F446001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 237 | 447 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300044706|Ga0466964_0017932|Ga0466964_0017932_1548_2642 |
| Length | 364 |
| Sequence | LTRIVPYSAIAVSVARRDLVEERLVEPWSREAVGRFEELEIESAALRDNPLGDPHVRPLWVYLPPAYDAEPERRFPSIYLIQGMTGQLDMWRNRTAFRPSVPELIDRLFAEEDCPPALVVAVDAWTSYGGSQFIDSPGTGRYGEYLCDEVVSFVDSRYRTLAEAAHRGLTGKSSGGYGAMVVPMLRPDVFGGLATHSGDALFELCYLPDFRDTARALRDEYDGSYERFWEDFRSRPSFTKQSDFPLVNTWAMAACYSANEDGSVDLPFDSDTGRLRDDVWQRWLAWDPVRMARRHADALRSQRAIYIDAGKRDEFFLDLGAEAFRRELEALGITDVFFELFDAKHGGIEYRYPLAIRYLAERLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 100 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 107 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 120 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 127 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 134 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 135 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 16.33 |
| Rhizosphere | 83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10096065 | 3300003316 | Bacteria | 2782 |
| 2 | rootL2_10127790 | 3300003322 | Bacteria | 1201 |
| 3 | Ga0070658_10042160 | 3300005327 | Bacteria | 3684 |
| 4 | Ga0070658_10089617 | 3300005327 | Bacteria | 2533 |
| 5 | Ga0070683_100022954 | 3300005329 | Bacteria | 5578 |
| 6 | Ga0070683_100073626 | 3300005329 | Bacteria | 3189 |
| 7 | Ga0070683_100388014 | 3300005329 | Bacteria | 1331 |
| 8 | Ga0070680_100123353 | 3300005336 | Bacteria | 2163 |
| 9 | Ga0070680_100161906 | 3300005336 | Bacteria | 1881 |
| 10 | Ga0070660_100075320 | 3300005339 | Bacteria | 2642 |
| 11 | Ga0070671_100124090 | 3300005355 | Bacteria | 2174 |
| 12 | Ga0070659_100161739 | 3300005366 | Bacteria | 1831 |
| 13 | Ga0070703_10000008 | 3300005406 | Bacteria | 97684 |
| 14 | Ga0070714_100012027 | 3300005435 | Bacteria | 6887 |
| 15 | Ga0070714_100094292 | 3300005435 | Bacteria | 2627 |
| 16 | Ga0070714_100297544 | 3300005435 | Bacteria | 1503 |
| 17 | Ga0070714_100447322 | 3300005435 | Bacteria | 1227 |
| 18 | Ga0070713_100006517 | 3300005436 | Bacteria | 8104 |
| 19 | Ga0070710_10001658 | 3300005437 | Bacteria | 10488 |
| 20 | Ga0070710_10056248 | 3300005437 | Bacteria | 2226 |
| 21 | Ga0070710_10091005 | 3300005437 | Bacteria | 1799 |
| 22 | Ga0070711_100025670 | 3300005439 | Bacteria | 3856 |
| 23 | Ga0070711_100228268 | 3300005439 | Bacteria | 1451 |
| 24 | Ga0070700_100028625 | 3300005441 | Bacteria | 3316 |
| 25 | Ga0070694_100257740 | 3300005444 | Bacteria | 1322 |
| 26 | Ga0070708_100000744 | 3300005445 | Bacteria | 24674 |
| 27 | Ga0070708_100001702 | 3300005445 | Bacteria | 16911 |
| 28 | Ga0070708_100031902 | 3300005445 | Bacteria | 4565 |
| 29 | Ga0070681_10081146 | 3300005458 | Bacteria | 3199 |
| 30 | Ga0070681_10122195 | 3300005458 | Bacteria | 2537 |
| 31 | Ga0068867_100104089 | 3300005459 | Bacteria | 2172 |
| 32 | Ga0070706_100000040 | 3300005467 | Bacteria | 149660 |
| 33 | Ga0070706_100001299 | 3300005467 | Bacteria | 26652 |
| 34 | Ga0070706_100010197 | 3300005467 | Bacteria | 8738 |
| 35 | Ga0070706_100018906 | 3300005467 | Bacteria | 6355 |
| 36 | Ga0070707_100000419 | 3300005468 | Bacteria | 41972 |
| 37 | Ga0070707_100002016 | 3300005468 | Bacteria | 19446 |
| 38 | Ga0070707_100006897 | 3300005468 | Bacteria | 10518 |
| 39 | Ga0070707_100011334 | 3300005468 | Bacteria | 8309 |
| 40 | Ga0070707_100014906 | 3300005468 | Bacteria | 7291 |
| 41 | Ga0070698_100001180 | 3300005471 | Bacteria | 29004 |
| 42 | Ga0070698_100007227 | 3300005471 | Bacteria | 12031 |
| 43 | Ga0070698_100041571 | 3300005471 | Bacteria | 4719 |
| 44 | Ga0070698_100239037 | 3300005471 | Bacteria | 1749 |
| 45 | Ga0070699_100000382 | 3300005518 | Bacteria | 43058 |
| 46 | Ga0070679_100199332 | 3300005530 | Bacteria | 1968 |
| 47 | Ga0070695_100000704 | 3300005545 | Bacteria | 17855 |
| 48 | Ga0070693_100104138 | 3300005547 | Bacteria | 1734 |
| 49 | Ga0068855_100051840 | 3300005563 | Bacteria | 4833 |
| 50 | Ga0068855_100256517 | 3300005563 | Bacteria | 1949 |
| 51 | Ga0070664_100063340 | 3300005564 | Bacteria | 3153 |
| 52 | Ga0070664_100217687 | 3300005564 | Bacteria | 1708 |
| 53 | Ga0068857_100000499 | 3300005577 | Bacteria | 28113 |
| 54 | Ga0068852_100157545 | 3300005616 | Bacteria | 2117 |
| 55 | Ga0068863_100289923 | 3300005841 | Bacteria | 1586 |
| 56 | Ga0081455_10003895 | 3300005937 | Bacteria | 16994 |
| 57 | Ga0081455_10018077 | 3300005937 | Bacteria | 6731 |
| 58 | Ga0081455_10137224 | 3300005937 | Bacteria | 1904 |
| 59 | Ga0081538_10000014 | 3300005981 | Bacteria | 151008 |
| 60 | Ga0081539_10001492 | 3300005985 | Bacteria | 39584 |
| 61 | Ga0070717_10000229 | 3300006028 | Bacteria | 38720 |
| 62 | Ga0070717_10003918 | 3300006028 | Bacteria | 10714 |
| 63 | Ga0070717_10014893 | 3300006028 | Bacteria | 5987 |
| 64 | Ga0070717_10068242 | 3300006028 | Bacteria | 2959 |
| 65 | Ga0070717_10122463 | 3300006028 | Bacteria | 2229 |
| 66 | Ga0070717_10274415 | 3300006028 | Bacteria | 1494 |
| 67 | Ga0070715_10049201 | 3300006163 | Bacteria | 1805 |
| 68 | Ga0070716_100064175 | 3300006173 | Bacteria | 2134 |
| 69 | Ga0097621_100205165 | 3300006237 | Bacteria | 1712 |
| 70 | Ga0068871_100171479 | 3300006358 | Bacteria | 1860 |
| 71 | Ga0075431_100287783 | 3300006847 | Bacteria | 1663 |
| 72 | Ga0075434_100250152 | 3300006871 | Bacteria | 1792 |
| 73 | Ga0075434_100345130 | 3300006871 | Unclassified | 1510 |
| 74 | Ga0075429_100019048 | 3300006880 | Bacteria | 5946 |
| 75 | Ga0105240_10019956 | 3300009093 | Bacteria | 8949 |
| 76 | Ga0105240_10047194 | 3300009093 | Bacteria | 5452 |
| 77 | Ga0111539_10009131 | 3300009094 | Bacteria | 12545 |
| 78 | Ga0111539_10040195 | 3300009094 | Bacteria | 5632 |
| 79 | Ga0105245_10014534 | 3300009098 | Bacteria | 6855 |
| 80 | Ga0105245_10083947 | 3300009098 | Bacteria | 2916 |
| 81 | Ga0105245_10120739 | 3300009098 | Bacteria | 2448 |
| 82 | Ga0114129_10006697 | 3300009147 | Bacteria | 16362 |
| 83 | Ga0105242_10063935 | 3300009176 | Bacteria | 3031 |
| 84 | Ga0105248_10319696 | 3300009177 | Bacteria | 1748 |
| 85 | Ga0105248_10543583 | 3300009177 | Bacteria | 1310 |
| 86 | Ga0105237_10044267 | 3300009545 | Bacteria | 4482 |
| 87 | Ga0105237_10252923 | 3300009545 | Bacteria | 1764 |
| 88 | Ga0105239_10555591 | 3300010375 | Bacteria | 1308 |
| 89 | Ga0157370_10022132 | 3300013104 | Bacteria | 6327 |
| 90 | Ga0157370_10207895 | 3300013104 | Bacteria | 1814 |
| 91 | Ga0157369_10017623 | 3300013105 | Bacteria | 8028 |
| 92 | Ga0157369_10051559 | 3300013105 | Bacteria | 4453 |
| 93 | Ga0157369_10056506 | 3300013105 | Bacteria | 4235 |
| 94 | Ga0157374_10062900 | 3300013296 | Bacteria | 3480 |
| 95 | Ga0163162_10225048 | 3300013306 | Bacteria | 2006 |
| 96 | Ga0157372_10353972 | 3300013307 | Bacteria | 1711 |
| 97 | Ga0157375_10101127 | 3300013308 | Bacteria | 2965 |
| 98 | Ga0157377_10106473 | 3300014745 | Bacteria | 1679 |
| 99 | Ga0157376_10083023 | 3300014969 | Bacteria | 2755 |
| 100 | Ga0197907_11120046 | 3300020069 | Bacteria | 2254 |
| 101 | Ga0206356_10055071 | 3300020070 | Bacteria | 3692 |
| 102 | Ga0206354_11240619 | 3300020081 | Bacteria | 1424 |
| 103 | Ga0206353_10334546 | 3300020082 | Bacteria | 2573 |
| 104 | Ga0206353_10532889 | 3300020082 | Bacteria | 1963 |
| 105 | Ga0207653_10000003 | 3300025885 | Bacteria | 268014 |
| 106 | Ga0207692_10023830 | 3300025898 | Bacteria | 2837 |
| 107 | Ga0207710_10054322 | 3300025900 | Bacteria | 1803 |
| 108 | Ga0207699_10086550 | 3300025906 | Bacteria | 1957 |
| 109 | Ga0207705_10014407 | 3300025909 | Bacteria | 5690 |
| 110 | Ga0207705_10126181 | 3300025909 | Bacteria | 1902 |
| 111 | Ga0207705_10204308 | 3300025909 | Bacteria | 1497 |
| 112 | Ga0207684_10000012 | 3300025910 | Bacteria | 478666 |
| 113 | Ga0207684_10000025 | 3300025910 | Bacteria | 316760 |
| 114 | Ga0207684_10005330 | 3300025910 | Bacteria | 11890 |
| 115 | Ga0207684_10035863 | 3300025910 | Bacteria | 4209 |
| 116 | Ga0207684_10467817 | 3300025910 | Bacteria | 1082 |
| 117 | Ga0207707_10137398 | 3300025912 | Bacteria | 2137 |
| 118 | Ga0207707_10199966 | 3300025912 | Bacteria | 1742 |
| 119 | Ga0207707_10220403 | 3300025912 | Bacteria | 1651 |
| 120 | Ga0207671_10096966 | 3300025914 | Bacteria | 2229 |
| 121 | Ga0207693_10004494 | 3300025915 | Bacteria | 11799 |
| 122 | Ga0207693_10006840 | 3300025915 | Bacteria | 9419 |
| 123 | Ga0207663_10023662 | 3300025916 | Bacteria | 3529 |
| 124 | Ga0207660_10009617 | 3300025917 | Bacteria | 6258 |
| 125 | Ga0207660_10098185 | 3300025917 | Bacteria | 2184 |
| 126 | Ga0207657_10002568 | 3300025919 | Bacteria | 19643 |
| 127 | Ga0207657_10122149 | 3300025919 | Bacteria | 2142 |
| 128 | Ga0207657_10123908 | 3300025919 | Bacteria | 2124 |
| 129 | Ga0207657_10166159 | 3300025919 | Bacteria | 1790 |
| 130 | Ga0207652_10011628 | 3300025921 | Bacteria | 7100 |
| 131 | Ga0207652_10089594 | 3300025921 | Bacteria | 2701 |
| 132 | Ga0207652_10115016 | 3300025921 | Bacteria | 2389 |
| 133 | Ga0207652_10183366 | 3300025921 | Bacteria | 1882 |
| 134 | Ga0207646_10002945 | 3300025922 | Bacteria | 19734 |
| 135 | Ga0207646_10003186 | 3300025922 | Bacteria | 18746 |
| 136 | Ga0207646_10006253 | 3300025922 | Bacteria | 12358 |
| 137 | Ga0207646_10024974 | 3300025922 | Bacteria | 5468 |
| 138 | Ga0207694_10195065 | 3300025924 | Bacteria | 1646 |
| 139 | Ga0207687_10009338 | 3300025927 | Bacteria | 6413 |
| 140 | Ga0207687_10009952 | 3300025927 | Bacteria | 6224 |
| 141 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 142 | Ga0207664_10113794 | 3300025929 | Bacteria | 2254 |
| 143 | Ga0207664_10160633 | 3300025929 | Bacteria | 1916 |
| 144 | Ga0207664_10209182 | 3300025929 | Bacteria | 1687 |
| 145 | Ga0207690_10013051 | 3300025932 | Bacteria | 4983 |
| 146 | Ga0207706_10073062 | 3300025933 | Bacteria | 3016 |
| 147 | Ga0207706_10255747 | 3300025933 | Bacteria | 1529 |
| 148 | Ga0207686_10199418 | 3300025934 | Bacteria | 1432 |
| 149 | Ga0207665_10000946 | 3300025939 | Bacteria | 19627 |
| 150 | Ga0207665_10020029 | 3300025939 | Bacteria | 4394 |
| 151 | Ga0207691_10151026 | 3300025940 | Bacteria | 2042 |
| 152 | Ga0207711_10168648 | 3300025941 | Bacteria | 1985 |
| 153 | Ga0207661_10034427 | 3300025944 | Bacteria | 3939 |
| 154 | Ga0207661_10344011 | 3300025944 | Bacteria | 1344 |
| 155 | Ga0207679_10068215 | 3300025945 | Bacteria | 2671 |
| 156 | Ga0207667_10225850 | 3300025949 | Bacteria | 1918 |
| 157 | Ga0207667_10297397 | 3300025949 | Bacteria | 1649 |
| 158 | Ga0207640_10093499 | 3300025981 | Bacteria | 2089 |
| 159 | Ga0207677_10286630 | 3300026023 | Bacteria | 1354 |
| 160 | Ga0207703_10198494 | 3300026035 | Bacteria | 1781 |
| 161 | Ga0207702_10481005 | 3300026078 | Bacteria | 1208 |
| 162 | Ga0207702_10523750 | 3300026078 | Bacteria | 1157 |
| 163 | Ga0207648_10061181 | 3300026089 | Bacteria | 3283 |
| 164 | Ga0207648_10062399 | 3300026089 | Bacteria | 3249 |
| 165 | Ga0207674_10003054 | 3300026116 | Bacteria | 20712 |
| 166 | Ga0207674_10250494 | 3300026116 | Bacteria | 1718 |
| 167 | Ga0207674_10319770 | 3300026116 | Bacteria | 1501 |
| 168 | Ga0207675_100087900 | 3300026118 | Bacteria | 2919 |
| 169 | Ga0207698_10129089 | 3300026142 | Bacteria | 2156 |
| 170 | Ga0207698_10139090 | 3300026142 | Bacteria | 2088 |
| 171 | Ga0209998_10032728 | 3300027717 | Bacteria | 1156 |
| 172 | Ga0265319_1000493 | 3300028563 | Bacteria | 27401 |
| 173 | Ga0265319_1002312 | 3300028563 | Bacteria | 10518 |
| 174 | Ga0265319_1031983 | 3300028563 | Bacteria | 1828 |
| 175 | Ga0265318_10000904 | 3300028577 | Bacteria | 19344 |
| 176 | Ga0265322_10026210 | 3300028654 | Bacteria | 1666 |
| 177 | Ga0265336_10002831 | 3300028666 | Bacteria | 6995 |
| 178 | Ga0265338_10001954 | 3300028800 | Bacteria | 32161 |
| 179 | Ga0265338_10006204 | 3300028800 | Bacteria | 15315 |
| 180 | Ga0265338_10008638 | 3300028800 | Bacteria | 12320 |
| 181 | Ga0265338_10010203 | 3300028800 | Bacteria | 11069 |
| 182 | Ga0265324_10009549 | 3300029957 | Bacteria | 3781 |
| 183 | Ga0265332_10085014 | 3300031238 | Bacteria | 1341 |
| 184 | Ga0265320_10113501 | 3300031240 | Bacteria | 1239 |
| 185 | Ga0265325_10000684 | 3300031241 | Bacteria | 24693 |
| 186 | Ga0265340_10021432 | 3300031247 | Bacteria | 3314 |
| 187 | Ga0265340_10067151 | 3300031247 | Bacteria | 1705 |
| 188 | Ga0265339_10057795 | 3300031249 | Bacteria | 2096 |
| 189 | Ga0265331_10007805 | 3300031250 | Bacteria | 6143 |
| 190 | Ga0265327_10025453 | 3300031251 | Bacteria | 3449 |
| 191 | Ga0265316_10012176 | 3300031344 | Bacteria | 7720 |
| 192 | Ga0265316_10030665 | 3300031344 | Bacteria | 4404 |
| 193 | Ga0307408_100090935 | 3300031548 | Bacteria | 2304 |
| 194 | Ga0265313_10015647 | 3300031595 | Bacteria | 4404 |
| 195 | Ga0265314_10134492 | 3300031711 | Bacteria | 1537 |
| 196 | Ga0265342_10018790 | 3300031712 | Bacteria | 4467 |
| 197 | Ga0307405_10007306 | 3300031731 | Bacteria | 5510 |
| 198 | Ga0307405_10124223 | 3300031731 | Unclassified | 1772 |
| 199 | Ga0307413_10015048 | 3300031824 | Bacteria | 3953 |
| 200 | Ga0307410_10000655 | 3300031852 | Bacteria | 14288 |
| 201 | Ga0307406_10003401 | 3300031901 | Bacteria | 8667 |
| 202 | Ga0307406_10048416 | 3300031901 | Bacteria | 2684 |
| 203 | Ga0307407_10000386 | 3300031903 | Bacteria | 13330 |
| 204 | Ga0307412_10142582 | 3300031911 | Bacteria | 1757 |
| 205 | Ga0307409_100011907 | 3300031995 | Bacteria | 5511 |
| 206 | Ga0307416_100009181 | 3300032002 | Bacteria | 6450 |
| 207 | Ga0307411_10021395 | 3300032005 | Bacteria | 3784 |
| 208 | Ga0307411_10050860 | 3300032005 | Bacteria | 2701 |
| 209 | Ga0307415_100000048 | 3300032126 | Bacteria | 51694 |
| 210 | Ga0307415_100000685 | 3300032126 | Bacteria | 15054 |
| 211 | Ga0316583_10010964 | 3300032133 | Bacteria | 3264 |
| 212 | Ga0373947_0131114 | 3300035725 | Bacteria | 1600 |
| 213 | Ga0395899_0158110 | 3300037312 | Bacteria | 1602 |
| 214 | Ga0395900_0011199 | 3300037418 | Bacteria | 9173 |
| 215 | Ga0395900_0334552 | 3300037418 | Bacteria | 1491 |
| 216 | Ga0395898_0008697 | 3300037466 | Bacteria | 10712 |
| 217 | Ga0395898_0052757 | 3300037466 | Bacteria | 3972 |
| 218 | Ga0395898_0129609 | 3300037466 | Bacteria | 2416 |
| 219 | Ga0395905_0014507 | 3300037471 | Bacteria | 7519 |
| 220 | Ga0395905_0053618 | 3300037471 | Bacteria | 3774 |
| 221 | Ga0395905_0060586 | 3300037471 | Bacteria | 3539 |
| 222 | Ga0395901_0011693 | 3300038443 | Bacteria | 8894 |
| 223 | Ga0395901_0031596 | 3300038443 | Bacteria | 5458 |
| 224 | Ga0395901_0038306 | 3300038443 | Bacteria | 4958 |
| 225 | Ga0436363_1391603 | 3300039450 | Bacteria | 1367 |
| 226 | Ga0466969_0001165 | 3300044656 | Bacteria | 14153 |
| 227 | Ga0466965_0149951 | 3300044683 | Bacteria | 1218 |
| 228 | Ga0466966_0028321 | 3300044684 | Bacteria | 3650 |
| 229 | Ga0466961_0010375 | 3300044693 | Bacteria | 5943 |
| 230 | Ga0466961_0119853 | 3300044693 | Bacteria | 1652 |
| 231 | Ga0466963_0000670 | 3300044694 | Bacteria | 16566 |
| 232 | Ga0466963_0002100 | 3300044694 | Bacteria | 11008 |
| 233 | Ga0466963_0005161 | 3300044694 | Bacteria | 7624 |
| 234 | Ga0466963_0007823 | 3300044694 | Bacteria | 6395 |
| 235 | Ga0466963_0044376 | 3300044694 | Bacteria | 2926 |
| 236 | Ga0466963_0054735 | 3300044694 | Bacteria | 2652 |
| 237 | Ga0466963_0069938 | 3300044694 | Bacteria | 2360 |
| 238 | Ga0466963_0158154 | 3300044694 | Bacteria | 1576 |
| 239 | Ga0466964_0003899 | 3300044706 | Bacteria | 5480 |
| 240 | Ga0466964_0006438 | 3300044706 | Bacteria | 4375 |
| 241 | Ga0466964_0011880 | 3300044706 | Bacteria | 3292 |
| 242 | Ga0466964_0013963 | 3300044706 | Bacteria | 3051 |
| 243 | Ga0466964_0017932 | 3300044706 | Bacteria | 2712 |
| 244 | Ga0466968_0000609 | 3300044735 | Bacteria | 12198 |
| 245 | Ga0466968_0066809 | 3300044735 | Bacteria | 1558 |
| 246 | Ga0466968_0068722 | 3300044735 | Bacteria | 1539 |
| 247 | Ga0466968_0083832 | 3300044735 | Bacteria | 1404 |
| 248 | Ga0466970_0037886 | 3300044765 | Bacteria | 2557 |
| 249 | Ga0466957_0008159 | 3300044842 | Bacteria | 5945 |
| 250 | Ga0466957_0018272 | 3300044842 | Bacteria | 4117 |
| 251 | Ga0466957_0020985 | 3300044842 | Bacteria | 3844 |
| 252 | Ga0466957_0023718 | 3300044842 | Bacteria | 3629 |
| 253 | Ga0466957_0031432 | 3300044842 | Bacteria | 3173 |
| 254 | Ga0466957_0063034 | 3300044842 | Bacteria | 2278 |
| 255 | Ga0466957_0066081 | 3300044842 | Bacteria | 2228 |
| 256 | Ga0466960_0009561 | 3300044901 | Bacteria | 4001 |
| 257 | Ga0466959_0003022 | 3300045049 | Bacteria | 10871 |
| 258 | Ga0466959_0058211 | 3300045049 | Bacteria | 2814 |
| 259 | Ga0466959_0063996 | 3300045049 | Bacteria | 2670 |
| 260 | Ga0466959_0113946 | 3300045049 | Bacteria | 1927 |
| 261 | Ga0451576_0265534 | 3300045051 | Bacteria | 1794 |
| 262 | Ga0466958_0025720 | 3300045836 | Bacteria | 3473 |
| 263 | Ga0466958_0026565 | 3300045836 | Bacteria | 3422 |
| 264 | Ga0466958_0031190 | 3300045836 | Bacteria | 3167 |
| 265 | Ga0466958_0035495 | 3300045836 | Bacteria | 2979 |
| 266 | Ga0466958_0038301 | 3300045836 | Bacteria | 2876 |
| 267 | Ga0466958_0039868 | 3300045836 | Bacteria | 2822 |
| 268 | Ga0466967_0017358 | 3300045976 | Bacteria | 5711 |
| 269 | Ga0466967_0032105 | 3300045976 | Bacteria | 4430 |
| 270 | Ga0466967_0034238 | 3300045976 | Bacteria | 4309 |
| 271 | Ga0466967_0036586 | 3300045976 | Bacteria | 4192 |
| 272 | Ga0466967_0048489 | 3300045976 | Bacteria | 3709 |
| 273 | Ga0466967_0216774 | 3300045976 | Bacteria | 1817 |
| 274 | Ga0466967_0219266 | 3300045976 | Bacteria | 1807 |
| 275 | Ga0466967_0283192 | 3300045976 | Bacteria | 1591 |
| 276 | Ga0466967_0346385 | 3300045976 | Bacteria | 1437 |
| 277 | Ga0495592_0015233 | 3300046454 | Bacteria | 5837 |
| 278 | Ga0495592_0034832 | 3300046454 | Bacteria | 3794 |
| 279 | Ga0495603_0016483 | 3300046455 | Bacteria | 4470 |
| 280 | Ga0495591_032637 | 3300046458 | Bacteria | 1548 |
| 281 | Ga0495629_0006286 | 3300046459 | Bacteria | 8814 |
| 282 | Ga0495641_0010889 | 3300046461 | Bacteria | 5227 |
| 283 | Ga0495641_0035936 | 3300046461 | Unclassified | 2331 |
| 284 | Ga0495641_0041532 | 3300046461 | Bacteria | 2136 |
| 285 | Ga0495653_0095267 | 3300046463 | Bacteria | 2167 |
| 286 | Ga0495580_0169677 | 3300046472 | Bacteria | 1509 |
| 287 | Ga0495582_0023218 | 3300046473 | Bacteria | 3393 |
| 288 | Ga0495584_0047214 | 3300046491 | Bacteria | 2171 |
| 289 | Ga0495584_0131449 | 3300046491 | Bacteria | 1270 |
| 290 | Ga0495607_0119710 | 3300046501 | Bacteria | 1384 |
| 291 | Ga0495608_0049020 | 3300046511 | Bacteria | 2805 |
| 292 | Ga0495618_0171268 | 3300046514 | Bacteria | 1381 |
| 293 | Ga0495628_0048562 | 3300046516 | Bacteria | 3363 |
| 294 | Ga0495644_0066116 | 3300046523 | Bacteria | 1358 |
| 295 | Ga0495663_0046636 | 3300046525 | Bacteria | 1332 |
| 296 | Ga0495666_0151759 | 3300046526 | Bacteria | 1077 |
| 297 | Ga0495652_0065507 | 3300046529 | Bacteria | 3052 |
| 298 | Ga0495652_0135950 | 3300046529 | Bacteria | 1939 |
| 299 | Ga0495586_0090238 | 3300046535 | Bacteria | 1692 |
| 300 | Ga0495587_0025151 | 3300046536 | Bacteria | 3640 |
| 301 | Ga0495587_0070353 | 3300046536 | Bacteria | 2036 |
| 302 | Ga0495609_0036278 | 3300046538 | Bacteria | 2227 |
| 303 | Ga0495633_0087516 | 3300046558 | Bacteria | 1449 |
| 304 | Ga0495667_0045700 | 3300046559 | Bacteria | 2898 |
| 305 | Ga0495656_0138339 | 3300046615 | Bacteria | 1165 |
| 306 | Ga0495634_0018613 | 3300046642 | Bacteria | 4941 |
| 307 | Ga0495611_0099704 | 3300046648 | Bacteria | 1348 |
| 308 | Ga0495657_0029971 | 3300046675 | Bacteria | 3813 |
| 309 | Ga0495657_0062731 | 3300046675 | Bacteria | 2454 |
| 310 | Ga0495646_0082407 | 3300046680 | Bacteria | 1872 |
| 311 | Ga0495647_0042168 | 3300046681 | Bacteria | 1741 |
| 312 | Ga0495658_0237585 | 3300046683 | Bacteria | 1144 |
| 313 | Ga0495613_0009939 | 3300046689 | Bacteria | 7072 |
| 314 | Ga0495613_0061658 | 3300046689 | Bacteria | 2745 |
| 315 | Ga0495624_0008262 | 3300046690 | Bacteria | 7276 |
| 316 | Ga0495589_0046158 | 3300046794 | Bacteria | 2163 |
| 317 | Ga0495581_0021287 | 3300047315 | Unclassified | 3760 |
| 318 | Ga0495674_0083755 | 3300047319 | Bacteria | 2733 |
| 319 | Ga0495676_0027336 | 3300047321 | Unclassified | 4893 |
| 320 | Ga0495676_0212742 | 3300047321 | Bacteria | 1337 |
| 321 | Ga0495680_0102270 | 3300047322 | Bacteria | 2133 |
| 322 | Ga0495679_031204 | 3300047446 | Bacteria | 1721 |
| 323 | Ga0495684_0119986 | 3300047471 | Bacteria | 1981 |
| 324 | Ga0495684_0296001 | 3300047471 | Bacteria | 1163 |
| 325 | Ga0495602_0063737 | 3300048088 | Bacteria | 3192 |
| 326 | Ga0495602_0140744 | 3300048088 | Bacteria | 1910 |
| 327 | Ga0495614_0077530 | 3300048089 | Bacteria | 1437 |
| 328 | Ga0495614_0108473 | 3300048089 | Bacteria | 1218 |
| 329 | Ga0496100_0030746 | 3300048903 | Bacteria | 3333 |
| 330 | Ga0496100_0083550 | 3300048903 | Bacteria | 2162 |
| 331 | Ga0496100_0101778 | 3300048903 | Bacteria | 1981 |
| 332 | Ga0496101_0002611 | 3300048904 | Bacteria | 11068 |
| 333 | Ga0496101_0036972 | 3300048904 | Bacteria | 3461 |
| 334 | Ga0496101_0044844 | 3300048904 | Bacteria | 3165 |
| 335 | Ga0496101_0205653 | 3300048904 | Bacteria | 1523 |
| 336 | Ga0496102_0026366 | 3300048905 | Bacteria | 5183 |
| 337 | Ga0496102_0045339 | 3300048905 | Bacteria | 3992 |
| 338 | Ga0496102_0124876 | 3300048905 | Bacteria | 2405 |
| 339 | Ga0496102_0159653 | 3300048905 | Bacteria | 2120 |
| 340 | Ga0496103_0049425 | 3300048906 | Bacteria | 2600 |
| 341 | Ga0496104_0015191 | 3300048907 | Bacteria | 6970 |
| 342 | Ga0496104_0036560 | 3300048907 | Bacteria | 4591 |
| 343 | Ga0496104_0039687 | 3300048907 | Bacteria | 4408 |
| 344 | Ga0496104_0139931 | 3300048907 | Bacteria | 2325 |
| 345 | Ga0496104_0198270 | 3300048907 | Bacteria | 1919 |
| 346 | Ga0496105_0001598 | 3300048908 | Bacteria | 16044 |
| 347 | Ga0496105_0026527 | 3300048908 | Bacteria | 4727 |
| 348 | Ga0496105_0046583 | 3300048908 | Bacteria | 3579 |
| 349 | Ga0496105_0131956 | 3300048908 | Bacteria | 2059 |
| 350 | Ga0496106_0003549 | 3300048909 | Bacteria | 11613 |
| 351 | Ga0496106_0022750 | 3300048909 | Bacteria | 4657 |
| 352 | Ga0496107_0001666 | 3300048910 | Bacteria | 13881 |
| 353 | Ga0496107_0026577 | 3300048910 | Bacteria | 4104 |
| 354 | Ga0496107_0116238 | 3300048910 | Bacteria | 1969 |
| 355 | Ga0496107_0117845 | 3300048910 | Bacteria | 1955 |
| 356 | Ga0496108_0015237 | 3300048911 | Bacteria | 6273 |
| 357 | Ga0496108_0028939 | 3300048911 | Bacteria | 4584 |
| 358 | Ga0496108_0056899 | 3300048911 | Bacteria | 3286 |
| 359 | Ga0496108_0104404 | 3300048911 | Bacteria | 2418 |
| 360 | Ga0496109_0004156 | 3300048912 | Bacteria | 12085 |
| 361 | Ga0496109_0010000 | 3300048912 | Bacteria | 8098 |
| 362 | Ga0496109_0011570 | 3300048912 | Bacteria | 7592 |
| 363 | Ga0496109_0035851 | 3300048912 | Bacteria | 4478 |
| 364 | Ga0496109_0052969 | 3300048912 | Bacteria | 3699 |
| 365 | Ga0496109_0063568 | 3300048912 | Bacteria | 3376 |
| 366 | Ga0496109_0077220 | 3300048912 | Bacteria | 3064 |
| 367 | Ga0496109_0452118 | 3300048912 | Bacteria | 1213 |
| 368 | Ga0496110_0002408 | 3300048913 | Bacteria | 14006 |
| 369 | Ga0496110_0005286 | 3300048913 | Bacteria | 10108 |
| 370 | Ga0496110_0019031 | 3300048913 | Bacteria | 5771 |
| 371 | Ga0496110_0038267 | 3300048913 | Bacteria | 4173 |
| 372 | Ga0496110_0244088 | 3300048913 | Bacteria | 1634 |
| 373 | Ga0496110_0350385 | 3300048913 | Bacteria | 1345 |
| 374 | Ga0496110_0389727 | 3300048913 | Bacteria | 1270 |
| 375 | Ga0496111_0013436 | 3300048914 | Bacteria | 5572 |
| 376 | Ga0496111_0019657 | 3300048914 | Bacteria | 4697 |
| 377 | Ga0496111_0021446 | 3300048914 | Bacteria | 4511 |
| 378 | Ga0496111_0023356 | 3300048914 | Bacteria | 4340 |
| 379 | Ga0496111_0070860 | 3300048914 | Bacteria | 2537 |
| 380 | Ga0496111_0103259 | 3300048914 | Bacteria | 2096 |
| 381 | Ga0496111_0163345 | 3300048914 | Bacteria | 1654 |
| 382 | Ga0496112_0001699 | 3300048915 | Bacteria | 17181 |
| 383 | Ga0496112_0019234 | 3300048915 | Bacteria | 6441 |
| 384 | Ga0496112_0038477 | 3300048915 | Bacteria | 4671 |
| 385 | Ga0496112_0040831 | 3300048915 | Bacteria | 4537 |
| 386 | Ga0496112_0178866 | 3300048915 | Bacteria | 2085 |
| 387 | Ga0496113_0043447 | 3300048916 | Bacteria | 3326 |
| 388 | Ga0496113_0044155 | 3300048916 | Bacteria | 3301 |
| 389 | Ga0496113_0101670 | 3300048916 | Bacteria | 2228 |
| 390 | Ga0496113_0128964 | 3300048916 | Bacteria | 1983 |
| 391 | Ga0496113_0139375 | 3300048916 | Bacteria | 1907 |
| 392 | Ga0496114_0001888 | 3300048917 | Bacteria | 15905 |
| 393 | Ga0496114_0011412 | 3300048917 | Bacteria | 7100 |
| 394 | Ga0496114_0013176 | 3300048917 | Bacteria | 6628 |
| 395 | Ga0496114_0106629 | 3300048917 | Bacteria | 2397 |
| 396 | Ga0496114_0254702 | 3300048917 | Bacteria | 1545 |
| 397 | Ga0496114_0274474 | 3300048917 | Bacteria | 1486 |
| 398 | Ga0496115_0026528 | 3300048918 | Bacteria | 4522 |
| 399 | Ga0496115_0033406 | 3300048918 | Bacteria | 4062 |
| 400 | Ga0496115_0076069 | 3300048918 | Bacteria | 2728 |
| 401 | Ga0496115_0129753 | 3300048918 | Bacteria | 2077 |
| 402 | Ga0501031_0007852 | 3300049568 | Bacteria | 6945 |
| 403 | Ga0501036_0016262 | 3300049572 | Bacteria | 6214 |
| 404 | Ga0501037_0197575 | 3300049573 | Bacteria | 1422 |
| 405 | Ga0501038_0024982 | 3300049574 | Bacteria | 5327 |
| 406 | Ga0501039_0003904 | 3300049575 | Bacteria | 11197 |
| 407 | Ga0501040_0026516 | 3300049576 | Bacteria | 3898 |
| 408 | Ga0501041_0118619 | 3300049577 | Bacteria | 1643 |
| 409 | Ga0501043_0283233 | 3300049579 | Bacteria | 1270 |
| 410 | Ga0501046_0141159 | 3300049580 | Bacteria | 1823 |
| 411 | Ga0501048_0017473 | 3300049582 | Bacteria | 5282 |
| 412 | Ga0501067_0206395 | 3300049583 | Bacteria | 1094 |
| 413 | Ga0501068_0128834 | 3300049584 | Bacteria | 1581 |
| 414 | Ga0501069_0002071 | 3300049585 | Bacteria | 10088 |
| 415 | Ga0501069_0090015 | 3300049585 | Bacteria | 1735 |
| 416 | Ga0501071_0001608 | 3300049587 | Bacteria | 13247 |
| 417 | Ga0501071_0029691 | 3300049587 | Bacteria | 3861 |
| 418 | Ga0501072_0019086 | 3300049588 | Bacteria | 5295 |
| 419 | Ga0501072_0077698 | 3300049588 | Bacteria | 2628 |
| 420 | Ga0501076_0096712 | 3300049592 | Bacteria | 2378 |
| 421 | Ga0501079_0077441 | 3300049741 | Bacteria | 2572 |
| 422 | Ga0501080_0228776 | 3300049742 | Bacteria | 1700 |
| 423 | Ga0501081_0021012 | 3300049743 | Bacteria | 4357 |
| 424 | Ga0501081_0091433 | 3300049743 | Bacteria | 2140 |
| 425 | Ga0501081_0153323 | 3300049743 | Bacteria | 1656 |
| 426 | Ga0501035_0122432 | 3300049822 | Bacteria | 2273 |
| 427 | Ga0501045_0119519 | 3300049824 | Bacteria | 1956 |
| 428 | Ga0501045_0223850 | 3300049824 | Bacteria | 1400 |
| 429 | nmdc:mga05p37_43980_c1 | 3300050507 | Bacteria | 5495 |
| 430 | nmdc:mga05p37_755521_c1 | 3300050507 | Bacteria | 1071 |
| 431 | nmdc:mga09592_85545_c1 | 3300050508 | Bacteria | 2690 |
| 432 | nmdc:mga0qj67_67769_c1 | 3300050509 | Bacteria | 2844 |
| 433 | nmdc:mga06r32_58766_c1 | 3300050510 | Bacteria | 3696 |
| 434 | nmdc:mga08y16_105171_c1 | 3300050511 | Bacteria | 2939 |
| 435 | nmdc:mga08y16_25657_c1 | 3300050511 | Bacteria | 6219 |
| 436 | nmdc:mga0n895_108911_c1 | 3300050512 | Bacteria | 2785 |
| 437 | nmdc:mga0n895_313599_c1 | 3300050512 | Unclassified | 1589 |
| 438 | nmdc:mga0n895_44121_c1 | 3300050512 | Bacteria | 4348 |
| 439 | nmdc:mga0n895_68113_c1 | 3300050512 | Bacteria | 3526 |
| 440 | Ga0495601_0003619 | 3300053077 | Bacteria | 8886 |
| 441 | Ga0495612_0071605 | 3300053078 | Bacteria | 1446 |
| 442 | Ga0495655_0036569 | 3300053083 | Bacteria | 1229 |
| 443 | Ga0495595_0091393 | 3300053084 | Bacteria | 1460 |
| 444 | Ga0495619_0109635 | 3300053085 | Bacteria | 1885 |
| 445 | Ga0501084_0474434 | 3300054114 | Bacteria | 1057 |
| 446 | Ga0466962_0005111 | 3300061719 | Bacteria | 6310 |
| 447 | Ga0466962_0007151 | 3300061719 | Bacteria | 5347 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0474434 | Ga0501084_0474434_186_1040 | 259 |
| 2 | 3300049572 | Ga0501036_0016262 | Ga0501036_0016262_1390_2262 | 265 |
| 3 | 3300049574 | Ga0501038_0024982 | Ga0501038_0024982_393_1265 | 265 |
| 4 | 3300049579 | Ga0501043_0283233 | Ga0501043_0283233_25_897 | 265 |
| 5 | 3300048917 | Ga0496114_0274474 | Ga0496114_0274474_69_893 | 274 |
| 6 | 3300028654 | Ga0265322_10026210 | Ga0265322_100262103 | 275 |
| 7 | 3300027717 | Ga0209998_10032728 | Ga0209998_100327282 | 299 |
| 8 | 3300035725 | Ga0373947_0131114 | Ga0373947_0131114_659_1567 | 302 |
| 9 | 3300046683 | Ga0495658_0237585 | Ga0495658_0237585_181_1089 | 302 |
| 10 | 3300050507 | nmdc:mga05p37_755521_c1 | nmdc:mga05p37_755521_c1_25_936 | 303 |
| 11 | 3300048089 | Ga0495614_0077530 | Ga0495614_0077530_499_1416 | 305 |
| 12 | 3300048913 | Ga0496110_0038267 | Ga0496110_0038267_27_950 | 307 |
| 13 | 3300013104 | Ga0157370_10207895 | Ga0157370_102078953 | 316 |
| 14 | 3300013105 | Ga0157369_10051559 | Ga0157369_100515595 | 316 |
| 15 | 3300049568 | Ga0501031_0007852 | Ga0501031_0007852_2265_3305 | 317 |
| 16 | 3300049573 | Ga0501037_0197575 | Ga0501037_0197575_199_1239 | 317 |
| 17 | 3300049575 | Ga0501039_0003904 | Ga0501039_0003904_318_1358 | 317 |
| 18 | 3300049576 | Ga0501040_0026516 | Ga0501040_0026516_1361_2401 | 317 |
| 19 | 3300049577 | Ga0501041_0118619 | Ga0501041_0118619_122_1162 | 317 |
| 20 | 3300049580 | Ga0501046_0141159 | Ga0501046_0141159_600_1640 | 317 |
| 21 | 3300049582 | Ga0501048_0017473 | Ga0501048_0017473_3808_4848 | 317 |
| 22 | 3300049587 | Ga0501071_0001608 | Ga0501071_0001608_6115_7155 | 317 |
| 23 | 3300049588 | Ga0501072_0019086 | Ga0501072_0019086_713_1753 | 317 |
| 24 | 3300049592 | Ga0501076_0096712 | Ga0501076_0096712_28_1068 | 317 |
| 25 | 3300049741 | Ga0501079_0077441 | Ga0501079_0077441_758_1798 | 317 |
| 26 | 3300049742 | Ga0501080_0228776 | Ga0501080_0228776_256_1296 | 317 |
| 27 | 3300049743 | Ga0501081_0021012 | Ga0501081_0021012_2442_3482 | 317 |
| 28 | 3300049822 | Ga0501035_0122432 | Ga0501035_0122432_17_1057 | 317 |
| 29 | 3300049824 | Ga0501045_0119519 | Ga0501045_0119519_437_1477 | 317 |
| 30 | 3300049584 | Ga0501068_0128834 | Ga0501068_0128834_373_1512 | 322 |
| 31 | 3300049585 | Ga0501069_0002071 | Ga0501069_0002071_236_1375 | 322 |
| 32 | 3300049587 | Ga0501071_0029691 | Ga0501071_0029691_2506_3645 | 322 |
| 33 | 3300044694 | Ga0466963_0005161 | Ga0466963_0005161_4822_5817 | 326 |
| 34 | 3300005327 | Ga0070658_10042160 | Ga0070658_100421604 | 328 |
| 35 | 3300005336 | Ga0070680_100123353 | Ga0070680_1001233532 | 328 |
| 36 | 3300005339 | Ga0070660_100075320 | Ga0070660_1000753203 | 328 |
| 37 | 3300005563 | Ga0068855_100051840 | Ga0068855_1000518405 | 328 |
| 38 | 3300005616 | Ga0068852_100157545 | Ga0068852_1001575453 | 328 |
| 39 | 3300009093 | Ga0105240_10019956 | Ga0105240_100199566 | 328 |
| 40 | 3300009545 | Ga0105237_10252923 | Ga0105237_102529233 | 328 |
| 41 | 3300013104 | Ga0157370_10022132 | Ga0157370_100221322 | 328 |
| 42 | 3300013105 | Ga0157369_10056506 | Ga0157369_100565063 | 328 |
| 43 | 3300020069 | Ga0197907_11120046 | Ga0197907_111200461 | 328 |
| 44 | 3300020070 | Ga0206356_10055071 | Ga0206356_100550713 | 328 |
| 45 | 3300020082 | Ga0206353_10532889 | Ga0206353_105328893 | 328 |
| 46 | 3300025909 | Ga0207705_10204308 | Ga0207705_102043083 | 328 |
| 47 | 3300025917 | Ga0207660_10098185 | Ga0207660_100981853 | 328 |
| 48 | 3300025919 | Ga0207657_10123908 | Ga0207657_101239083 | 328 |
| 49 | 3300025921 | Ga0207652_10183366 | Ga0207652_101833663 | 328 |
| 50 | 3300025924 | Ga0207694_10195065 | Ga0207694_101950652 | 328 |
| 51 | 3300025949 | Ga0207667_10225850 | Ga0207667_102258503 | 328 |
| 52 | 3300026142 | Ga0207698_10139090 | Ga0207698_101390903 | 328 |
| 53 | 3300005327 | Ga0070658_10089617 | Ga0070658_100896172 | 329 |
| 54 | 3300044842 | Ga0466957_0018272 | Ga0466957_0018272_213_1202 | 329 |
| 55 | 3300044684 | Ga0466966_0028321 | Ga0466966_0028321_820_1815 | 330 |
| 56 | 3300045049 | Ga0466959_0003022 | Ga0466959_0003022_8862_9857 | 330 |
| 57 | 3300045976 | Ga0466967_0034238 | Ga0466967_0034238_1633_2625 | 330 |
| 58 | 3300013105 | Ga0157369_10017623 | Ga0157369_100176233 | 331 |
| 59 | 3300025909 | Ga0207705_10014407 | Ga0207705_100144073 | 331 |
| 60 | 3300025919 | Ga0207657_10122149 | Ga0207657_101221493 | 331 |
| 61 | 3300037312 | Ga0395899_0158110 | Ga0395899_0158110_485_1483 | 332 |
| 62 | 3300044656 | Ga0466969_0001165 | Ga0466969_0001165_1496_2494 | 332 |
| 63 | 3300044693 | Ga0466961_0119853 | Ga0466961_0119853_155_1153 | 332 |
| 64 | 3300044694 | Ga0466963_0044376 | Ga0466963_0044376_941_1939 | 332 |
| 65 | 3300044694 | Ga0466963_0054735 | Ga0466963_0054735_164_1162 | 332 |
| 66 | 3300044706 | Ga0466964_0011880 | Ga0466964_0011880_164_1162 | 332 |
| 67 | 3300044735 | Ga0466968_0000609 | Ga0466968_0000609_981_1979 | 332 |
| 68 | 3300044765 | Ga0466970_0037886 | Ga0466970_0037886_1280_2278 | 332 |
| 69 | 3300044842 | Ga0466957_0020985 | Ga0466957_0020985_299_1297 | 332 |
| 70 | 3300045049 | Ga0466959_0063996 | Ga0466959_0063996_645_1643 | 332 |
| 71 | 3300045836 | Ga0466958_0026565 | Ga0466958_0026565_1608_2606 | 332 |
| 72 | 3300045836 | Ga0466958_0038301 | Ga0466958_0038301_1381_2379 | 332 |
| 73 | 3300045976 | Ga0466967_0032105 | Ga0466967_0032105_1035_2033 | 332 |
| 74 | 3300045976 | Ga0466967_0048489 | Ga0466967_0048489_2328_3326 | 332 |
| 75 | 3300046459 | Ga0495629_0006286 | Ga0495629_0006286_4065_5063 | 332 |
| 76 | 3300046461 | Ga0495641_0010889 | Ga0495641_0010889_1045_2043 | 332 |
| 77 | 3300046472 | Ga0495580_0169677 | Ga0495580_0169677_239_1237 | 332 |
| 78 | 3300046473 | Ga0495582_0023218 | Ga0495582_0023218_949_1947 | 332 |
| 79 | 3300046511 | Ga0495608_0049020 | Ga0495608_0049020_1745_2743 | 332 |
| 80 | 3300046514 | Ga0495618_0171268 | Ga0495618_0171268_110_1108 | 332 |
| 81 | 3300046526 | Ga0495666_0151759 | Ga0495666_0151759_29_1027 | 332 |
| 82 | 3300046558 | Ga0495633_0087516 | Ga0495633_0087516_228_1226 | 332 |
| 83 | 3300046615 | Ga0495656_0138339 | Ga0495656_0138339_11_1009 | 332 |
| 84 | 3300046642 | Ga0495634_0018613 | Ga0495634_0018613_3785_4783 | 332 |
| 85 | 3300046689 | Ga0495613_0061658 | Ga0495613_0061658_1656_2654 | 332 |
| 86 | 3300046794 | Ga0495589_0046158 | Ga0495589_0046158_991_1989 | 332 |
| 87 | 3300048908 | Ga0496105_0001598 | Ga0496105_0001598_1756_2754 | 332 |
| 88 | 3300048912 | Ga0496109_0010000 | Ga0496109_0010000_1756_2754 | 332 |
| 89 | 3300048913 | Ga0496110_0350385 | Ga0496110_0350385_255_1253 | 332 |
| 90 | 3300048913 | Ga0496110_0389727 | Ga0496110_0389727_234_1232 | 332 |
| 91 | 3300009098 | Ga0105245_10083947 | Ga0105245_100839471 | 333 |
| 92 | 3300045836 | Ga0466958_0035495 | Ga0466958_0035495_1024_2025 | 333 |
| 93 | 3300046461 | Ga0495641_0041532 | Ga0495641_0041532_474_1475 | 333 |
| 94 | 3300046536 | Ga0495587_0025151 | Ga0495587_0025151_1556_2557 | 333 |
| 95 | 3300046680 | Ga0495646_0082407 | Ga0495646_0082407_110_1111 | 333 |
| 96 | 3300048912 | Ga0496109_0077220 | Ga0496109_0077220_850_1851 | 333 |
| 97 | 3300048916 | Ga0496113_0139375 | Ga0496113_0139375_406_1407 | 333 |
| 98 | 3300049583 | Ga0501067_0206395 | Ga0501067_0206395_68_1069 | 333 |
| 99 | 3300049585 | Ga0501069_0090015 | Ga0501069_0090015_355_1356 | 333 |
| 100 | 3300005435 | Ga0070714_100094292 | Ga0070714_1000942922 | 335 |
| 101 | 3300025929 | Ga0207664_10113794 | Ga0207664_101137943 | 335 |
| 102 | 3300048907 | Ga0496104_0198270 | Ga0496104_0198270_450_1457 | 335 |
| 103 | 3300048908 | Ga0496105_0131956 | Ga0496105_0131956_752_1759 | 335 |
| 104 | 3300048911 | Ga0496108_0028939 | Ga0496108_0028939_3515_4522 | 335 |
| 105 | 3300048912 | Ga0496109_0035851 | Ga0496109_0035851_1265_2272 | 335 |
| 106 | 3300048915 | Ga0496112_0038477 | Ga0496112_0038477_3551_4558 | 335 |
| 107 | 3300048915 | Ga0496112_0178866 | Ga0496112_0178866_369_1388 | 335 |
| 108 | 3300005435 | Ga0070714_100012027 | Ga0070714_1000120274 | 336 |
| 109 | 3300005436 | Ga0070713_100006517 | Ga0070713_1000065174 | 336 |
| 110 | 3300006028 | Ga0070717_10274415 | Ga0070717_102744152 | 336 |
| 111 | 3300006871 | Ga0075434_100345130 | Ga0075434_1003451302 | 336 |
| 112 | 3300025928 | Ga0207700_10000002 | Ga0207700_10000002219 | 336 |
| 113 | 3300025939 | Ga0207665_10020029 | Ga0207665_100200292 | 336 |
| 114 | 3300048913 | Ga0496110_0244088 | Ga0496110_0244088_435_1445 | 336 |
| 115 | 3300048914 | Ga0496111_0070860 | Ga0496111_0070860_1254_2264 | 336 |
| 116 | 3300005471 | Ga0070698_100239037 | Ga0070698_1002390372 | 337 |
| 117 | 3300006173 | Ga0070716_100064175 | Ga0070716_1000641753 | 337 |
| 118 | 3300044735 | Ga0466968_0083832 | Ga0466968_0083832_173_1186 | 337 |
| 119 | 3300005981 | Ga0081538_10000014 | Ga0081538_1000001426 | 338 |
| 120 | 3300049588 | Ga0501072_0077698 | Ga0501072_0077698_908_1930 | 338 |
| 121 | 3300049743 | Ga0501081_0091433 | Ga0501081_0091433_90_1112 | 338 |
| 122 | 3300049824 | Ga0501045_0223850 | Ga0501045_0223850_65_1087 | 338 |
| 123 | 3300005445 | Ga0070708_100000744 | Ga0070708_10000074412 | 339 |
| 124 | 3300005458 | Ga0070681_10081146 | Ga0070681_100811461 | 339 |
| 125 | 3300005467 | Ga0070706_100010197 | Ga0070706_1000101973 | 339 |
| 126 | 3300020082 | Ga0206353_10334546 | Ga0206353_103345462 | 339 |
| 127 | 3300025910 | Ga0207684_10005330 | Ga0207684_1000533010 | 339 |
| 128 | 3300025910 | Ga0207684_10467817 | Ga0207684_104678171 | 339 |
| 129 | 3300025912 | Ga0207707_10137398 | Ga0207707_101373983 | 339 |
| 130 | 3300025917 | Ga0207660_10009617 | Ga0207660_100096177 | 339 |
| 131 | 3300025921 | Ga0207652_10011628 | Ga0207652_100116286 | 339 |
| 132 | 3300038443 | Ga0395901_0031596 | Ga0395901_0031596_1591_2610 | 339 |
| 133 | 3300046535 | Ga0495586_0090238 | Ga0495586_0090238_66_1088 | 339 |
| 134 | 3300046689 | Ga0495613_0009939 | Ga0495613_0009939_103_1125 | 339 |
| 135 | 3300048913 | Ga0496110_0002408 | Ga0496110_0002408_11349_12368 | 339 |
| 136 | 3300048914 | Ga0496111_0023356 | Ga0496111_0023356_121_1140 | 339 |
| 137 | 3300048915 | Ga0496112_0019234 | Ga0496112_0019234_2705_3724 | 339 |
| 138 | 3300048915 | Ga0496112_0040831 | Ga0496112_0040831_2338_3357 | 339 |
| 139 | 3300048916 | Ga0496113_0043447 | Ga0496113_0043447_2204_3223 | 339 |
| 140 | 3300048917 | Ga0496114_0254702 | Ga0496114_0254702_163_1182 | 339 |
| 141 | 3300050512 | nmdc:mga0n895_44121_c1 | nmdc:mga0n895_44121_c1_773_1792 | 339 |
| 142 | 3300003322 | rootL2_10127790 | rootL2_101277901 | 340 |
| 143 | 3300005329 | Ga0070683_100022954 | Ga0070683_1000229543 | 340 |
| 144 | 3300005336 | Ga0070680_100161906 | Ga0070680_1001619062 | 340 |
| 145 | 3300005355 | Ga0070671_100124090 | Ga0070671_1001240901 | 340 |
| 146 | 3300005435 | Ga0070714_100297544 | Ga0070714_1002975442 | 340 |
| 147 | 3300005435 | Ga0070714_100447322 | Ga0070714_1004473222 | 340 |
| 148 | 3300005437 | Ga0070710_10001658 | Ga0070710_1000165812 | 340 |
| 149 | 3300005437 | Ga0070710_10056248 | Ga0070710_100562485 | 340 |
| 150 | 3300005437 | Ga0070710_10091005 | Ga0070710_100910051 | 340 |
| 151 | 3300005439 | Ga0070711_100025670 | Ga0070711_1000256702 | 340 |
| 152 | 3300005439 | Ga0070711_100228268 | Ga0070711_1002282682 | 340 |
| 153 | 3300005444 | Ga0070694_100257740 | Ga0070694_1002577401 | 340 |
| 154 | 3300005458 | Ga0070681_10122195 | Ga0070681_101221953 | 340 |
| 155 | 3300005459 | Ga0068867_100104089 | Ga0068867_1001040893 | 340 |
| 156 | 3300005468 | Ga0070707_100000419 | Ga0070707_10000041946 | 340 |
| 157 | 3300005530 | Ga0070679_100199332 | Ga0070679_1001993322 | 340 |
| 158 | 3300005545 | Ga0070695_100000704 | Ga0070695_1000007042 | 340 |
| 159 | 3300005563 | Ga0068855_100256517 | Ga0068855_1002565172 | 340 |
| 160 | 3300005841 | Ga0068863_100289923 | Ga0068863_1002899232 | 340 |
| 161 | 3300005937 | Ga0081455_10137224 | Ga0081455_101372242 | 340 |
| 162 | 3300006028 | Ga0070717_10003918 | Ga0070717_1000391811 | 340 |
| 163 | 3300006028 | Ga0070717_10014893 | Ga0070717_100148936 | 340 |
| 164 | 3300006028 | Ga0070717_10068242 | Ga0070717_100682422 | 340 |
| 165 | 3300006028 | Ga0070717_10122463 | Ga0070717_101224632 | 340 |
| 166 | 3300006163 | Ga0070715_10049201 | Ga0070715_100492012 | 340 |
| 167 | 3300006237 | Ga0097621_100205165 | Ga0097621_1002051652 | 340 |
| 168 | 3300006358 | Ga0068871_100171479 | Ga0068871_1001714792 | 340 |
| 169 | 3300006871 | Ga0075434_100250152 | Ga0075434_1002501522 | 340 |
| 170 | 3300009093 | Ga0105240_10047194 | Ga0105240_100471943 | 340 |
| 171 | 3300009098 | Ga0105245_10014534 | Ga0105245_100145345 | 340 |
| 172 | 3300009176 | Ga0105242_10063935 | Ga0105242_100639352 | 340 |
| 173 | 3300009177 | Ga0105248_10319696 | Ga0105248_103196962 | 340 |
| 174 | 3300009545 | Ga0105237_10044267 | Ga0105237_100442676 | 340 |
| 175 | 3300010375 | Ga0105239_10555591 | Ga0105239_105555911 | 340 |
| 176 | 3300013296 | Ga0157374_10062900 | Ga0157374_100629002 | 340 |
| 177 | 3300013307 | Ga0157372_10353972 | Ga0157372_103539722 | 340 |
| 178 | 3300014969 | Ga0157376_10083023 | Ga0157376_100830234 | 340 |
| 179 | 3300025898 | Ga0207692_10023830 | Ga0207692_100238302 | 340 |
| 180 | 3300025900 | Ga0207710_10054322 | Ga0207710_100543222 | 340 |
| 181 | 3300025906 | Ga0207699_10086550 | Ga0207699_100865502 | 340 |
| 182 | 3300025909 | Ga0207705_10126181 | Ga0207705_101261811 | 340 |
| 183 | 3300025912 | Ga0207707_10199966 | Ga0207707_101999662 | 340 |
| 184 | 3300025912 | Ga0207707_10220403 | Ga0207707_102204032 | 340 |
| 185 | 3300025914 | Ga0207671_10096966 | Ga0207671_100969662 | 340 |
| 186 | 3300025915 | Ga0207693_10004494 | Ga0207693_100044946 | 340 |
| 187 | 3300025915 | Ga0207693_10006840 | Ga0207693_100068402 | 340 |
| 188 | 3300025916 | Ga0207663_10023662 | Ga0207663_100236624 | 340 |
| 189 | 3300025919 | Ga0207657_10002568 | Ga0207657_1000256811 | 340 |
| 190 | 3300025921 | Ga0207652_10089594 | Ga0207652_100895942 | 340 |
| 191 | 3300025922 | Ga0207646_10003186 | Ga0207646_100031862 | 340 |
| 192 | 3300025927 | Ga0207687_10009338 | Ga0207687_100093384 | 340 |
| 193 | 3300025929 | Ga0207664_10160633 | Ga0207664_101606332 | 340 |
| 194 | 3300025929 | Ga0207664_10209182 | Ga0207664_102091822 | 340 |
| 195 | 3300025932 | Ga0207690_10013051 | Ga0207690_100130514 | 340 |
| 196 | 3300025934 | Ga0207686_10199418 | Ga0207686_101994182 | 340 |
| 197 | 3300025939 | Ga0207665_10000946 | Ga0207665_100009463 | 340 |
| 198 | 3300025949 | Ga0207667_10297397 | Ga0207667_102973972 | 340 |
| 199 | 3300026078 | Ga0207702_10481005 | Ga0207702_104810051 | 340 |
| 200 | 3300026089 | Ga0207648_10061181 | Ga0207648_100611813 | 340 |
| 201 | 3300026116 | Ga0207674_10319770 | Ga0207674_103197701 | 340 |
| 202 | 3300028563 | Ga0265319_1000493 | Ga0265319_100049318 | 340 |
| 203 | 3300028563 | Ga0265319_1031983 | Ga0265319_10319833 | 340 |
| 204 | 3300028577 | Ga0265318_10000904 | Ga0265318_100009046 | 340 |
| 205 | 3300028666 | Ga0265336_10002831 | Ga0265336_100028315 | 340 |
| 206 | 3300028800 | Ga0265338_10001954 | Ga0265338_1000195410 | 340 |
| 207 | 3300028800 | Ga0265338_10008638 | Ga0265338_100086384 | 340 |
| 208 | 3300028800 | Ga0265338_10010203 | Ga0265338_100102036 | 340 |
| 209 | 3300029957 | Ga0265324_10009549 | Ga0265324_100095491 | 340 |
| 210 | 3300031238 | Ga0265332_10085014 | Ga0265332_100850142 | 340 |
| 211 | 3300031240 | Ga0265320_10113501 | Ga0265320_101135011 | 340 |
| 212 | 3300031344 | Ga0265316_10012176 | Ga0265316_100121768 | 340 |
| 213 | 3300031711 | Ga0265314_10134492 | Ga0265314_101344922 | 340 |
| 214 | 3300031901 | Ga0307406_10048416 | Ga0307406_100484163 | 340 |
| 215 | 3300032005 | Ga0307411_10050860 | Ga0307411_100508603 | 340 |
| 216 | 3300032126 | Ga0307415_100000048 | Ga0307415_10000004852 | 340 |
| 217 | 3300032133 | Ga0316583_10010964 | Ga0316583_100109643 | 340 |
| 218 | 3300037418 | Ga0395900_0011199 | Ga0395900_0011199_3165_4187 | 340 |
| 219 | 3300037418 | Ga0395900_0334552 | Ga0395900_0334552_336_1358 | 340 |
| 220 | 3300037466 | Ga0395898_0052757 | Ga0395898_0052757_952_1974 | 340 |
| 221 | 3300037466 | Ga0395898_0129609 | Ga0395898_0129609_1377_2399 | 340 |
| 222 | 3300037471 | Ga0395905_0053618 | Ga0395905_0053618_2096_3118 | 340 |
| 223 | 3300038443 | Ga0395901_0038306 | Ga0395901_0038306_2217_3239 | 340 |
| 224 | 3300044683 | Ga0466965_0149951 | Ga0466965_0149951_68_1090 | 340 |
| 225 | 3300044693 | Ga0466961_0010375 | Ga0466961_0010375_3309_4331 | 340 |
| 226 | 3300044694 | Ga0466963_0000670 | Ga0466963_0000670_12744_13766 | 340 |
| 227 | 3300044694 | Ga0466963_0002100 | Ga0466963_0002100_1184_2206 | 340 |
| 228 | 3300044694 | Ga0466963_0007823 | Ga0466963_0007823_1804_2826 | 340 |
| 229 | 3300044694 | Ga0466963_0069938 | Ga0466963_0069938_1040_2062 | 340 |
| 230 | 3300044694 | Ga0466963_0158154 | Ga0466963_0158154_388_1410 | 340 |
| 231 | 3300044706 | Ga0466964_0003899 | Ga0466964_0003899_647_1669 | 340 |
| 232 | 3300044706 | Ga0466964_0006438 | Ga0466964_0006438_1632_2654 | 340 |
| 233 | 3300044706 | Ga0466964_0017932 | Ga0466964_0017932_1548_2642 | 340 |
| 234 | 3300044735 | Ga0466968_0066809 | Ga0466968_0066809_106_1200 | 340 |
| 235 | 3300044735 | Ga0466968_0068722 | Ga0466968_0068722_366_1388 | 340 |
| 236 | 3300044842 | Ga0466957_0008159 | Ga0466957_0008159_390_1412 | 340 |
| 237 | 3300044842 | Ga0466957_0023718 | Ga0466957_0023718_1948_2970 | 340 |
| 238 | 3300044842 | Ga0466957_0031432 | Ga0466957_0031432_2122_3144 | 340 |
| 239 | 3300044842 | Ga0466957_0063034 | Ga0466957_0063034_970_1992 | 340 |
| 240 | 3300044842 | Ga0466957_0066081 | Ga0466957_0066081_766_1860 | 340 |
| 241 | 3300044901 | Ga0466960_0009561 | Ga0466960_0009561_2222_3244 | 340 |
| 242 | 3300045049 | Ga0466959_0058211 | Ga0466959_0058211_877_1899 | 340 |
| 243 | 3300045049 | Ga0466959_0113946 | Ga0466959_0113946_557_1579 | 340 |
| 244 | 3300045836 | Ga0466958_0031190 | Ga0466958_0031190_2134_3156 | 340 |
| 245 | 3300045836 | Ga0466958_0039868 | Ga0466958_0039868_1226_2248 | 340 |
| 246 | 3300045976 | Ga0466967_0017358 | Ga0466967_0017358_3698_4720 | 340 |
| 247 | 3300045976 | Ga0466967_0036586 | Ga0466967_0036586_2590_3612 | 340 |
| 248 | 3300045976 | Ga0466967_0216774 | Ga0466967_0216774_569_1594 | 340 |
| 249 | 3300045976 | Ga0466967_0219266 | Ga0466967_0219266_120_1142 | 340 |
| 250 | 3300045976 | Ga0466967_0283192 | Ga0466967_0283192_512_1534 | 340 |
| 251 | 3300045976 | Ga0466967_0346385 | Ga0466967_0346385_370_1392 | 340 |
| 252 | 3300046454 | Ga0495592_0015233 | Ga0495592_0015233_3041_4063 | 340 |
| 253 | 3300046454 | Ga0495592_0034832 | Ga0495592_0034832_2335_3357 | 340 |
| 254 | 3300046455 | Ga0495603_0016483 | Ga0495603_0016483_105_1127 | 340 |
| 255 | 3300046461 | Ga0495641_0035936 | Ga0495641_0035936_10_1032 | 340 |
| 256 | 3300046463 | Ga0495653_0095267 | Ga0495653_0095267_10_1032 | 340 |
| 257 | 3300046491 | Ga0495584_0047214 | Ga0495584_0047214_576_1598 | 340 |
| 258 | 3300046491 | Ga0495584_0131449 | Ga0495584_0131449_85_1107 | 340 |
| 259 | 3300046501 | Ga0495607_0119710 | Ga0495607_0119710_254_1276 | 340 |
| 260 | 3300046516 | Ga0495628_0048562 | Ga0495628_0048562_595_1617 | 340 |
| 261 | 3300046523 | Ga0495644_0066116 | Ga0495644_0066116_180_1202 | 340 |
| 262 | 3300046529 | Ga0495652_0065507 | Ga0495652_0065507_712_1734 | 340 |
| 263 | 3300046529 | Ga0495652_0135950 | Ga0495652_0135950_815_1837 | 340 |
| 264 | 3300046536 | Ga0495587_0070353 | Ga0495587_0070353_787_1809 | 340 |
| 265 | 3300046559 | Ga0495667_0045700 | Ga0495667_0045700_1545_2567 | 340 |
| 266 | 3300046648 | Ga0495611_0099704 | Ga0495611_0099704_90_1112 | 340 |
| 267 | 3300046675 | Ga0495657_0029971 | Ga0495657_0029971_1374_2396 | 340 |
| 268 | 3300046675 | Ga0495657_0062731 | Ga0495657_0062731_1184_2206 | 340 |
| 269 | 3300046681 | Ga0495647_0042168 | Ga0495647_0042168_225_1247 | 340 |
| 270 | 3300046690 | Ga0495624_0008262 | Ga0495624_0008262_2686_3708 | 340 |
| 271 | 3300047315 | Ga0495581_0021287 | Ga0495581_0021287_1723_2745 | 340 |
| 272 | 3300047319 | Ga0495674_0083755 | Ga0495674_0083755_1580_2602 | 340 |
| 273 | 3300047321 | Ga0495676_0027336 | Ga0495676_0027336_2639_3661 | 340 |
| 274 | 3300047321 | Ga0495676_0212742 | Ga0495676_0212742_235_1257 | 340 |
| 275 | 3300047322 | Ga0495680_0102270 | Ga0495680_0102270_533_1555 | 340 |
| 276 | 3300047446 | Ga0495679_031204 | Ga0495679_031204_259_1281 | 340 |
| 277 | 3300047471 | Ga0495684_0119986 | Ga0495684_0119986_69_1091 | 340 |
| 278 | 3300047471 | Ga0495684_0296001 | Ga0495684_0296001_79_1101 | 340 |
| 279 | 3300048088 | Ga0495602_0063737 | Ga0495602_0063737_1568_2590 | 340 |
| 280 | 3300048088 | Ga0495602_0140744 | Ga0495602_0140744_183_1205 | 340 |
| 281 | 3300048089 | Ga0495614_0108473 | Ga0495614_0108473_153_1175 | 340 |
| 282 | 3300048903 | Ga0496100_0030746 | Ga0496100_0030746_1347_2369 | 340 |
| 283 | 3300048903 | Ga0496100_0101778 | Ga0496100_0101778_459_1481 | 340 |
| 284 | 3300048904 | Ga0496101_0002611 | Ga0496101_0002611_8796_9818 | 340 |
| 285 | 3300048904 | Ga0496101_0036972 | Ga0496101_0036972_1027_2049 | 340 |
| 286 | 3300048904 | Ga0496101_0044844 | Ga0496101_0044844_1813_2835 | 340 |
| 287 | 3300048904 | Ga0496101_0205653 | Ga0496101_0205653_297_1319 | 340 |
| 288 | 3300048905 | Ga0496102_0045339 | Ga0496102_0045339_2740_3762 | 340 |
| 289 | 3300048905 | Ga0496102_0124876 | Ga0496102_0124876_168_1190 | 340 |
| 290 | 3300048905 | Ga0496102_0159653 | Ga0496102_0159653_863_1885 | 340 |
| 291 | 3300048907 | Ga0496104_0015191 | Ga0496104_0015191_2964_3986 | 340 |
| 292 | 3300048907 | Ga0496104_0036560 | Ga0496104_0036560_2727_3749 | 340 |
| 293 | 3300048907 | Ga0496104_0039687 | Ga0496104_0039687_2365_3387 | 340 |
| 294 | 3300048907 | Ga0496104_0139931 | Ga0496104_0139931_835_1857 | 340 |
| 295 | 3300048908 | Ga0496105_0026527 | Ga0496105_0026527_3209_4231 | 340 |
| 296 | 3300048908 | Ga0496105_0046583 | Ga0496105_0046583_558_1580 | 340 |
| 297 | 3300048909 | Ga0496106_0003549 | Ga0496106_0003549_2585_3607 | 340 |
| 298 | 3300048910 | Ga0496107_0116238 | Ga0496107_0116238_426_1448 | 340 |
| 299 | 3300048910 | Ga0496107_0117845 | Ga0496107_0117845_275_1297 | 340 |
| 300 | 3300048911 | Ga0496108_0015237 | Ga0496108_0015237_4571_5593 | 340 |
| 301 | 3300048911 | Ga0496108_0104404 | Ga0496108_0104404_592_1614 | 340 |
| 302 | 3300048912 | Ga0496109_0011570 | Ga0496109_0011570_2264_3286 | 340 |
| 303 | 3300048912 | Ga0496109_0052969 | Ga0496109_0052969_91_1113 | 340 |
| 304 | 3300048912 | Ga0496109_0063568 | Ga0496109_0063568_1565_2587 | 340 |
| 305 | 3300048912 | Ga0496109_0452118 | Ga0496109_0452118_18_1040 | 340 |
| 306 | 3300048913 | Ga0496110_0005286 | Ga0496110_0005286_4384_5406 | 340 |
| 307 | 3300048913 | Ga0496110_0019031 | Ga0496110_0019031_16_1038 | 340 |
| 308 | 3300048914 | Ga0496111_0013436 | Ga0496111_0013436_1450_2472 | 340 |
| 309 | 3300048914 | Ga0496111_0019657 | Ga0496111_0019657_3350_4372 | 340 |
| 310 | 3300048914 | Ga0496111_0103259 | Ga0496111_0103259_495_1517 | 340 |
| 311 | 3300048914 | Ga0496111_0163345 | Ga0496111_0163345_41_1063 | 340 |
| 312 | 3300048915 | Ga0496112_0001699 | Ga0496112_0001699_7311_8333 | 340 |
| 313 | 3300048916 | Ga0496113_0101670 | Ga0496113_0101670_57_1079 | 340 |
| 314 | 3300048916 | Ga0496113_0128964 | Ga0496113_0128964_303_1325 | 340 |
| 315 | 3300048917 | Ga0496114_0001888 | Ga0496114_0001888_6914_7936 | 340 |
| 316 | 3300048917 | Ga0496114_0011412 | Ga0496114_0011412_1509_2531 | 340 |
| 317 | 3300048917 | Ga0496114_0106629 | Ga0496114_0106629_506_1528 | 340 |
| 318 | 3300048918 | Ga0496115_0026528 | Ga0496115_0026528_3074_4096 | 340 |
| 319 | 3300048918 | Ga0496115_0033406 | Ga0496115_0033406_843_1865 | 340 |
| 320 | 3300048918 | Ga0496115_0076069 | Ga0496115_0076069_487_1509 | 340 |
| 321 | 3300048918 | Ga0496115_0129753 | Ga0496115_0129753_454_1476 | 340 |
| 322 | 3300050512 | nmdc:mga0n895_313599_c1 | nmdc:mga0n895_313599_c1_454_1476 | 340 |
| 323 | 3300050512 | nmdc:mga0n895_68113_c1 | nmdc:mga0n895_68113_c1_2098_3120 | 340 |
| 324 | 3300053077 | Ga0495601_0003619 | Ga0495601_0003619_6902_7924 | 340 |
| 325 | 3300053078 | Ga0495612_0071605 | Ga0495612_0071605_17_1039 | 340 |
| 326 | 3300053083 | Ga0495655_0036569 | Ga0495655_0036569_100_1122 | 340 |
| 327 | 3300053084 | Ga0495595_0091393 | Ga0495595_0091393_425_1447 | 340 |
| 328 | 3300053085 | Ga0495619_0109635 | Ga0495619_0109635_818_1846 | 340 |
| 329 | 3300061719 | Ga0466962_0005111 | Ga0466962_0005111_5114_6136 | 340 |
| 330 | 3300061719 | Ga0466962_0007151 | Ga0466962_0007151_2925_3947 | 340 |
| 331 | 3300005329 | Ga0070683_100073626 | Ga0070683_1000736262 | 341 |
| 332 | 3300005366 | Ga0070659_100161739 | Ga0070659_1001617392 | 341 |
| 333 | 3300005406 | Ga0070703_10000008 | Ga0070703_1000000877 | 341 |
| 334 | 3300005441 | Ga0070700_100028625 | Ga0070700_1000286253 | 341 |
| 335 | 3300005445 | Ga0070708_100001702 | Ga0070708_10000170214 | 341 |
| 336 | 3300005445 | Ga0070708_100031902 | Ga0070708_1000319023 | 341 |
| 337 | 3300005467 | Ga0070706_100000040 | Ga0070706_100000040106 | 341 |
| 338 | 3300005467 | Ga0070706_100001299 | Ga0070706_10000129913 | 341 |
| 339 | 3300005467 | Ga0070706_100018906 | Ga0070706_1000189063 | 341 |
| 340 | 3300005468 | Ga0070707_100002016 | Ga0070707_10000201613 | 341 |
| 341 | 3300005468 | Ga0070707_100006897 | Ga0070707_1000068977 | 341 |
| 342 | 3300005468 | Ga0070707_100011334 | Ga0070707_1000113345 | 341 |
| 343 | 3300005468 | Ga0070707_100014906 | Ga0070707_1000149065 | 341 |
| 344 | 3300005471 | Ga0070698_100001180 | Ga0070698_10000118015 | 341 |
| 345 | 3300005471 | Ga0070698_100007227 | Ga0070698_1000072277 | 341 |
| 346 | 3300005471 | Ga0070698_100041571 | Ga0070698_1000415712 | 341 |
| 347 | 3300005518 | Ga0070699_100000382 | Ga0070699_10000038237 | 341 |
| 348 | 3300005547 | Ga0070693_100104138 | Ga0070693_1001041382 | 341 |
| 349 | 3300005564 | Ga0070664_100217687 | Ga0070664_1002176872 | 341 |
| 350 | 3300005937 | Ga0081455_10018077 | Ga0081455_100180776 | 341 |
| 351 | 3300006028 | Ga0070717_10000229 | Ga0070717_1000022925 | 341 |
| 352 | 3300009094 | Ga0111539_10040195 | Ga0111539_100401953 | 341 |
| 353 | 3300009098 | Ga0105245_10120739 | Ga0105245_101207393 | 341 |
| 354 | 3300009177 | Ga0105248_10543583 | Ga0105248_105435832 | 341 |
| 355 | 3300013306 | Ga0163162_10225048 | Ga0163162_102250482 | 341 |
| 356 | 3300013308 | Ga0157375_10101127 | Ga0157375_101011274 | 341 |
| 357 | 3300014745 | Ga0157377_10106473 | Ga0157377_101064732 | 341 |
| 358 | 3300025885 | Ga0207653_10000003 | Ga0207653_1000000384 | 341 |
| 359 | 3300025910 | Ga0207684_10000012 | Ga0207684_10000012320 | 341 |
| 360 | 3300025910 | Ga0207684_10000025 | Ga0207684_10000025113 | 341 |
| 361 | 3300025910 | Ga0207684_10035863 | Ga0207684_100358632 | 341 |
| 362 | 3300025919 | Ga0207657_10166159 | Ga0207657_101661593 | 341 |
| 363 | 3300025921 | Ga0207652_10115016 | Ga0207652_101150163 | 341 |
| 364 | 3300025922 | Ga0207646_10002945 | Ga0207646_100029455 | 341 |
| 365 | 3300025922 | Ga0207646_10006253 | Ga0207646_100062537 | 341 |
| 366 | 3300025922 | Ga0207646_10024974 | Ga0207646_100249745 | 341 |
| 367 | 3300025927 | Ga0207687_10009952 | Ga0207687_100099526 | 341 |
| 368 | 3300025933 | Ga0207706_10073062 | Ga0207706_100730624 | 341 |
| 369 | 3300025933 | Ga0207706_10255747 | Ga0207706_102557472 | 341 |
| 370 | 3300025940 | Ga0207691_10151026 | Ga0207691_101510263 | 341 |
| 371 | 3300025941 | Ga0207711_10168648 | Ga0207711_101686482 | 341 |
| 372 | 3300025944 | Ga0207661_10034427 | Ga0207661_100344273 | 341 |
| 373 | 3300025945 | Ga0207679_10068215 | Ga0207679_100682152 | 341 |
| 374 | 3300025981 | Ga0207640_10093499 | Ga0207640_100934993 | 341 |
| 375 | 3300026023 | Ga0207677_10286630 | Ga0207677_102866302 | 341 |
| 376 | 3300026035 | Ga0207703_10198494 | Ga0207703_101984943 | 341 |
| 377 | 3300026089 | Ga0207648_10062399 | Ga0207648_100623993 | 341 |
| 378 | 3300026116 | Ga0207674_10250494 | Ga0207674_102504942 | 341 |
| 379 | 3300026118 | Ga0207675_100087900 | Ga0207675_1000879002 | 341 |
| 380 | 3300026142 | Ga0207698_10129089 | Ga0207698_101290892 | 341 |
| 381 | 3300028563 | Ga0265319_1002312 | Ga0265319_10023125 | 341 |
| 382 | 3300028800 | Ga0265338_10006204 | Ga0265338_100062043 | 341 |
| 383 | 3300031241 | Ga0265325_10000684 | Ga0265325_1000068428 | 341 |
| 384 | 3300031247 | Ga0265340_10021432 | Ga0265340_100214323 | 341 |
| 385 | 3300031249 | Ga0265339_10057795 | Ga0265339_100577953 | 341 |
| 386 | 3300031250 | Ga0265331_10007805 | Ga0265331_100078056 | 341 |
| 387 | 3300031251 | Ga0265327_10025453 | Ga0265327_100254533 | 341 |
| 388 | 3300031344 | Ga0265316_10030665 | Ga0265316_100306655 | 341 |
| 389 | 3300031548 | Ga0307408_100090935 | Ga0307408_1000909353 | 341 |
| 390 | 3300031595 | Ga0265313_10015647 | Ga0265313_100156473 | 341 |
| 391 | 3300031712 | Ga0265342_10018790 | Ga0265342_100187906 | 341 |
| 392 | 3300031731 | Ga0307405_10007306 | Ga0307405_100073065 | 341 |
| 393 | 3300031731 | Ga0307405_10124223 | Ga0307405_101242233 | 341 |
| 394 | 3300031824 | Ga0307413_10015048 | Ga0307413_100150484 | 341 |
| 395 | 3300031852 | Ga0307410_10000655 | Ga0307410_1000065510 | 341 |
| 396 | 3300031901 | Ga0307406_10003401 | Ga0307406_100034012 | 341 |
| 397 | 3300031903 | Ga0307407_10000386 | Ga0307407_100003868 | 341 |
| 398 | 3300031911 | Ga0307412_10142582 | Ga0307412_101425822 | 341 |
| 399 | 3300031995 | Ga0307409_100011907 | Ga0307409_1000119073 | 341 |
| 400 | 3300032002 | Ga0307416_100009181 | Ga0307416_1000091814 | 341 |
| 401 | 3300032005 | Ga0307411_10021395 | Ga0307411_100213955 | 341 |
| 402 | 3300032126 | Ga0307415_100000685 | Ga0307415_1000006853 | 341 |
| 403 | 3300037466 | Ga0395898_0008697 | Ga0395898_0008697_6789_7817 | 341 |
| 404 | 3300037471 | Ga0395905_0014507 | Ga0395905_0014507_1431_2459 | 341 |
| 405 | 3300037471 | Ga0395905_0060586 | Ga0395905_0060586_401_1426 | 341 |
| 406 | 3300038443 | Ga0395901_0011693 | Ga0395901_0011693_4537_5565 | 341 |
| 407 | 3300044706 | Ga0466964_0013963 | Ga0466964_0013963_1221_2255 | 341 |
| 408 | 3300045051 | Ga0451576_0265534 | Ga0451576_0265534_759_1784 | 341 |
| 409 | 3300046458 | Ga0495591_032637 | Ga0495591_032637_447_1472 | 341 |
| 410 | 3300046525 | Ga0495663_0046636 | Ga0495663_0046636_138_1163 | 341 |
| 411 | 3300046538 | Ga0495609_0036278 | Ga0495609_0036278_845_1870 | 341 |
| 412 | 3300048905 | Ga0496102_0026366 | Ga0496102_0026366_464_1489 | 341 |
| 413 | 3300048906 | Ga0496103_0049425 | Ga0496103_0049425_661_1686 | 341 |
| 414 | 3300048909 | Ga0496106_0022750 | Ga0496106_0022750_2108_3151 | 341 |
| 415 | 3300048910 | Ga0496107_0001666 | Ga0496107_0001666_527_1570 | 341 |
| 416 | 3300048911 | Ga0496108_0056899 | Ga0496108_0056899_415_1440 | 341 |
| 417 | 3300048912 | Ga0496109_0004156 | Ga0496109_0004156_92_1117 | 341 |
| 418 | 3300048914 | Ga0496111_0021446 | Ga0496111_0021446_450_1475 | 341 |
| 419 | 3300048916 | Ga0496113_0044155 | Ga0496113_0044155_1947_2972 | 341 |
| 420 | 3300050511 | nmdc:mga08y16_105171_c1 | nmdc:mga08y16_105171_c1_1216_2241 | 341 |
| 421 | 3300003316 | rootH1_10096065 | rootH1_100960653 | 342 |
| 422 | 3300005329 | Ga0070683_100388014 | Ga0070683_1003880141 | 342 |
| 423 | 3300005564 | Ga0070664_100063340 | Ga0070664_1000633403 | 342 |
| 424 | 3300005577 | Ga0068857_100000499 | Ga0068857_1000004999 | 342 |
| 425 | 3300005937 | Ga0081455_10003895 | Ga0081455_1000389513 | 342 |
| 426 | 3300005985 | Ga0081539_10001492 | Ga0081539_1000149236 | 342 |
| 427 | 3300006847 | Ga0075431_100287783 | Ga0075431_1002877832 | 342 |
| 428 | 3300006880 | Ga0075429_100019048 | Ga0075429_1000190485 | 342 |
| 429 | 3300009094 | Ga0111539_10009131 | Ga0111539_100091316 | 342 |
| 430 | 3300009147 | Ga0114129_10006697 | Ga0114129_1000669711 | 342 |
| 431 | 3300020081 | Ga0206354_11240619 | Ga0206354_112406192 | 342 |
| 432 | 3300025944 | Ga0207661_10344011 | Ga0207661_103440112 | 342 |
| 433 | 3300026078 | Ga0207702_10523750 | Ga0207702_105237501 | 342 |
| 434 | 3300026116 | Ga0207674_10003054 | Ga0207674_100030544 | 342 |
| 435 | 3300031247 | Ga0265340_10067151 | Ga0265340_100671512 | 342 |
| 436 | 3300039450 | Ga0436363_1391603 | Ga0436363_1391603_245_1279 | 342 |
| 437 | 3300045836 | Ga0466958_0025720 | Ga0466958_0025720_1449_2501 | 342 |
| 438 | 3300048903 | Ga0496100_0083550 | Ga0496100_0083550_597_1637 | 342 |
| 439 | 3300048910 | Ga0496107_0026577 | Ga0496107_0026577_628_1668 | 342 |
| 440 | 3300048917 | Ga0496114_0013176 | Ga0496114_0013176_2086_3126 | 342 |
| 441 | 3300049743 | Ga0501081_0153323 | Ga0501081_0153323_511_1542 | 342 |
| 442 | 3300050507 | nmdc:mga05p37_43980_c1 | nmdc:mga05p37_43980_c1_3825_4856 | 342 |
| 443 | 3300050508 | nmdc:mga09592_85545_c1 | nmdc:mga09592_85545_c1_1641_2672 | 342 |
| 444 | 3300050509 | nmdc:mga0qj67_67769_c1 | nmdc:mga0qj67_67769_c1_1131_2162 | 342 |
| 445 | 3300050510 | nmdc:mga06r32_58766_c1 | nmdc:mga06r32_58766_c1_2184_3215 | 342 |
| 446 | 3300050511 | nmdc:mga08y16_25657_c1 | nmdc:mga08y16_25657_c1_4728_5756 | 342 |
| 447 | 3300050512 | nmdc:mga0n895_108911_c1 | nmdc:mga0n895_108911_c1_142_1173 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b5v-assembly1.cif.gz_B | the carbohydrate binding module family 48 (cbm48) and carboxy-terminal carbohydrate esterase family 1 (ce1) domains of the multidomain esterase dmce1b from dysgonomonas mossii | 0.8195 | 8 | 336 |
| 6ne9-assembly1.cif.gz_A | bacteroides intestinalis acetyl xylan esterase (bacint_01039) | 0.8146 | 8 | 337 |
| 5vol-assembly2.cif.gz_H | bacint_04212 ferulic acid esterase | 0.8144 | 10 | 339 |
| 7xrv-assembly1.cif.gz_H | bacteroides thetaiotaomicron ferulic acid esterase - s150a (bt_4077-s150a) complex with trans-methylferulate | 0.8079 | 10 | 342 |
| 6rzo-assembly1.cif.gz_B | crystal structure of the n-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme ce1-gh62-gh10 | 0.8068 | 8 | 335 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jt2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7951 | 8 | 339 | 3.40.50.1820 |
| 3wydB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7877 | 34 | 332 | 3.40.50.1820 |
| af_Q2FZQ0_2_248_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7748 | 6 | 342 | 3.40.50.1820 |
| af_A4HYV9_156_416_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7712 | 10 | 337 | 3.40.50.1820 |
| af_Q2FZQ0_2_248_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7661 | 6 | 342 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9YMB2-F1-model_v4 | Enterochelin esterase | 0.9951 | 55 | 341 |
|
| AF-A0A537J5S0-F1-model_v4 | Enterochelin esterase | 0.9883 | 176 | 342 |
|
| AF-A0A7J9YMB2-F1-model_v4 | Enterochelin esterase | 0.9883 | 55 | 341 |
|
| AF-A0A536HRQ0-F1-model_v4 | Enterochelin esterase | 0.9875 | 1 | 252 |
|
| AF-K0FBF9-F1-model_v4 | Esterase | 0.987 | 1 | 341 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar