F446001

General Info

Members Datasets Scaffolds Average Seq Length
447 237 447 337

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0017932|Ga0466964_0017932_1548_2642
Length 364
Sequence LTRIVPYSAIAVSVARRDLVEERLVEPWSREAVGRFEELEIESAALRDNPLGDPHVRPLWVYLPPAYDAEPERRFPSIYLIQGMTGQLDMWRNRTAFRPSVPELIDRLFAEEDCPPALVVAVDAWTSYGGSQFIDSPGTGRYGEYLCDEVVSFVDSRYRTLAEAAHRGLTGKSSGGYGAMVVPMLRPDVFGGLATHSGDALFELCYLPDFRDTARALRDEYDGSYERFWEDFRSRPSFTKQSDFPLVNTWAMAACYSANEDGSVDLPFDSDTGRLRDDVWQRWLAWDPVRMARRHADALRSQRAIYIDAGKRDEFFLDLGAEAFRRELEALGITDVFFELFDAKHGGIEYRYPLAIRYLAERLQ

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.33
Rhizosphere 83
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10096065 3300003316 Bacteria 2782
2 rootL2_10127790 3300003322 Bacteria 1201
3 Ga0070658_10042160 3300005327 Bacteria 3684
4 Ga0070658_10089617 3300005327 Bacteria 2533
5 Ga0070683_100022954 3300005329 Bacteria 5578
6 Ga0070683_100073626 3300005329 Bacteria 3189
7 Ga0070683_100388014 3300005329 Bacteria 1331
8 Ga0070680_100123353 3300005336 Bacteria 2163
9 Ga0070680_100161906 3300005336 Bacteria 1881
10 Ga0070660_100075320 3300005339 Bacteria 2642
11 Ga0070671_100124090 3300005355 Bacteria 2174
12 Ga0070659_100161739 3300005366 Bacteria 1831
13 Ga0070703_10000008 3300005406 Bacteria 97684
14 Ga0070714_100012027 3300005435 Bacteria 6887
15 Ga0070714_100094292 3300005435 Bacteria 2627
16 Ga0070714_100297544 3300005435 Bacteria 1503
17 Ga0070714_100447322 3300005435 Bacteria 1227
18 Ga0070713_100006517 3300005436 Bacteria 8104
19 Ga0070710_10001658 3300005437 Bacteria 10488
20 Ga0070710_10056248 3300005437 Bacteria 2226
21 Ga0070710_10091005 3300005437 Bacteria 1799
22 Ga0070711_100025670 3300005439 Bacteria 3856
23 Ga0070711_100228268 3300005439 Bacteria 1451
24 Ga0070700_100028625 3300005441 Bacteria 3316
25 Ga0070694_100257740 3300005444 Bacteria 1322
26 Ga0070708_100000744 3300005445 Bacteria 24674
27 Ga0070708_100001702 3300005445 Bacteria 16911
28 Ga0070708_100031902 3300005445 Bacteria 4565
29 Ga0070681_10081146 3300005458 Bacteria 3199
30 Ga0070681_10122195 3300005458 Bacteria 2537
31 Ga0068867_100104089 3300005459 Bacteria 2172
32 Ga0070706_100000040 3300005467 Bacteria 149660
33 Ga0070706_100001299 3300005467 Bacteria 26652
34 Ga0070706_100010197 3300005467 Bacteria 8738
35 Ga0070706_100018906 3300005467 Bacteria 6355
36 Ga0070707_100000419 3300005468 Bacteria 41972
37 Ga0070707_100002016 3300005468 Bacteria 19446
38 Ga0070707_100006897 3300005468 Bacteria 10518
39 Ga0070707_100011334 3300005468 Bacteria 8309
40 Ga0070707_100014906 3300005468 Bacteria 7291
41 Ga0070698_100001180 3300005471 Bacteria 29004
42 Ga0070698_100007227 3300005471 Bacteria 12031
43 Ga0070698_100041571 3300005471 Bacteria 4719
44 Ga0070698_100239037 3300005471 Bacteria 1749
45 Ga0070699_100000382 3300005518 Bacteria 43058
46 Ga0070679_100199332 3300005530 Bacteria 1968
47 Ga0070695_100000704 3300005545 Bacteria 17855
48 Ga0070693_100104138 3300005547 Bacteria 1734
49 Ga0068855_100051840 3300005563 Bacteria 4833
50 Ga0068855_100256517 3300005563 Bacteria 1949
51 Ga0070664_100063340 3300005564 Bacteria 3153
52 Ga0070664_100217687 3300005564 Bacteria 1708
53 Ga0068857_100000499 3300005577 Bacteria 28113
54 Ga0068852_100157545 3300005616 Bacteria 2117
55 Ga0068863_100289923 3300005841 Bacteria 1586
56 Ga0081455_10003895 3300005937 Bacteria 16994
57 Ga0081455_10018077 3300005937 Bacteria 6731
58 Ga0081455_10137224 3300005937 Bacteria 1904
59 Ga0081538_10000014 3300005981 Bacteria 151008
60 Ga0081539_10001492 3300005985 Bacteria 39584
61 Ga0070717_10000229 3300006028 Bacteria 38720
62 Ga0070717_10003918 3300006028 Bacteria 10714
63 Ga0070717_10014893 3300006028 Bacteria 5987
64 Ga0070717_10068242 3300006028 Bacteria 2959
65 Ga0070717_10122463 3300006028 Bacteria 2229
66 Ga0070717_10274415 3300006028 Bacteria 1494
67 Ga0070715_10049201 3300006163 Bacteria 1805
68 Ga0070716_100064175 3300006173 Bacteria 2134
69 Ga0097621_100205165 3300006237 Bacteria 1712
70 Ga0068871_100171479 3300006358 Bacteria 1860
71 Ga0075431_100287783 3300006847 Bacteria 1663
72 Ga0075434_100250152 3300006871 Bacteria 1792
73 Ga0075434_100345130 3300006871 Unclassified 1510
74 Ga0075429_100019048 3300006880 Bacteria 5946
75 Ga0105240_10019956 3300009093 Bacteria 8949
76 Ga0105240_10047194 3300009093 Bacteria 5452
77 Ga0111539_10009131 3300009094 Bacteria 12545
78 Ga0111539_10040195 3300009094 Bacteria 5632
79 Ga0105245_10014534 3300009098 Bacteria 6855
80 Ga0105245_10083947 3300009098 Bacteria 2916
81 Ga0105245_10120739 3300009098 Bacteria 2448
82 Ga0114129_10006697 3300009147 Bacteria 16362
83 Ga0105242_10063935 3300009176 Bacteria 3031
84 Ga0105248_10319696 3300009177 Bacteria 1748
85 Ga0105248_10543583 3300009177 Bacteria 1310
86 Ga0105237_10044267 3300009545 Bacteria 4482
87 Ga0105237_10252923 3300009545 Bacteria 1764
88 Ga0105239_10555591 3300010375 Bacteria 1308
89 Ga0157370_10022132 3300013104 Bacteria 6327
90 Ga0157370_10207895 3300013104 Bacteria 1814
91 Ga0157369_10017623 3300013105 Bacteria 8028
92 Ga0157369_10051559 3300013105 Bacteria 4453
93 Ga0157369_10056506 3300013105 Bacteria 4235
94 Ga0157374_10062900 3300013296 Bacteria 3480
95 Ga0163162_10225048 3300013306 Bacteria 2006
96 Ga0157372_10353972 3300013307 Bacteria 1711
97 Ga0157375_10101127 3300013308 Bacteria 2965
98 Ga0157377_10106473 3300014745 Bacteria 1679
99 Ga0157376_10083023 3300014969 Bacteria 2755
100 Ga0197907_11120046 3300020069 Bacteria 2254
101 Ga0206356_10055071 3300020070 Bacteria 3692
102 Ga0206354_11240619 3300020081 Bacteria 1424
103 Ga0206353_10334546 3300020082 Bacteria 2573
104 Ga0206353_10532889 3300020082 Bacteria 1963
105 Ga0207653_10000003 3300025885 Bacteria 268014
106 Ga0207692_10023830 3300025898 Bacteria 2837
107 Ga0207710_10054322 3300025900 Bacteria 1803
108 Ga0207699_10086550 3300025906 Bacteria 1957
109 Ga0207705_10014407 3300025909 Bacteria 5690
110 Ga0207705_10126181 3300025909 Bacteria 1902
111 Ga0207705_10204308 3300025909 Bacteria 1497
112 Ga0207684_10000012 3300025910 Bacteria 478666
113 Ga0207684_10000025 3300025910 Bacteria 316760
114 Ga0207684_10005330 3300025910 Bacteria 11890
115 Ga0207684_10035863 3300025910 Bacteria 4209
116 Ga0207684_10467817 3300025910 Bacteria 1082
117 Ga0207707_10137398 3300025912 Bacteria 2137
118 Ga0207707_10199966 3300025912 Bacteria 1742
119 Ga0207707_10220403 3300025912 Bacteria 1651
120 Ga0207671_10096966 3300025914 Bacteria 2229
121 Ga0207693_10004494 3300025915 Bacteria 11799
122 Ga0207693_10006840 3300025915 Bacteria 9419
123 Ga0207663_10023662 3300025916 Bacteria 3529
124 Ga0207660_10009617 3300025917 Bacteria 6258
125 Ga0207660_10098185 3300025917 Bacteria 2184
126 Ga0207657_10002568 3300025919 Bacteria 19643
127 Ga0207657_10122149 3300025919 Bacteria 2142
128 Ga0207657_10123908 3300025919 Bacteria 2124
129 Ga0207657_10166159 3300025919 Bacteria 1790
130 Ga0207652_10011628 3300025921 Bacteria 7100
131 Ga0207652_10089594 3300025921 Bacteria 2701
132 Ga0207652_10115016 3300025921 Bacteria 2389
133 Ga0207652_10183366 3300025921 Bacteria 1882
134 Ga0207646_10002945 3300025922 Bacteria 19734
135 Ga0207646_10003186 3300025922 Bacteria 18746
136 Ga0207646_10006253 3300025922 Bacteria 12358
137 Ga0207646_10024974 3300025922 Bacteria 5468
138 Ga0207694_10195065 3300025924 Bacteria 1646
139 Ga0207687_10009338 3300025927 Bacteria 6413
140 Ga0207687_10009952 3300025927 Bacteria 6224
141 Ga0207700_10000002 3300025928 Bacteria 775978
142 Ga0207664_10113794 3300025929 Bacteria 2254
143 Ga0207664_10160633 3300025929 Bacteria 1916
144 Ga0207664_10209182 3300025929 Bacteria 1687
145 Ga0207690_10013051 3300025932 Bacteria 4983
146 Ga0207706_10073062 3300025933 Bacteria 3016
147 Ga0207706_10255747 3300025933 Bacteria 1529
148 Ga0207686_10199418 3300025934 Bacteria 1432
149 Ga0207665_10000946 3300025939 Bacteria 19627
150 Ga0207665_10020029 3300025939 Bacteria 4394
151 Ga0207691_10151026 3300025940 Bacteria 2042
152 Ga0207711_10168648 3300025941 Bacteria 1985
153 Ga0207661_10034427 3300025944 Bacteria 3939
154 Ga0207661_10344011 3300025944 Bacteria 1344
155 Ga0207679_10068215 3300025945 Bacteria 2671
156 Ga0207667_10225850 3300025949 Bacteria 1918
157 Ga0207667_10297397 3300025949 Bacteria 1649
158 Ga0207640_10093499 3300025981 Bacteria 2089
159 Ga0207677_10286630 3300026023 Bacteria 1354
160 Ga0207703_10198494 3300026035 Bacteria 1781
161 Ga0207702_10481005 3300026078 Bacteria 1208
162 Ga0207702_10523750 3300026078 Bacteria 1157
163 Ga0207648_10061181 3300026089 Bacteria 3283
164 Ga0207648_10062399 3300026089 Bacteria 3249
165 Ga0207674_10003054 3300026116 Bacteria 20712
166 Ga0207674_10250494 3300026116 Bacteria 1718
167 Ga0207674_10319770 3300026116 Bacteria 1501
168 Ga0207675_100087900 3300026118 Bacteria 2919
169 Ga0207698_10129089 3300026142 Bacteria 2156
170 Ga0207698_10139090 3300026142 Bacteria 2088
171 Ga0209998_10032728 3300027717 Bacteria 1156
172 Ga0265319_1000493 3300028563 Bacteria 27401
173 Ga0265319_1002312 3300028563 Bacteria 10518
174 Ga0265319_1031983 3300028563 Bacteria 1828
175 Ga0265318_10000904 3300028577 Bacteria 19344
176 Ga0265322_10026210 3300028654 Bacteria 1666
177 Ga0265336_10002831 3300028666 Bacteria 6995
178 Ga0265338_10001954 3300028800 Bacteria 32161
179 Ga0265338_10006204 3300028800 Bacteria 15315
180 Ga0265338_10008638 3300028800 Bacteria 12320
181 Ga0265338_10010203 3300028800 Bacteria 11069
182 Ga0265324_10009549 3300029957 Bacteria 3781
183 Ga0265332_10085014 3300031238 Bacteria 1341
184 Ga0265320_10113501 3300031240 Bacteria 1239
185 Ga0265325_10000684 3300031241 Bacteria 24693
186 Ga0265340_10021432 3300031247 Bacteria 3314
187 Ga0265340_10067151 3300031247 Bacteria 1705
188 Ga0265339_10057795 3300031249 Bacteria 2096
189 Ga0265331_10007805 3300031250 Bacteria 6143
190 Ga0265327_10025453 3300031251 Bacteria 3449
191 Ga0265316_10012176 3300031344 Bacteria 7720
192 Ga0265316_10030665 3300031344 Bacteria 4404
193 Ga0307408_100090935 3300031548 Bacteria 2304
194 Ga0265313_10015647 3300031595 Bacteria 4404
195 Ga0265314_10134492 3300031711 Bacteria 1537
196 Ga0265342_10018790 3300031712 Bacteria 4467
197 Ga0307405_10007306 3300031731 Bacteria 5510
198 Ga0307405_10124223 3300031731 Unclassified 1772
199 Ga0307413_10015048 3300031824 Bacteria 3953
200 Ga0307410_10000655 3300031852 Bacteria 14288
201 Ga0307406_10003401 3300031901 Bacteria 8667
202 Ga0307406_10048416 3300031901 Bacteria 2684
203 Ga0307407_10000386 3300031903 Bacteria 13330
204 Ga0307412_10142582 3300031911 Bacteria 1757
205 Ga0307409_100011907 3300031995 Bacteria 5511
206 Ga0307416_100009181 3300032002 Bacteria 6450
207 Ga0307411_10021395 3300032005 Bacteria 3784
208 Ga0307411_10050860 3300032005 Bacteria 2701
209 Ga0307415_100000048 3300032126 Bacteria 51694
210 Ga0307415_100000685 3300032126 Bacteria 15054
211 Ga0316583_10010964 3300032133 Bacteria 3264
212 Ga0373947_0131114 3300035725 Bacteria 1600
213 Ga0395899_0158110 3300037312 Bacteria 1602
214 Ga0395900_0011199 3300037418 Bacteria 9173
215 Ga0395900_0334552 3300037418 Bacteria 1491
216 Ga0395898_0008697 3300037466 Bacteria 10712
217 Ga0395898_0052757 3300037466 Bacteria 3972
218 Ga0395898_0129609 3300037466 Bacteria 2416
219 Ga0395905_0014507 3300037471 Bacteria 7519
220 Ga0395905_0053618 3300037471 Bacteria 3774
221 Ga0395905_0060586 3300037471 Bacteria 3539
222 Ga0395901_0011693 3300038443 Bacteria 8894
223 Ga0395901_0031596 3300038443 Bacteria 5458
224 Ga0395901_0038306 3300038443 Bacteria 4958
225 Ga0436363_1391603 3300039450 Bacteria 1367
226 Ga0466969_0001165 3300044656 Bacteria 14153
227 Ga0466965_0149951 3300044683 Bacteria 1218
228 Ga0466966_0028321 3300044684 Bacteria 3650
229 Ga0466961_0010375 3300044693 Bacteria 5943
230 Ga0466961_0119853 3300044693 Bacteria 1652
231 Ga0466963_0000670 3300044694 Bacteria 16566
232 Ga0466963_0002100 3300044694 Bacteria 11008
233 Ga0466963_0005161 3300044694 Bacteria 7624
234 Ga0466963_0007823 3300044694 Bacteria 6395
235 Ga0466963_0044376 3300044694 Bacteria 2926
236 Ga0466963_0054735 3300044694 Bacteria 2652
237 Ga0466963_0069938 3300044694 Bacteria 2360
238 Ga0466963_0158154 3300044694 Bacteria 1576
239 Ga0466964_0003899 3300044706 Bacteria 5480
240 Ga0466964_0006438 3300044706 Bacteria 4375
241 Ga0466964_0011880 3300044706 Bacteria 3292
242 Ga0466964_0013963 3300044706 Bacteria 3051
243 Ga0466964_0017932 3300044706 Bacteria 2712
244 Ga0466968_0000609 3300044735 Bacteria 12198
245 Ga0466968_0066809 3300044735 Bacteria 1558
246 Ga0466968_0068722 3300044735 Bacteria 1539
247 Ga0466968_0083832 3300044735 Bacteria 1404
248 Ga0466970_0037886 3300044765 Bacteria 2557
249 Ga0466957_0008159 3300044842 Bacteria 5945
250 Ga0466957_0018272 3300044842 Bacteria 4117
251 Ga0466957_0020985 3300044842 Bacteria 3844
252 Ga0466957_0023718 3300044842 Bacteria 3629
253 Ga0466957_0031432 3300044842 Bacteria 3173
254 Ga0466957_0063034 3300044842 Bacteria 2278
255 Ga0466957_0066081 3300044842 Bacteria 2228
256 Ga0466960_0009561 3300044901 Bacteria 4001
257 Ga0466959_0003022 3300045049 Bacteria 10871
258 Ga0466959_0058211 3300045049 Bacteria 2814
259 Ga0466959_0063996 3300045049 Bacteria 2670
260 Ga0466959_0113946 3300045049 Bacteria 1927
261 Ga0451576_0265534 3300045051 Bacteria 1794
262 Ga0466958_0025720 3300045836 Bacteria 3473
263 Ga0466958_0026565 3300045836 Bacteria 3422
264 Ga0466958_0031190 3300045836 Bacteria 3167
265 Ga0466958_0035495 3300045836 Bacteria 2979
266 Ga0466958_0038301 3300045836 Bacteria 2876
267 Ga0466958_0039868 3300045836 Bacteria 2822
268 Ga0466967_0017358 3300045976 Bacteria 5711
269 Ga0466967_0032105 3300045976 Bacteria 4430
270 Ga0466967_0034238 3300045976 Bacteria 4309
271 Ga0466967_0036586 3300045976 Bacteria 4192
272 Ga0466967_0048489 3300045976 Bacteria 3709
273 Ga0466967_0216774 3300045976 Bacteria 1817
274 Ga0466967_0219266 3300045976 Bacteria 1807
275 Ga0466967_0283192 3300045976 Bacteria 1591
276 Ga0466967_0346385 3300045976 Bacteria 1437
277 Ga0495592_0015233 3300046454 Bacteria 5837
278 Ga0495592_0034832 3300046454 Bacteria 3794
279 Ga0495603_0016483 3300046455 Bacteria 4470
280 Ga0495591_032637 3300046458 Bacteria 1548
281 Ga0495629_0006286 3300046459 Bacteria 8814
282 Ga0495641_0010889 3300046461 Bacteria 5227
283 Ga0495641_0035936 3300046461 Unclassified 2331
284 Ga0495641_0041532 3300046461 Bacteria 2136
285 Ga0495653_0095267 3300046463 Bacteria 2167
286 Ga0495580_0169677 3300046472 Bacteria 1509
287 Ga0495582_0023218 3300046473 Bacteria 3393
288 Ga0495584_0047214 3300046491 Bacteria 2171
289 Ga0495584_0131449 3300046491 Bacteria 1270
290 Ga0495607_0119710 3300046501 Bacteria 1384
291 Ga0495608_0049020 3300046511 Bacteria 2805
292 Ga0495618_0171268 3300046514 Bacteria 1381
293 Ga0495628_0048562 3300046516 Bacteria 3363
294 Ga0495644_0066116 3300046523 Bacteria 1358
295 Ga0495663_0046636 3300046525 Bacteria 1332
296 Ga0495666_0151759 3300046526 Bacteria 1077
297 Ga0495652_0065507 3300046529 Bacteria 3052
298 Ga0495652_0135950 3300046529 Bacteria 1939
299 Ga0495586_0090238 3300046535 Bacteria 1692
300 Ga0495587_0025151 3300046536 Bacteria 3640
301 Ga0495587_0070353 3300046536 Bacteria 2036
302 Ga0495609_0036278 3300046538 Bacteria 2227
303 Ga0495633_0087516 3300046558 Bacteria 1449
304 Ga0495667_0045700 3300046559 Bacteria 2898
305 Ga0495656_0138339 3300046615 Bacteria 1165
306 Ga0495634_0018613 3300046642 Bacteria 4941
307 Ga0495611_0099704 3300046648 Bacteria 1348
308 Ga0495657_0029971 3300046675 Bacteria 3813
309 Ga0495657_0062731 3300046675 Bacteria 2454
310 Ga0495646_0082407 3300046680 Bacteria 1872
311 Ga0495647_0042168 3300046681 Bacteria 1741
312 Ga0495658_0237585 3300046683 Bacteria 1144
313 Ga0495613_0009939 3300046689 Bacteria 7072
314 Ga0495613_0061658 3300046689 Bacteria 2745
315 Ga0495624_0008262 3300046690 Bacteria 7276
316 Ga0495589_0046158 3300046794 Bacteria 2163
317 Ga0495581_0021287 3300047315 Unclassified 3760
318 Ga0495674_0083755 3300047319 Bacteria 2733
319 Ga0495676_0027336 3300047321 Unclassified 4893
320 Ga0495676_0212742 3300047321 Bacteria 1337
321 Ga0495680_0102270 3300047322 Bacteria 2133
322 Ga0495679_031204 3300047446 Bacteria 1721
323 Ga0495684_0119986 3300047471 Bacteria 1981
324 Ga0495684_0296001 3300047471 Bacteria 1163
325 Ga0495602_0063737 3300048088 Bacteria 3192
326 Ga0495602_0140744 3300048088 Bacteria 1910
327 Ga0495614_0077530 3300048089 Bacteria 1437
328 Ga0495614_0108473 3300048089 Bacteria 1218
329 Ga0496100_0030746 3300048903 Bacteria 3333
330 Ga0496100_0083550 3300048903 Bacteria 2162
331 Ga0496100_0101778 3300048903 Bacteria 1981
332 Ga0496101_0002611 3300048904 Bacteria 11068
333 Ga0496101_0036972 3300048904 Bacteria 3461
334 Ga0496101_0044844 3300048904 Bacteria 3165
335 Ga0496101_0205653 3300048904 Bacteria 1523
336 Ga0496102_0026366 3300048905 Bacteria 5183
337 Ga0496102_0045339 3300048905 Bacteria 3992
338 Ga0496102_0124876 3300048905 Bacteria 2405
339 Ga0496102_0159653 3300048905 Bacteria 2120
340 Ga0496103_0049425 3300048906 Bacteria 2600
341 Ga0496104_0015191 3300048907 Bacteria 6970
342 Ga0496104_0036560 3300048907 Bacteria 4591
343 Ga0496104_0039687 3300048907 Bacteria 4408
344 Ga0496104_0139931 3300048907 Bacteria 2325
345 Ga0496104_0198270 3300048907 Bacteria 1919
346 Ga0496105_0001598 3300048908 Bacteria 16044
347 Ga0496105_0026527 3300048908 Bacteria 4727
348 Ga0496105_0046583 3300048908 Bacteria 3579
349 Ga0496105_0131956 3300048908 Bacteria 2059
350 Ga0496106_0003549 3300048909 Bacteria 11613
351 Ga0496106_0022750 3300048909 Bacteria 4657
352 Ga0496107_0001666 3300048910 Bacteria 13881
353 Ga0496107_0026577 3300048910 Bacteria 4104
354 Ga0496107_0116238 3300048910 Bacteria 1969
355 Ga0496107_0117845 3300048910 Bacteria 1955
356 Ga0496108_0015237 3300048911 Bacteria 6273
357 Ga0496108_0028939 3300048911 Bacteria 4584
358 Ga0496108_0056899 3300048911 Bacteria 3286
359 Ga0496108_0104404 3300048911 Bacteria 2418
360 Ga0496109_0004156 3300048912 Bacteria 12085
361 Ga0496109_0010000 3300048912 Bacteria 8098
362 Ga0496109_0011570 3300048912 Bacteria 7592
363 Ga0496109_0035851 3300048912 Bacteria 4478
364 Ga0496109_0052969 3300048912 Bacteria 3699
365 Ga0496109_0063568 3300048912 Bacteria 3376
366 Ga0496109_0077220 3300048912 Bacteria 3064
367 Ga0496109_0452118 3300048912 Bacteria 1213
368 Ga0496110_0002408 3300048913 Bacteria 14006
369 Ga0496110_0005286 3300048913 Bacteria 10108
370 Ga0496110_0019031 3300048913 Bacteria 5771
371 Ga0496110_0038267 3300048913 Bacteria 4173
372 Ga0496110_0244088 3300048913 Bacteria 1634
373 Ga0496110_0350385 3300048913 Bacteria 1345
374 Ga0496110_0389727 3300048913 Bacteria 1270
375 Ga0496111_0013436 3300048914 Bacteria 5572
376 Ga0496111_0019657 3300048914 Bacteria 4697
377 Ga0496111_0021446 3300048914 Bacteria 4511
378 Ga0496111_0023356 3300048914 Bacteria 4340
379 Ga0496111_0070860 3300048914 Bacteria 2537
380 Ga0496111_0103259 3300048914 Bacteria 2096
381 Ga0496111_0163345 3300048914 Bacteria 1654
382 Ga0496112_0001699 3300048915 Bacteria 17181
383 Ga0496112_0019234 3300048915 Bacteria 6441
384 Ga0496112_0038477 3300048915 Bacteria 4671
385 Ga0496112_0040831 3300048915 Bacteria 4537
386 Ga0496112_0178866 3300048915 Bacteria 2085
387 Ga0496113_0043447 3300048916 Bacteria 3326
388 Ga0496113_0044155 3300048916 Bacteria 3301
389 Ga0496113_0101670 3300048916 Bacteria 2228
390 Ga0496113_0128964 3300048916 Bacteria 1983
391 Ga0496113_0139375 3300048916 Bacteria 1907
392 Ga0496114_0001888 3300048917 Bacteria 15905
393 Ga0496114_0011412 3300048917 Bacteria 7100
394 Ga0496114_0013176 3300048917 Bacteria 6628
395 Ga0496114_0106629 3300048917 Bacteria 2397
396 Ga0496114_0254702 3300048917 Bacteria 1545
397 Ga0496114_0274474 3300048917 Bacteria 1486
398 Ga0496115_0026528 3300048918 Bacteria 4522
399 Ga0496115_0033406 3300048918 Bacteria 4062
400 Ga0496115_0076069 3300048918 Bacteria 2728
401 Ga0496115_0129753 3300048918 Bacteria 2077
402 Ga0501031_0007852 3300049568 Bacteria 6945
403 Ga0501036_0016262 3300049572 Bacteria 6214
404 Ga0501037_0197575 3300049573 Bacteria 1422
405 Ga0501038_0024982 3300049574 Bacteria 5327
406 Ga0501039_0003904 3300049575 Bacteria 11197
407 Ga0501040_0026516 3300049576 Bacteria 3898
408 Ga0501041_0118619 3300049577 Bacteria 1643
409 Ga0501043_0283233 3300049579 Bacteria 1270
410 Ga0501046_0141159 3300049580 Bacteria 1823
411 Ga0501048_0017473 3300049582 Bacteria 5282
412 Ga0501067_0206395 3300049583 Bacteria 1094
413 Ga0501068_0128834 3300049584 Bacteria 1581
414 Ga0501069_0002071 3300049585 Bacteria 10088
415 Ga0501069_0090015 3300049585 Bacteria 1735
416 Ga0501071_0001608 3300049587 Bacteria 13247
417 Ga0501071_0029691 3300049587 Bacteria 3861
418 Ga0501072_0019086 3300049588 Bacteria 5295
419 Ga0501072_0077698 3300049588 Bacteria 2628
420 Ga0501076_0096712 3300049592 Bacteria 2378
421 Ga0501079_0077441 3300049741 Bacteria 2572
422 Ga0501080_0228776 3300049742 Bacteria 1700
423 Ga0501081_0021012 3300049743 Bacteria 4357
424 Ga0501081_0091433 3300049743 Bacteria 2140
425 Ga0501081_0153323 3300049743 Bacteria 1656
426 Ga0501035_0122432 3300049822 Bacteria 2273
427 Ga0501045_0119519 3300049824 Bacteria 1956
428 Ga0501045_0223850 3300049824 Bacteria 1400
429 nmdc:mga05p37_43980_c1 3300050507 Bacteria 5495
430 nmdc:mga05p37_755521_c1 3300050507 Bacteria 1071
431 nmdc:mga09592_85545_c1 3300050508 Bacteria 2690
432 nmdc:mga0qj67_67769_c1 3300050509 Bacteria 2844
433 nmdc:mga06r32_58766_c1 3300050510 Bacteria 3696
434 nmdc:mga08y16_105171_c1 3300050511 Bacteria 2939
435 nmdc:mga08y16_25657_c1 3300050511 Bacteria 6219
436 nmdc:mga0n895_108911_c1 3300050512 Bacteria 2785
437 nmdc:mga0n895_313599_c1 3300050512 Unclassified 1589
438 nmdc:mga0n895_44121_c1 3300050512 Bacteria 4348
439 nmdc:mga0n895_68113_c1 3300050512 Bacteria 3526
440 Ga0495601_0003619 3300053077 Bacteria 8886
441 Ga0495612_0071605 3300053078 Bacteria 1446
442 Ga0495655_0036569 3300053083 Bacteria 1229
443 Ga0495595_0091393 3300053084 Bacteria 1460
444 Ga0495619_0109635 3300053085 Bacteria 1885
445 Ga0501084_0474434 3300054114 Bacteria 1057
446 Ga0466962_0005111 3300061719 Bacteria 6310
447 Ga0466962_0007151 3300061719 Bacteria 5347

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0474434 Ga0501084_0474434_186_1040 259
2 3300049572 Ga0501036_0016262 Ga0501036_0016262_1390_2262 265
3 3300049574 Ga0501038_0024982 Ga0501038_0024982_393_1265 265
4 3300049579 Ga0501043_0283233 Ga0501043_0283233_25_897 265
5 3300048917 Ga0496114_0274474 Ga0496114_0274474_69_893 274
6 3300028654 Ga0265322_10026210 Ga0265322_100262103 275
7 3300027717 Ga0209998_10032728 Ga0209998_100327282 299
8 3300035725 Ga0373947_0131114 Ga0373947_0131114_659_1567 302
9 3300046683 Ga0495658_0237585 Ga0495658_0237585_181_1089 302
10 3300050507 nmdc:mga05p37_755521_c1 nmdc:mga05p37_755521_c1_25_936 303
11 3300048089 Ga0495614_0077530 Ga0495614_0077530_499_1416 305
12 3300048913 Ga0496110_0038267 Ga0496110_0038267_27_950 307
13 3300013104 Ga0157370_10207895 Ga0157370_102078953 316
14 3300013105 Ga0157369_10051559 Ga0157369_100515595 316
15 3300049568 Ga0501031_0007852 Ga0501031_0007852_2265_3305 317
16 3300049573 Ga0501037_0197575 Ga0501037_0197575_199_1239 317
17 3300049575 Ga0501039_0003904 Ga0501039_0003904_318_1358 317
18 3300049576 Ga0501040_0026516 Ga0501040_0026516_1361_2401 317
19 3300049577 Ga0501041_0118619 Ga0501041_0118619_122_1162 317
20 3300049580 Ga0501046_0141159 Ga0501046_0141159_600_1640 317
21 3300049582 Ga0501048_0017473 Ga0501048_0017473_3808_4848 317
22 3300049587 Ga0501071_0001608 Ga0501071_0001608_6115_7155 317
23 3300049588 Ga0501072_0019086 Ga0501072_0019086_713_1753 317
24 3300049592 Ga0501076_0096712 Ga0501076_0096712_28_1068 317
25 3300049741 Ga0501079_0077441 Ga0501079_0077441_758_1798 317
26 3300049742 Ga0501080_0228776 Ga0501080_0228776_256_1296 317
27 3300049743 Ga0501081_0021012 Ga0501081_0021012_2442_3482 317
28 3300049822 Ga0501035_0122432 Ga0501035_0122432_17_1057 317
29 3300049824 Ga0501045_0119519 Ga0501045_0119519_437_1477 317
30 3300049584 Ga0501068_0128834 Ga0501068_0128834_373_1512 322
31 3300049585 Ga0501069_0002071 Ga0501069_0002071_236_1375 322
32 3300049587 Ga0501071_0029691 Ga0501071_0029691_2506_3645 322
33 3300044694 Ga0466963_0005161 Ga0466963_0005161_4822_5817 326
34 3300005327 Ga0070658_10042160 Ga0070658_100421604 328
35 3300005336 Ga0070680_100123353 Ga0070680_1001233532 328
36 3300005339 Ga0070660_100075320 Ga0070660_1000753203 328
37 3300005563 Ga0068855_100051840 Ga0068855_1000518405 328
38 3300005616 Ga0068852_100157545 Ga0068852_1001575453 328
39 3300009093 Ga0105240_10019956 Ga0105240_100199566 328
40 3300009545 Ga0105237_10252923 Ga0105237_102529233 328
41 3300013104 Ga0157370_10022132 Ga0157370_100221322 328
42 3300013105 Ga0157369_10056506 Ga0157369_100565063 328
43 3300020069 Ga0197907_11120046 Ga0197907_111200461 328
44 3300020070 Ga0206356_10055071 Ga0206356_100550713 328
45 3300020082 Ga0206353_10532889 Ga0206353_105328893 328
46 3300025909 Ga0207705_10204308 Ga0207705_102043083 328
47 3300025917 Ga0207660_10098185 Ga0207660_100981853 328
48 3300025919 Ga0207657_10123908 Ga0207657_101239083 328
49 3300025921 Ga0207652_10183366 Ga0207652_101833663 328
50 3300025924 Ga0207694_10195065 Ga0207694_101950652 328
51 3300025949 Ga0207667_10225850 Ga0207667_102258503 328
52 3300026142 Ga0207698_10139090 Ga0207698_101390903 328
53 3300005327 Ga0070658_10089617 Ga0070658_100896172 329
54 3300044842 Ga0466957_0018272 Ga0466957_0018272_213_1202 329
55 3300044684 Ga0466966_0028321 Ga0466966_0028321_820_1815 330
56 3300045049 Ga0466959_0003022 Ga0466959_0003022_8862_9857 330
57 3300045976 Ga0466967_0034238 Ga0466967_0034238_1633_2625 330
58 3300013105 Ga0157369_10017623 Ga0157369_100176233 331
59 3300025909 Ga0207705_10014407 Ga0207705_100144073 331
60 3300025919 Ga0207657_10122149 Ga0207657_101221493 331
61 3300037312 Ga0395899_0158110 Ga0395899_0158110_485_1483 332
62 3300044656 Ga0466969_0001165 Ga0466969_0001165_1496_2494 332
63 3300044693 Ga0466961_0119853 Ga0466961_0119853_155_1153 332
64 3300044694 Ga0466963_0044376 Ga0466963_0044376_941_1939 332
65 3300044694 Ga0466963_0054735 Ga0466963_0054735_164_1162 332
66 3300044706 Ga0466964_0011880 Ga0466964_0011880_164_1162 332
67 3300044735 Ga0466968_0000609 Ga0466968_0000609_981_1979 332
68 3300044765 Ga0466970_0037886 Ga0466970_0037886_1280_2278 332
69 3300044842 Ga0466957_0020985 Ga0466957_0020985_299_1297 332
70 3300045049 Ga0466959_0063996 Ga0466959_0063996_645_1643 332
71 3300045836 Ga0466958_0026565 Ga0466958_0026565_1608_2606 332
72 3300045836 Ga0466958_0038301 Ga0466958_0038301_1381_2379 332
73 3300045976 Ga0466967_0032105 Ga0466967_0032105_1035_2033 332
74 3300045976 Ga0466967_0048489 Ga0466967_0048489_2328_3326 332
75 3300046459 Ga0495629_0006286 Ga0495629_0006286_4065_5063 332
76 3300046461 Ga0495641_0010889 Ga0495641_0010889_1045_2043 332
77 3300046472 Ga0495580_0169677 Ga0495580_0169677_239_1237 332
78 3300046473 Ga0495582_0023218 Ga0495582_0023218_949_1947 332
79 3300046511 Ga0495608_0049020 Ga0495608_0049020_1745_2743 332
80 3300046514 Ga0495618_0171268 Ga0495618_0171268_110_1108 332
81 3300046526 Ga0495666_0151759 Ga0495666_0151759_29_1027 332
82 3300046558 Ga0495633_0087516 Ga0495633_0087516_228_1226 332
83 3300046615 Ga0495656_0138339 Ga0495656_0138339_11_1009 332
84 3300046642 Ga0495634_0018613 Ga0495634_0018613_3785_4783 332
85 3300046689 Ga0495613_0061658 Ga0495613_0061658_1656_2654 332
86 3300046794 Ga0495589_0046158 Ga0495589_0046158_991_1989 332
87 3300048908 Ga0496105_0001598 Ga0496105_0001598_1756_2754 332
88 3300048912 Ga0496109_0010000 Ga0496109_0010000_1756_2754 332
89 3300048913 Ga0496110_0350385 Ga0496110_0350385_255_1253 332
90 3300048913 Ga0496110_0389727 Ga0496110_0389727_234_1232 332
91 3300009098 Ga0105245_10083947 Ga0105245_100839471 333
92 3300045836 Ga0466958_0035495 Ga0466958_0035495_1024_2025 333
93 3300046461 Ga0495641_0041532 Ga0495641_0041532_474_1475 333
94 3300046536 Ga0495587_0025151 Ga0495587_0025151_1556_2557 333
95 3300046680 Ga0495646_0082407 Ga0495646_0082407_110_1111 333
96 3300048912 Ga0496109_0077220 Ga0496109_0077220_850_1851 333
97 3300048916 Ga0496113_0139375 Ga0496113_0139375_406_1407 333
98 3300049583 Ga0501067_0206395 Ga0501067_0206395_68_1069 333
99 3300049585 Ga0501069_0090015 Ga0501069_0090015_355_1356 333
100 3300005435 Ga0070714_100094292 Ga0070714_1000942922 335
101 3300025929 Ga0207664_10113794 Ga0207664_101137943 335
102 3300048907 Ga0496104_0198270 Ga0496104_0198270_450_1457 335
103 3300048908 Ga0496105_0131956 Ga0496105_0131956_752_1759 335
104 3300048911 Ga0496108_0028939 Ga0496108_0028939_3515_4522 335
105 3300048912 Ga0496109_0035851 Ga0496109_0035851_1265_2272 335
106 3300048915 Ga0496112_0038477 Ga0496112_0038477_3551_4558 335
107 3300048915 Ga0496112_0178866 Ga0496112_0178866_369_1388 335
108 3300005435 Ga0070714_100012027 Ga0070714_1000120274 336
109 3300005436 Ga0070713_100006517 Ga0070713_1000065174 336
110 3300006028 Ga0070717_10274415 Ga0070717_102744152 336
111 3300006871 Ga0075434_100345130 Ga0075434_1003451302 336
112 3300025928 Ga0207700_10000002 Ga0207700_10000002219 336
113 3300025939 Ga0207665_10020029 Ga0207665_100200292 336
114 3300048913 Ga0496110_0244088 Ga0496110_0244088_435_1445 336
115 3300048914 Ga0496111_0070860 Ga0496111_0070860_1254_2264 336
116 3300005471 Ga0070698_100239037 Ga0070698_1002390372 337
117 3300006173 Ga0070716_100064175 Ga0070716_1000641753 337
118 3300044735 Ga0466968_0083832 Ga0466968_0083832_173_1186 337
119 3300005981 Ga0081538_10000014 Ga0081538_1000001426 338
120 3300049588 Ga0501072_0077698 Ga0501072_0077698_908_1930 338
121 3300049743 Ga0501081_0091433 Ga0501081_0091433_90_1112 338
122 3300049824 Ga0501045_0223850 Ga0501045_0223850_65_1087 338
123 3300005445 Ga0070708_100000744 Ga0070708_10000074412 339
124 3300005458 Ga0070681_10081146 Ga0070681_100811461 339
125 3300005467 Ga0070706_100010197 Ga0070706_1000101973 339
126 3300020082 Ga0206353_10334546 Ga0206353_103345462 339
127 3300025910 Ga0207684_10005330 Ga0207684_1000533010 339
128 3300025910 Ga0207684_10467817 Ga0207684_104678171 339
129 3300025912 Ga0207707_10137398 Ga0207707_101373983 339
130 3300025917 Ga0207660_10009617 Ga0207660_100096177 339
131 3300025921 Ga0207652_10011628 Ga0207652_100116286 339
132 3300038443 Ga0395901_0031596 Ga0395901_0031596_1591_2610 339
133 3300046535 Ga0495586_0090238 Ga0495586_0090238_66_1088 339
134 3300046689 Ga0495613_0009939 Ga0495613_0009939_103_1125 339
135 3300048913 Ga0496110_0002408 Ga0496110_0002408_11349_12368 339
136 3300048914 Ga0496111_0023356 Ga0496111_0023356_121_1140 339
137 3300048915 Ga0496112_0019234 Ga0496112_0019234_2705_3724 339
138 3300048915 Ga0496112_0040831 Ga0496112_0040831_2338_3357 339
139 3300048916 Ga0496113_0043447 Ga0496113_0043447_2204_3223 339
140 3300048917 Ga0496114_0254702 Ga0496114_0254702_163_1182 339
141 3300050512 nmdc:mga0n895_44121_c1 nmdc:mga0n895_44121_c1_773_1792 339
142 3300003322 rootL2_10127790 rootL2_101277901 340
143 3300005329 Ga0070683_100022954 Ga0070683_1000229543 340
144 3300005336 Ga0070680_100161906 Ga0070680_1001619062 340
145 3300005355 Ga0070671_100124090 Ga0070671_1001240901 340
146 3300005435 Ga0070714_100297544 Ga0070714_1002975442 340
147 3300005435 Ga0070714_100447322 Ga0070714_1004473222 340
148 3300005437 Ga0070710_10001658 Ga0070710_1000165812 340
149 3300005437 Ga0070710_10056248 Ga0070710_100562485 340
150 3300005437 Ga0070710_10091005 Ga0070710_100910051 340
151 3300005439 Ga0070711_100025670 Ga0070711_1000256702 340
152 3300005439 Ga0070711_100228268 Ga0070711_1002282682 340
153 3300005444 Ga0070694_100257740 Ga0070694_1002577401 340
154 3300005458 Ga0070681_10122195 Ga0070681_101221953 340
155 3300005459 Ga0068867_100104089 Ga0068867_1001040893 340
156 3300005468 Ga0070707_100000419 Ga0070707_10000041946 340
157 3300005530 Ga0070679_100199332 Ga0070679_1001993322 340
158 3300005545 Ga0070695_100000704 Ga0070695_1000007042 340
159 3300005563 Ga0068855_100256517 Ga0068855_1002565172 340
160 3300005841 Ga0068863_100289923 Ga0068863_1002899232 340
161 3300005937 Ga0081455_10137224 Ga0081455_101372242 340
162 3300006028 Ga0070717_10003918 Ga0070717_1000391811 340
163 3300006028 Ga0070717_10014893 Ga0070717_100148936 340
164 3300006028 Ga0070717_10068242 Ga0070717_100682422 340
165 3300006028 Ga0070717_10122463 Ga0070717_101224632 340
166 3300006163 Ga0070715_10049201 Ga0070715_100492012 340
167 3300006237 Ga0097621_100205165 Ga0097621_1002051652 340
168 3300006358 Ga0068871_100171479 Ga0068871_1001714792 340
169 3300006871 Ga0075434_100250152 Ga0075434_1002501522 340
170 3300009093 Ga0105240_10047194 Ga0105240_100471943 340
171 3300009098 Ga0105245_10014534 Ga0105245_100145345 340
172 3300009176 Ga0105242_10063935 Ga0105242_100639352 340
173 3300009177 Ga0105248_10319696 Ga0105248_103196962 340
174 3300009545 Ga0105237_10044267 Ga0105237_100442676 340
175 3300010375 Ga0105239_10555591 Ga0105239_105555911 340
176 3300013296 Ga0157374_10062900 Ga0157374_100629002 340
177 3300013307 Ga0157372_10353972 Ga0157372_103539722 340
178 3300014969 Ga0157376_10083023 Ga0157376_100830234 340
179 3300025898 Ga0207692_10023830 Ga0207692_100238302 340
180 3300025900 Ga0207710_10054322 Ga0207710_100543222 340
181 3300025906 Ga0207699_10086550 Ga0207699_100865502 340
182 3300025909 Ga0207705_10126181 Ga0207705_101261811 340
183 3300025912 Ga0207707_10199966 Ga0207707_101999662 340
184 3300025912 Ga0207707_10220403 Ga0207707_102204032 340
185 3300025914 Ga0207671_10096966 Ga0207671_100969662 340
186 3300025915 Ga0207693_10004494 Ga0207693_100044946 340
187 3300025915 Ga0207693_10006840 Ga0207693_100068402 340
188 3300025916 Ga0207663_10023662 Ga0207663_100236624 340
189 3300025919 Ga0207657_10002568 Ga0207657_1000256811 340
190 3300025921 Ga0207652_10089594 Ga0207652_100895942 340
191 3300025922 Ga0207646_10003186 Ga0207646_100031862 340
192 3300025927 Ga0207687_10009338 Ga0207687_100093384 340
193 3300025929 Ga0207664_10160633 Ga0207664_101606332 340
194 3300025929 Ga0207664_10209182 Ga0207664_102091822 340
195 3300025932 Ga0207690_10013051 Ga0207690_100130514 340
196 3300025934 Ga0207686_10199418 Ga0207686_101994182 340
197 3300025939 Ga0207665_10000946 Ga0207665_100009463 340
198 3300025949 Ga0207667_10297397 Ga0207667_102973972 340
199 3300026078 Ga0207702_10481005 Ga0207702_104810051 340
200 3300026089 Ga0207648_10061181 Ga0207648_100611813 340
201 3300026116 Ga0207674_10319770 Ga0207674_103197701 340
202 3300028563 Ga0265319_1000493 Ga0265319_100049318 340
203 3300028563 Ga0265319_1031983 Ga0265319_10319833 340
204 3300028577 Ga0265318_10000904 Ga0265318_100009046 340
205 3300028666 Ga0265336_10002831 Ga0265336_100028315 340
206 3300028800 Ga0265338_10001954 Ga0265338_1000195410 340
207 3300028800 Ga0265338_10008638 Ga0265338_100086384 340
208 3300028800 Ga0265338_10010203 Ga0265338_100102036 340
209 3300029957 Ga0265324_10009549 Ga0265324_100095491 340
210 3300031238 Ga0265332_10085014 Ga0265332_100850142 340
211 3300031240 Ga0265320_10113501 Ga0265320_101135011 340
212 3300031344 Ga0265316_10012176 Ga0265316_100121768 340
213 3300031711 Ga0265314_10134492 Ga0265314_101344922 340
214 3300031901 Ga0307406_10048416 Ga0307406_100484163 340
215 3300032005 Ga0307411_10050860 Ga0307411_100508603 340
216 3300032126 Ga0307415_100000048 Ga0307415_10000004852 340
217 3300032133 Ga0316583_10010964 Ga0316583_100109643 340
218 3300037418 Ga0395900_0011199 Ga0395900_0011199_3165_4187 340
219 3300037418 Ga0395900_0334552 Ga0395900_0334552_336_1358 340
220 3300037466 Ga0395898_0052757 Ga0395898_0052757_952_1974 340
221 3300037466 Ga0395898_0129609 Ga0395898_0129609_1377_2399 340
222 3300037471 Ga0395905_0053618 Ga0395905_0053618_2096_3118 340
223 3300038443 Ga0395901_0038306 Ga0395901_0038306_2217_3239 340
224 3300044683 Ga0466965_0149951 Ga0466965_0149951_68_1090 340
225 3300044693 Ga0466961_0010375 Ga0466961_0010375_3309_4331 340
226 3300044694 Ga0466963_0000670 Ga0466963_0000670_12744_13766 340
227 3300044694 Ga0466963_0002100 Ga0466963_0002100_1184_2206 340
228 3300044694 Ga0466963_0007823 Ga0466963_0007823_1804_2826 340
229 3300044694 Ga0466963_0069938 Ga0466963_0069938_1040_2062 340
230 3300044694 Ga0466963_0158154 Ga0466963_0158154_388_1410 340
231 3300044706 Ga0466964_0003899 Ga0466964_0003899_647_1669 340
232 3300044706 Ga0466964_0006438 Ga0466964_0006438_1632_2654 340
233 3300044706 Ga0466964_0017932 Ga0466964_0017932_1548_2642 340
234 3300044735 Ga0466968_0066809 Ga0466968_0066809_106_1200 340
235 3300044735 Ga0466968_0068722 Ga0466968_0068722_366_1388 340
236 3300044842 Ga0466957_0008159 Ga0466957_0008159_390_1412 340
237 3300044842 Ga0466957_0023718 Ga0466957_0023718_1948_2970 340
238 3300044842 Ga0466957_0031432 Ga0466957_0031432_2122_3144 340
239 3300044842 Ga0466957_0063034 Ga0466957_0063034_970_1992 340
240 3300044842 Ga0466957_0066081 Ga0466957_0066081_766_1860 340
241 3300044901 Ga0466960_0009561 Ga0466960_0009561_2222_3244 340
242 3300045049 Ga0466959_0058211 Ga0466959_0058211_877_1899 340
243 3300045049 Ga0466959_0113946 Ga0466959_0113946_557_1579 340
244 3300045836 Ga0466958_0031190 Ga0466958_0031190_2134_3156 340
245 3300045836 Ga0466958_0039868 Ga0466958_0039868_1226_2248 340
246 3300045976 Ga0466967_0017358 Ga0466967_0017358_3698_4720 340
247 3300045976 Ga0466967_0036586 Ga0466967_0036586_2590_3612 340
248 3300045976 Ga0466967_0216774 Ga0466967_0216774_569_1594 340
249 3300045976 Ga0466967_0219266 Ga0466967_0219266_120_1142 340
250 3300045976 Ga0466967_0283192 Ga0466967_0283192_512_1534 340
251 3300045976 Ga0466967_0346385 Ga0466967_0346385_370_1392 340
252 3300046454 Ga0495592_0015233 Ga0495592_0015233_3041_4063 340
253 3300046454 Ga0495592_0034832 Ga0495592_0034832_2335_3357 340
254 3300046455 Ga0495603_0016483 Ga0495603_0016483_105_1127 340
255 3300046461 Ga0495641_0035936 Ga0495641_0035936_10_1032 340
256 3300046463 Ga0495653_0095267 Ga0495653_0095267_10_1032 340
257 3300046491 Ga0495584_0047214 Ga0495584_0047214_576_1598 340
258 3300046491 Ga0495584_0131449 Ga0495584_0131449_85_1107 340
259 3300046501 Ga0495607_0119710 Ga0495607_0119710_254_1276 340
260 3300046516 Ga0495628_0048562 Ga0495628_0048562_595_1617 340
261 3300046523 Ga0495644_0066116 Ga0495644_0066116_180_1202 340
262 3300046529 Ga0495652_0065507 Ga0495652_0065507_712_1734 340
263 3300046529 Ga0495652_0135950 Ga0495652_0135950_815_1837 340
264 3300046536 Ga0495587_0070353 Ga0495587_0070353_787_1809 340
265 3300046559 Ga0495667_0045700 Ga0495667_0045700_1545_2567 340
266 3300046648 Ga0495611_0099704 Ga0495611_0099704_90_1112 340
267 3300046675 Ga0495657_0029971 Ga0495657_0029971_1374_2396 340
268 3300046675 Ga0495657_0062731 Ga0495657_0062731_1184_2206 340
269 3300046681 Ga0495647_0042168 Ga0495647_0042168_225_1247 340
270 3300046690 Ga0495624_0008262 Ga0495624_0008262_2686_3708 340
271 3300047315 Ga0495581_0021287 Ga0495581_0021287_1723_2745 340
272 3300047319 Ga0495674_0083755 Ga0495674_0083755_1580_2602 340
273 3300047321 Ga0495676_0027336 Ga0495676_0027336_2639_3661 340
274 3300047321 Ga0495676_0212742 Ga0495676_0212742_235_1257 340
275 3300047322 Ga0495680_0102270 Ga0495680_0102270_533_1555 340
276 3300047446 Ga0495679_031204 Ga0495679_031204_259_1281 340
277 3300047471 Ga0495684_0119986 Ga0495684_0119986_69_1091 340
278 3300047471 Ga0495684_0296001 Ga0495684_0296001_79_1101 340
279 3300048088 Ga0495602_0063737 Ga0495602_0063737_1568_2590 340
280 3300048088 Ga0495602_0140744 Ga0495602_0140744_183_1205 340
281 3300048089 Ga0495614_0108473 Ga0495614_0108473_153_1175 340
282 3300048903 Ga0496100_0030746 Ga0496100_0030746_1347_2369 340
283 3300048903 Ga0496100_0101778 Ga0496100_0101778_459_1481 340
284 3300048904 Ga0496101_0002611 Ga0496101_0002611_8796_9818 340
285 3300048904 Ga0496101_0036972 Ga0496101_0036972_1027_2049 340
286 3300048904 Ga0496101_0044844 Ga0496101_0044844_1813_2835 340
287 3300048904 Ga0496101_0205653 Ga0496101_0205653_297_1319 340
288 3300048905 Ga0496102_0045339 Ga0496102_0045339_2740_3762 340
289 3300048905 Ga0496102_0124876 Ga0496102_0124876_168_1190 340
290 3300048905 Ga0496102_0159653 Ga0496102_0159653_863_1885 340
291 3300048907 Ga0496104_0015191 Ga0496104_0015191_2964_3986 340
292 3300048907 Ga0496104_0036560 Ga0496104_0036560_2727_3749 340
293 3300048907 Ga0496104_0039687 Ga0496104_0039687_2365_3387 340
294 3300048907 Ga0496104_0139931 Ga0496104_0139931_835_1857 340
295 3300048908 Ga0496105_0026527 Ga0496105_0026527_3209_4231 340
296 3300048908 Ga0496105_0046583 Ga0496105_0046583_558_1580 340
297 3300048909 Ga0496106_0003549 Ga0496106_0003549_2585_3607 340
298 3300048910 Ga0496107_0116238 Ga0496107_0116238_426_1448 340
299 3300048910 Ga0496107_0117845 Ga0496107_0117845_275_1297 340
300 3300048911 Ga0496108_0015237 Ga0496108_0015237_4571_5593 340
301 3300048911 Ga0496108_0104404 Ga0496108_0104404_592_1614 340
302 3300048912 Ga0496109_0011570 Ga0496109_0011570_2264_3286 340
303 3300048912 Ga0496109_0052969 Ga0496109_0052969_91_1113 340
304 3300048912 Ga0496109_0063568 Ga0496109_0063568_1565_2587 340
305 3300048912 Ga0496109_0452118 Ga0496109_0452118_18_1040 340
306 3300048913 Ga0496110_0005286 Ga0496110_0005286_4384_5406 340
307 3300048913 Ga0496110_0019031 Ga0496110_0019031_16_1038 340
308 3300048914 Ga0496111_0013436 Ga0496111_0013436_1450_2472 340
309 3300048914 Ga0496111_0019657 Ga0496111_0019657_3350_4372 340
310 3300048914 Ga0496111_0103259 Ga0496111_0103259_495_1517 340
311 3300048914 Ga0496111_0163345 Ga0496111_0163345_41_1063 340
312 3300048915 Ga0496112_0001699 Ga0496112_0001699_7311_8333 340
313 3300048916 Ga0496113_0101670 Ga0496113_0101670_57_1079 340
314 3300048916 Ga0496113_0128964 Ga0496113_0128964_303_1325 340
315 3300048917 Ga0496114_0001888 Ga0496114_0001888_6914_7936 340
316 3300048917 Ga0496114_0011412 Ga0496114_0011412_1509_2531 340
317 3300048917 Ga0496114_0106629 Ga0496114_0106629_506_1528 340
318 3300048918 Ga0496115_0026528 Ga0496115_0026528_3074_4096 340
319 3300048918 Ga0496115_0033406 Ga0496115_0033406_843_1865 340
320 3300048918 Ga0496115_0076069 Ga0496115_0076069_487_1509 340
321 3300048918 Ga0496115_0129753 Ga0496115_0129753_454_1476 340
322 3300050512 nmdc:mga0n895_313599_c1 nmdc:mga0n895_313599_c1_454_1476 340
323 3300050512 nmdc:mga0n895_68113_c1 nmdc:mga0n895_68113_c1_2098_3120 340
324 3300053077 Ga0495601_0003619 Ga0495601_0003619_6902_7924 340
325 3300053078 Ga0495612_0071605 Ga0495612_0071605_17_1039 340
326 3300053083 Ga0495655_0036569 Ga0495655_0036569_100_1122 340
327 3300053084 Ga0495595_0091393 Ga0495595_0091393_425_1447 340
328 3300053085 Ga0495619_0109635 Ga0495619_0109635_818_1846 340
329 3300061719 Ga0466962_0005111 Ga0466962_0005111_5114_6136 340
330 3300061719 Ga0466962_0007151 Ga0466962_0007151_2925_3947 340
331 3300005329 Ga0070683_100073626 Ga0070683_1000736262 341
332 3300005366 Ga0070659_100161739 Ga0070659_1001617392 341
333 3300005406 Ga0070703_10000008 Ga0070703_1000000877 341
334 3300005441 Ga0070700_100028625 Ga0070700_1000286253 341
335 3300005445 Ga0070708_100001702 Ga0070708_10000170214 341
336 3300005445 Ga0070708_100031902 Ga0070708_1000319023 341
337 3300005467 Ga0070706_100000040 Ga0070706_100000040106 341
338 3300005467 Ga0070706_100001299 Ga0070706_10000129913 341
339 3300005467 Ga0070706_100018906 Ga0070706_1000189063 341
340 3300005468 Ga0070707_100002016 Ga0070707_10000201613 341
341 3300005468 Ga0070707_100006897 Ga0070707_1000068977 341
342 3300005468 Ga0070707_100011334 Ga0070707_1000113345 341
343 3300005468 Ga0070707_100014906 Ga0070707_1000149065 341
344 3300005471 Ga0070698_100001180 Ga0070698_10000118015 341
345 3300005471 Ga0070698_100007227 Ga0070698_1000072277 341
346 3300005471 Ga0070698_100041571 Ga0070698_1000415712 341
347 3300005518 Ga0070699_100000382 Ga0070699_10000038237 341
348 3300005547 Ga0070693_100104138 Ga0070693_1001041382 341
349 3300005564 Ga0070664_100217687 Ga0070664_1002176872 341
350 3300005937 Ga0081455_10018077 Ga0081455_100180776 341
351 3300006028 Ga0070717_10000229 Ga0070717_1000022925 341
352 3300009094 Ga0111539_10040195 Ga0111539_100401953 341
353 3300009098 Ga0105245_10120739 Ga0105245_101207393 341
354 3300009177 Ga0105248_10543583 Ga0105248_105435832 341
355 3300013306 Ga0163162_10225048 Ga0163162_102250482 341
356 3300013308 Ga0157375_10101127 Ga0157375_101011274 341
357 3300014745 Ga0157377_10106473 Ga0157377_101064732 341
358 3300025885 Ga0207653_10000003 Ga0207653_1000000384 341
359 3300025910 Ga0207684_10000012 Ga0207684_10000012320 341
360 3300025910 Ga0207684_10000025 Ga0207684_10000025113 341
361 3300025910 Ga0207684_10035863 Ga0207684_100358632 341
362 3300025919 Ga0207657_10166159 Ga0207657_101661593 341
363 3300025921 Ga0207652_10115016 Ga0207652_101150163 341
364 3300025922 Ga0207646_10002945 Ga0207646_100029455 341
365 3300025922 Ga0207646_10006253 Ga0207646_100062537 341
366 3300025922 Ga0207646_10024974 Ga0207646_100249745 341
367 3300025927 Ga0207687_10009952 Ga0207687_100099526 341
368 3300025933 Ga0207706_10073062 Ga0207706_100730624 341
369 3300025933 Ga0207706_10255747 Ga0207706_102557472 341
370 3300025940 Ga0207691_10151026 Ga0207691_101510263 341
371 3300025941 Ga0207711_10168648 Ga0207711_101686482 341
372 3300025944 Ga0207661_10034427 Ga0207661_100344273 341
373 3300025945 Ga0207679_10068215 Ga0207679_100682152 341
374 3300025981 Ga0207640_10093499 Ga0207640_100934993 341
375 3300026023 Ga0207677_10286630 Ga0207677_102866302 341
376 3300026035 Ga0207703_10198494 Ga0207703_101984943 341
377 3300026089 Ga0207648_10062399 Ga0207648_100623993 341
378 3300026116 Ga0207674_10250494 Ga0207674_102504942 341
379 3300026118 Ga0207675_100087900 Ga0207675_1000879002 341
380 3300026142 Ga0207698_10129089 Ga0207698_101290892 341
381 3300028563 Ga0265319_1002312 Ga0265319_10023125 341
382 3300028800 Ga0265338_10006204 Ga0265338_100062043 341
383 3300031241 Ga0265325_10000684 Ga0265325_1000068428 341
384 3300031247 Ga0265340_10021432 Ga0265340_100214323 341
385 3300031249 Ga0265339_10057795 Ga0265339_100577953 341
386 3300031250 Ga0265331_10007805 Ga0265331_100078056 341
387 3300031251 Ga0265327_10025453 Ga0265327_100254533 341
388 3300031344 Ga0265316_10030665 Ga0265316_100306655 341
389 3300031548 Ga0307408_100090935 Ga0307408_1000909353 341
390 3300031595 Ga0265313_10015647 Ga0265313_100156473 341
391 3300031712 Ga0265342_10018790 Ga0265342_100187906 341
392 3300031731 Ga0307405_10007306 Ga0307405_100073065 341
393 3300031731 Ga0307405_10124223 Ga0307405_101242233 341
394 3300031824 Ga0307413_10015048 Ga0307413_100150484 341
395 3300031852 Ga0307410_10000655 Ga0307410_1000065510 341
396 3300031901 Ga0307406_10003401 Ga0307406_100034012 341
397 3300031903 Ga0307407_10000386 Ga0307407_100003868 341
398 3300031911 Ga0307412_10142582 Ga0307412_101425822 341
399 3300031995 Ga0307409_100011907 Ga0307409_1000119073 341
400 3300032002 Ga0307416_100009181 Ga0307416_1000091814 341
401 3300032005 Ga0307411_10021395 Ga0307411_100213955 341
402 3300032126 Ga0307415_100000685 Ga0307415_1000006853 341
403 3300037466 Ga0395898_0008697 Ga0395898_0008697_6789_7817 341
404 3300037471 Ga0395905_0014507 Ga0395905_0014507_1431_2459 341
405 3300037471 Ga0395905_0060586 Ga0395905_0060586_401_1426 341
406 3300038443 Ga0395901_0011693 Ga0395901_0011693_4537_5565 341
407 3300044706 Ga0466964_0013963 Ga0466964_0013963_1221_2255 341
408 3300045051 Ga0451576_0265534 Ga0451576_0265534_759_1784 341
409 3300046458 Ga0495591_032637 Ga0495591_032637_447_1472 341
410 3300046525 Ga0495663_0046636 Ga0495663_0046636_138_1163 341
411 3300046538 Ga0495609_0036278 Ga0495609_0036278_845_1870 341
412 3300048905 Ga0496102_0026366 Ga0496102_0026366_464_1489 341
413 3300048906 Ga0496103_0049425 Ga0496103_0049425_661_1686 341
414 3300048909 Ga0496106_0022750 Ga0496106_0022750_2108_3151 341
415 3300048910 Ga0496107_0001666 Ga0496107_0001666_527_1570 341
416 3300048911 Ga0496108_0056899 Ga0496108_0056899_415_1440 341
417 3300048912 Ga0496109_0004156 Ga0496109_0004156_92_1117 341
418 3300048914 Ga0496111_0021446 Ga0496111_0021446_450_1475 341
419 3300048916 Ga0496113_0044155 Ga0496113_0044155_1947_2972 341
420 3300050511 nmdc:mga08y16_105171_c1 nmdc:mga08y16_105171_c1_1216_2241 341
421 3300003316 rootH1_10096065 rootH1_100960653 342
422 3300005329 Ga0070683_100388014 Ga0070683_1003880141 342
423 3300005564 Ga0070664_100063340 Ga0070664_1000633403 342
424 3300005577 Ga0068857_100000499 Ga0068857_1000004999 342
425 3300005937 Ga0081455_10003895 Ga0081455_1000389513 342
426 3300005985 Ga0081539_10001492 Ga0081539_1000149236 342
427 3300006847 Ga0075431_100287783 Ga0075431_1002877832 342
428 3300006880 Ga0075429_100019048 Ga0075429_1000190485 342
429 3300009094 Ga0111539_10009131 Ga0111539_100091316 342
430 3300009147 Ga0114129_10006697 Ga0114129_1000669711 342
431 3300020081 Ga0206354_11240619 Ga0206354_112406192 342
432 3300025944 Ga0207661_10344011 Ga0207661_103440112 342
433 3300026078 Ga0207702_10523750 Ga0207702_105237501 342
434 3300026116 Ga0207674_10003054 Ga0207674_100030544 342
435 3300031247 Ga0265340_10067151 Ga0265340_100671512 342
436 3300039450 Ga0436363_1391603 Ga0436363_1391603_245_1279 342
437 3300045836 Ga0466958_0025720 Ga0466958_0025720_1449_2501 342
438 3300048903 Ga0496100_0083550 Ga0496100_0083550_597_1637 342
439 3300048910 Ga0496107_0026577 Ga0496107_0026577_628_1668 342
440 3300048917 Ga0496114_0013176 Ga0496114_0013176_2086_3126 342
441 3300049743 Ga0501081_0153323 Ga0501081_0153323_511_1542 342
442 3300050507 nmdc:mga05p37_43980_c1 nmdc:mga05p37_43980_c1_3825_4856 342
443 3300050508 nmdc:mga09592_85545_c1 nmdc:mga09592_85545_c1_1641_2672 342
444 3300050509 nmdc:mga0qj67_67769_c1 nmdc:mga0qj67_67769_c1_1131_2162 342
445 3300050510 nmdc:mga06r32_58766_c1 nmdc:mga06r32_58766_c1_2184_3215 342
446 3300050511 nmdc:mga08y16_25657_c1 nmdc:mga08y16_25657_c1_4728_5756 342
447 3300050512 nmdc:mga0n895_108911_c1 nmdc:mga0n895_108911_c1_142_1173 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

54

331

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b5v-assembly1.cif.gz_B the carbohydrate binding module family 48 (cbm48) and carboxy-terminal carbohydrate esterase family 1 (ce1) domains of the multidomain esterase dmce1b from dysgonomonas mossii 0.8195 8 336
6ne9-assembly1.cif.gz_A bacteroides intestinalis acetyl xylan esterase (bacint_01039) 0.8146 8 337
5vol-assembly2.cif.gz_H bacint_04212 ferulic acid esterase 0.8144 10 339
7xrv-assembly1.cif.gz_H bacteroides thetaiotaomicron ferulic acid esterase - s150a (bt_4077-s150a) complex with trans-methylferulate 0.8079 10 342
6rzo-assembly1.cif.gz_B crystal structure of the n-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme ce1-gh62-gh10 0.8068 8 335
ID Description Score Start End Superfamily
1jt2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7951 8 339 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7877 34 332 3.40.50.1820
af_Q2FZQ0_2_248_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7748 6 342 3.40.50.1820
af_A4HYV9_156_416_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7712 10 337 3.40.50.1820
af_Q2FZQ0_2_248_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7661 6 342 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7J9YMB2-F1-model_v4 Enterochelin esterase 0.9951 55 341
AF-A0A537J5S0-F1-model_v4 Enterochelin esterase 0.9883 176 342
AF-A0A7J9YMB2-F1-model_v4 Enterochelin esterase 0.9883 55 341
AF-A0A536HRQ0-F1-model_v4 Enterochelin esterase 0.9875 1 252
AF-K0FBF9-F1-model_v4 Esterase 0.987 1 341

Feature Viewer

pLDDT pTM Quality
94.55 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map