0102916 Ga0495600_0102916_715_1476 242
362 3300047315 Ga0495581_0035571 Ga0495581_0035571_533_1294 242
363 3300047317 Ga0495604_0005319 Ga0495604_0005319_7033_7794 242
364 3300047318 Ga0495636_0004549 Ga0495636_0004549_2816_3586 242
365 3300047319 Ga0495674_0051790 Ga0495674_0051790_1078_1839 242
366 3300047320 Ga0495672_0007776 Ga0495672_0007776_5562_6317 242
367 3300047322 Ga0495680_0099320 Ga0495680_0099320_1198_1959 242
368 3300047444 Ga0495675_0087183 Ga0495675_0087183_671_1432 242
369 3300047447 Ga0495685_000362 Ga0495685_000362_11745_12500 242
370 3300047470 Ga0495681_0128905 Ga0495681_0128905_65_826 242
371 3300047471 Ga0495684_0010489 Ga0495684_0010489_4063_4824 242
372 3300047673 Ga0495593_0000661 Ga0495593_0000661_5092_5853 242
373 3300048088 Ga0495602_0095889 Ga0495602_0095889_1188_1949 242
374 3300048903 Ga0496100_0021425 Ga0496100_0021425_2987_3757 242
375 3300048905 Ga0496102_0002452 Ga0496102_0002452_11046_11816 242
376 3300048905 Ga0496102_0006332 Ga0496102_0006332_6948_7709 242
377 3300048906 Ga0496103_0008069 Ga0496103_0008069_4019_4780 242
378 3300048906 Ga0496103_0020672 Ga0496103_0020672_3109_3879 242
379 3300048907 Ga0496104_0020479 Ga0496104_0020479_1164_1934 242
380 3300048908 Ga0496105_0002217 Ga0496105_0002217_8611_9381 242
381 3300048911 Ga0496108_0252791 Ga0496108_0252791_730_1500 242
382 3300048912 Ga0496109_0082262 Ga0496109_0082262_1688_2458 242
383 3300048913 Ga0496110_0007166 Ga0496110_0007166_4095_4865 242
384 3300048914 Ga0496111_0101386 Ga0496111_0101386_1312_2082 242
385 3300048916 Ga0496113_0176635 Ga0496113_0176635_892_1662 242
386 3300048919 Ga0496116_0001895 Ga0496116_0001895_9183_9938 242
387 3300048919 Ga0496116_0190991 Ga0496116_0190991_150_944 242
388 3300048920 Ga0496117_0005047 Ga0496117_0005047_12838_13599 242
389 3300048920 Ga0496117_0009875 Ga0496117_0009875_6043_6822 242
390 3300048921 Ga0496118_0000671 Ga0496118_0000671_40737_41498 242
391 3300048924 Ga0496121_0000645 Ga0496121_0000645_7086_7859 242
392 3300048924 Ga0496121_0000956 Ga0496121_0000956_12461_13234 242
393 3300048924 Ga0496121_0001818 Ga0496121_0001818_24299_25054 242
394 3300048925 Ga0496122_0000963 Ga0496122_0000963_41909_42664 242
395 3300048926 Ga0496123_0000608 Ga0496123_0000608_50325_51080 242
396 3300048928 Ga0496125_0026175 Ga0496125_0026175_772_1527 242
397 3300048929 Ga0496126_0000880 Ga0496126_0000880_48690_49463 242
398 3300048929 Ga0496126_0005105 Ga0496126_0005105_849_1622 242
399 3300048929 Ga0496126_0090278 Ga0496126_0090278_380_1135 242
400 3300025226 Ga0209674_100504 Ga0209674_10050414 243
401 2162886007 SwRhRL2b_contig_1740182 SwRhRL2b_0863.00004400 244
402 3300002737 JGI25162J39368_1000003 JGI25162J39368_100000350 244
403 3300002771 JGI25163J39215_1000012 JGI25163J39215_100001251 244
404 3300002772 JGI25164J39214_1000009 JGI25164J39214_1000009241 244
405 3300003751 Ga0055538_1000005 Ga0055538_100000550 244
406 3300003752 Ga0055539_1000007 Ga0055539_100000750 244
407 3300003756 Ga0055533_1000009 Ga0055533_100000950 244
408 3300003759 Ga0055525_1000010 Ga0055525_100001050 244
409 3300003841 Ga0055541_1000005 Ga0055541_1000005514 244
410 3300005289 Ga0065704_10000639 Ga0065704_100006399 244
411 3300005339 Ga0070660_100000416 Ga0070660_1000004164 244
412 3300005366 Ga0070659_100004374 Ga0070659_1000043745 244
413 3300005455 Ga0070663_100000950 Ga0070663_1000009503 244
414 3300009036 Ga0105244_10000840 Ga0105244_1000084014 244
415 3300009092 Ga0105250_10001095 Ga0105250_100010959 244
416 3300009551 Ga0105238_10002287 Ga0105238_100022874 244
417 3300010375 Ga0105239_10001809 Ga0105239_100018094 244
418 3300013102 Ga0157371_10000007 Ga0157371_1000000713 244
419 3300013104 Ga0157370_10004459 Ga0157370_100044592 244
420 3300013105 Ga0157369_10001560 Ga0157369_100015604 244
421 3300013306 Ga0163162_10089167 Ga0163162_100891672 244
422 3300025207 Ga0209760_100029 Ga0209760_10002966 244
423 3300025224 Ga0209784_100001 Ga0209784_100001594 244
424 3300025225 Ga0209566_100001 Ga0209566_100001594 244
425 3300025226 Ga0209674_100002 Ga0209674_100002594 244
426 3300025226 Ga0209674_100059 Ga0209674_100059120 244
427 3300025230 Ga0209563_100008 Ga0209563_100008598 244
428 3300025231 Ga0207427_100002 Ga0207427_100002682 244
429 3300025233 Ga0209437_100007 Ga0209437_10000750 244
430 3300025253 Ga0209677_100004 Ga0209677_100004598 244
431 3300025253 Ga0209677_100863 Ga0209677_10086313 244
432 3300025711 Ga0207696_1000273 Ga0207696_100027342 244
433 3300025728 Ga0207655_1000521 Ga0207655_10005218 244
434 3300025913 Ga0207695_10188967 Ga0207695_101889672 244
435 3300025919 Ga0207657_10001134 Ga0207657_1000113425 244
436 3300025924 Ga0207694_10002333 Ga0207694_100023339 244
437 3300025932 Ga0207690_10000152 Ga0207690_100001524 244
438 3300026067 Ga0207678_10000757 Ga0207678_1000075719 244
439 3300042532 Ga0450893_0005917 Ga0450893_0005917_382_1116 244
440 3300046471 Ga0495650_0000004 Ga0495650_0000004_702794_703528 244
441 3300046519 Ga0495632_0119611 Ga0495632_0119611_312_1046 244
442 3300046810 Ga0495660_0000062 Ga0495660_0000062_49804_50538 244
443 3300048907 Ga0496104_0014092 Ga0496104_0014092_5136_5870 244
444 3300048919 Ga0496116_0001115 Ga0496116_0001115_16285_17019 244
445 3300048920 Ga0496117_0004829 Ga0496117_0004829_6317_7051 244
446 3300048921 Ga0496118_0014792 Ga0496118_0014792_5753_6487 244
447 3300048922 Ga0496119_0003491 Ga0496119_0003491_9237_9971 244
448 3300048923 Ga0496120_0002343 Ga0496120_0002343_8308_9042 244
449 3300048925 Ga0496122_0000056 Ga0496122_0000056_171046_171780 244
450 3300048926 Ga0496123_0000041 Ga0496123_0000041_171046_171780 244
451 3300048927 Ga0496124_0000010 Ga0496124_0000010_399871_400605 244
452 3300048928 Ga0496125_0000113 Ga0496125_0000113_171405_172139 244
453 3300048929 Ga0496126_0001486 Ga0496126_0001486_6303_7037 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00345

PapD_N

Pili and flagellar-assembly chaperone, PapD N-terminal domain

50

174

0.97

PF02753

PapD_C

Pili assembly chaperone PapD, C-terminal domain

199

264

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ghu-assembly1.cif.gz_A crystal structure of yadv chaperone at 1.63 angstrom 0.956 26 244
3q48-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa cupb2 chaperone 0.9556 29 244
3q48-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa cupb2 chaperone 0.9551 29 244
5ghu-assembly1.cif.gz_A crystal structure of yadv chaperone at 1.63 angstrom 0.9514 26 244
3q48-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa cupb2 chaperone 0.9501 29 244
ID Description Score Start End Superfamily
af_P33342_35_154_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9692 29 146 2.60.40.10
3q48B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9687 29 150 2.60.40.10
3q48B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9598 29 150 2.60.40.10
af_P33128_27_148_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.946 29 146 2.60.40.10
af_P33342_35_154_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9458 29 146 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7G2K0J0-F1-model_v4 Gram-negative pili assembly chaperone domain protein 0.968 29 112 GO:0030288
GO:0061077
GO:0071555
AF-D4BKI2-F1-model_v4 Gram-negative pili assembly chaperone domain protein 0.9639 24 244 GO:0030288
GO:0061077
GO:0071555
AF-A0A376TLW2-F1-model_v4 Chaperone protein EcpD 0.9625 176 244
AF-D8AA32-F1-model_v4 deleted 0.9613 24 244
AF-A0A0D7LPM0-F1-model_v4 deleted 0.9608 24 243

Feature Viewer

pLDDT pTM Quality
88.22 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map