F445372

General Info

Members Datasets Scaffolds Average Seq Length
444 264 431 167

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0028382|Ga0500646_0028382_802_1323
Length 173
Sequence MRTGVYPGTFDPITLGHMDIIRRAAHLVDRLVIGVTTNPSKSPMFTVEERLAMVERETASVTDGAALSVVAFDSLLMDFAEAQGASMIVRGLRAVADFEYEYQMAGMNQQLNADIETVFLMADVSLQPIASKLVKEIAIYGGDISRFVPPAVVGEVSRRVAEIGRKGTPPPRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
10 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
11 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
12 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
13 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
196 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
197 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
198 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
199 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
216 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
220 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
221 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
222 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
223 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
224 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
227 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
230 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
231 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
232 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
233 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
239 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
245 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
246 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
255 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
256 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
261 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
264 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 4.28
Rhizosphere 76.8
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1505805 2162886007 Bacteria 987
2 SwRhRL2b_contig_3439718 2162886007 Bacteria 1009
3 JGI24741J21665_1013465 3300001915 Bacteria 1387
4 JGI24752J21851_1003188 3300001976 Bacteria 2164
5 JGI24740J21852_10002064 3300001979 Bacteria 9182
6 JGI24740J21852_10034057 3300001979 Bacteria 1609
7 JGI24739J22299_10001692 3300001989 Bacteria 8378
8 JGI24737J22298_10024726 3300001990 Bacteria 1901
9 JGI24735J21928_10005665 3300002067 Bacteria 4130
10 JGI24748J21848_1000029 3300002074 Bacteria 90134
11 JGI24738J21930_10000138 3300002075 Bacteria 17795
12 JGI24738J21930_10003295 3300002075 Bacteria 4103
13 JGI24749J21850_1000094 3300002076 Bacteria 15838
14 JGI24749J21850_1001913 3300002076 Bacteria 2941
15 JGI24034J26672_10000006 3300002239 Bacteria 294495
16 JGI24742J22300_10002513 3300002244 Bacteria 2931
17 JGI24751J29686_10000093 3300002459 Bacteria 50074
18 JGI24751J29686_10008583 3300002459 Bacteria 2092
19 JGI24751J29686_10021088 3300002459 Bacteria 1351
20 Ga0055536_1010070 3300003781 Bacteria 3809
21 Ga0055534_1019334 3300003784 Bacteria 1171
22 Ga0055530_10000083 3300003791 Bacteria 81772
23 Ga0055530_10068130 3300003791 Bacteria 774
24 Ga0055531_10000316 3300003794 Bacteria 47444
25 Ga0055531_10001717 3300003794 Bacteria 15697
26 Ga0065704_10078399 3300005289 Bacteria 4441
27 Ga0065704_10202209 3300005289 Bacteria 1141
28 Ga0065715_10916673 3300005293 Bacteria 570
29 Ga0065707_10082105 3300005295 Bacteria 21836
30 Ga0065707_10082467 3300005295 Bacteria 14795
31 Ga0065707_10141585 3300005295 Bacteria 1765
32 Ga0065707_10484423 3300005295 Bacteria 771
33 Ga0070658_10137441 3300005327 Bacteria 2040
34 Ga0070658_10160617 3300005327 Bacteria 1885
35 Ga0070690_100000002 3300005330 Bacteria 176748
36 Ga0070670_100000005 3300005331 Bacteria 351569
37 Ga0070670_100000169 3300005331 Bacteria 59093
38 Ga0070670_100000528 3300005331 Bacteria 30641
39 Ga0070670_100073948 3300005331 Bacteria 2927
40 Ga0070666_10000002 3300005335 Bacteria 478684
41 Ga0070666_10035929 3300005335 Bacteria 3286
42 Ga0070689_100007860 3300005340 Bacteria 7477
43 Ga0070668_100000007 3300005347 Bacteria 150621
44 Ga0070668_100324389 3300005347 Bacteria 1297
45 Ga0070668_100609554 3300005347 Bacteria 956
46 Ga0070669_100000195 3300005353 Bacteria 53791
47 Ga0070669_100000440 3300005353 Bacteria 31718
48 Ga0070669_100034494 3300005353 Bacteria 3663
49 Ga0070671_100000388 3300005355 Bacteria 30256
50 Ga0070671_100027243 3300005355 Bacteria 4702
51 Ga0070674_100707454 3300005356 Bacteria 862
52 Ga0070673_101380978 3300005364 Bacteria 663
53 Ga0070688_100011582 3300005365 Bacteria 4905
54 Ga0070659_100042467 3300005366 Bacteria 3554
55 Ga0070659_100369057 3300005366 Bacteria 1207
56 Ga0070667_100000003 3300005367 Bacteria 447715
57 Ga0070667_100000327 3300005367 Bacteria 52972
58 Ga0070667_100001850 3300005367 Bacteria 18783
59 Ga0070667_100008584 3300005367 Bacteria 8468
60 Ga0070663_100185239 3300005455 Bacteria 1617
61 Ga0070662_100006250 3300005457 Bacteria 7670
62 Ga0070662_100060346 3300005457 Bacteria 2765
63 Ga0070662_100608194 3300005457 Bacteria 920
64 Ga0070662_101024679 3300005457 Bacteria 707
65 Ga0070681_10237857 3300005458 Bacteria 1735
66 Ga0070685_10000056 3300005466 Bacteria 68183
67 Ga0070679_100354019 3300005530 Bacteria 1416
68 Ga0070684_100693090 3300005535 Bacteria 949
69 Ga0068853_100096736 3300005539 Bacteria 2605
70 Ga0070672_100229285 3300005543 Bacteria 1560
71 Ga0070686_100000002 3300005544 Bacteria 336303
72 Ga0070693_100829250 3300005547 Bacteria 688
73 Ga0070665_100000025 3300005548 Bacteria 367488
74 Ga0070665_100004060 3300005548 Bacteria 15401
75 Ga0070665_100657668 3300005548 Bacteria 1061
76 Ga0068855_100004366 3300005563 Bacteria 17285
77 Ga0068857_100015964 3300005577 Bacteria 6577
78 Ga0068857_100134454 3300005577 Bacteria 2232
79 Ga0068857_100166790 3300005577 Bacteria 2000
80 Ga0068854_100029193 3300005578 Bacteria 3817
81 Ga0068854_100036277 3300005578 Bacteria 3456
82 Ga0068854_100322165 3300005578 Bacteria 1257
83 Ga0068856_100058625 3300005614 Bacteria 3803
84 Ga0068852_100215479 3300005616 Bacteria 1824
85 Ga0068859_100008939 3300005617 Bacteria 10118
86 Ga0068859_100012055 3300005617 Bacteria 8685
87 Ga0068859_100012820 3300005617 Bacteria 8419
88 Ga0068859_100025890 3300005617 Bacteria 5886
89 Ga0068864_100000004 3300005618 Bacteria 489341
90 Ga0068864_100000011 3300005618 Bacteria 350056
91 Ga0068864_100004976 3300005618 Bacteria 10896
92 Ga0068861_100220277 3300005719 Bacteria 1603
93 Ga0068851_10027890 3300005834 Bacteria 2786
94 Ga0068863_100000002 3300005841 Bacteria 489510
95 Ga0068863_100000070 3300005841 Bacteria 115715
96 Ga0068863_100003398 3300005841 Bacteria 15704
97 Ga0068863_100017965 3300005841 Bacteria 6769
98 Ga0068858_100001881 3300005842 Bacteria 21432
99 Ga0068858_100002924 3300005842 Bacteria 17185
100 Ga0068860_100000001 3300005843 Bacteria 703043
101 Ga0068860_100000045 3300005843 Bacteria 223252
102 Ga0068860_100040511 3300005843 Bacteria 4451
103 Ga0068862_100000002 3300005844 Bacteria 489341
104 Ga0068862_100000011 3300005844 Bacteria 270105
105 Ga0068862_100000020 3300005844 Bacteria 219516
106 Ga0068862_100000989 3300005844 Bacteria 27179
107 Ga0081540_1056312 3300005983 Bacteria 1909
108 Ga0097620_100008939 3300006931 Bacteria 10118
109 Ga0097620_100012054 3300006931 Bacteria 8685
110 Ga0097620_100012820 3300006931 Bacteria 8419
111 Ga0097620_100025890 3300006931 Bacteria 5886
112 Ga0105251_10000342 3300009011 Bacteria 46221
113 Ga0105250_10260431 3300009092 Bacteria 743
114 Ga0105240_10009282 3300009093 Bacteria 13947
115 Ga0111539_10382741 3300009094 Bacteria 1638
116 Ga0105247_10017026 3300009101 Bacteria 4361
117 Ga0105247_10041415 3300009101 Bacteria 2819
118 Ga0105241_10230273 3300009174 Bacteria 1562
119 Ga0105248_10000016 3300009177 Bacteria 308151
120 Ga0105248_10000069 3300009177 Bacteria 120989
121 Ga0105248_10065895 3300009177 Bacteria 4067
122 Ga0105248_10509668 3300009177 Bacteria 1357
123 Ga0105237_10224635 3300009545 Bacteria 1878
124 Ga0105237_10586709 3300009545 Bacteria 1121
125 Ga0105237_10599018 3300009545 Bacteria 1109
126 Ga0105238_10051291 3300009551 Bacteria 4150
127 Ga0105238_10072055 3300009551 Bacteria 3452
128 Ga0105238_11100422 3300009551 Bacteria 817
129 Ga0105249_10000005 3300009553 Bacteria 362467
130 Ga0105249_10000106 3300009553 Bacteria 115526
131 Ga0105249_10369014 3300009553 Bacteria 1458
132 Ga0105249_10810158 3300009553 Bacteria 1001
133 Ga0105239_10446539 3300010375 Bacteria 1467
134 Ga0105239_10509252 3300010375 Bacteria 1369
135 Ga0105239_10852509 3300010375 Bacteria 1045
136 Ga0157326_1000303 3300012513 Bacteria 5782
137 Ga0157373_10152970 3300013100 Bacteria 1623
138 Ga0157370_10025774 3300013104 Bacteria 5818
139 Ga0157370_11603128 3300013104 Bacteria 585
140 Ga0157370_11667324 3300013104 Bacteria 572
141 Ga0157369_10133762 3300013105 Bacteria 2626
142 Ga0157374_10365013 3300013296 Bacteria 1436
143 Ga0157378_10156954 3300013297 Bacteria 2125
144 Ga0163162_10060819 3300013306 Bacteria 3814
145 Ga0163162_10503157 3300013306 Bacteria 1342
146 Ga0157372_10138783 3300013307 Bacteria 2800
147 Ga0157372_10509317 3300013307 Bacteria 1403
148 Ga0163163_10101070 3300014325 Bacteria 2906
149 Ga0157380_10000304 3300014326 Bacteria 29589
150 Ga0157380_10000363 3300014326 Bacteria 27231
151 Ga0157380_10183104 3300014326 Bacteria 1842
152 Ga0157379_10007070 3300014968 Bacteria 9701
153 Ga0157379_10027796 3300014968 Bacteria 5035
154 Ga0163161_10000115 3300017792 Bacteria 76319
155 Ga0213876_10432585 3300021384 Bacteria 700
156 Ga0213875_10001461 3300021388 Bacteria 15300
157 Ga0209675_1000190 3300025291 Bacteria 67514
158 Ga0209676_1000081 3300025292 Bacteria 285297
159 Ga0209676_1000133 3300025292 Bacteria 184430
160 Ga0209676_1000769 3300025292 Bacteria 42909
161 Ga0209025_1015501 3300025294 Bacteria 4587
162 Ga0209050_1000067 3300025298 Bacteria 304206
163 Ga0209050_1001738 3300025298 Bacteria 21673
164 Ga0209050_1011629 3300025298 Bacteria 4145
165 Ga0209257_1000132 3300025304 Bacteria 210870
166 Ga0209257_1000206 3300025304 Bacteria 142184
167 Ga0207656_10002142 3300025321 Bacteria 6593
168 Ga0207696_1167430 3300025711 Bacteria 583
169 Ga0207713_1003473 3300025735 Bacteria 10729
170 Ga0207710_10018928 3300025900 Bacteria 2934
171 Ga0207710_10065620 3300025900 Bacteria 1655
172 Ga0207680_10000004 3300025903 Bacteria 827324
173 Ga0207680_10019012 3300025903 Bacteria 3668
174 Ga0207647_10000069 3300025904 Bacteria 80952
175 Ga0207705_10225117 3300025909 Bacteria 1425
176 Ga0207654_10006741 3300025911 Bacteria 5775
177 Ga0207707_10405559 3300025912 Bacteria 1170
178 Ga0207695_10007597 3300025913 Bacteria 13744
179 Ga0207695_10009337 3300025913 Bacteria 12132
180 Ga0207671_10001601 3300025914 Bacteria 25733
181 Ga0207657_10029090 3300025919 Bacteria 5034
182 Ga0207652_11444563 3300025921 Bacteria 591
183 Ga0207681_10000001 3300025923 Bacteria 1105841
184 Ga0207681_10000130 3300025923 Bacteria 61067
185 Ga0207681_10069244 3300025923 Bacteria 2454
186 Ga0207681_10122918 3300025923 Bacteria 1906
187 Ga0207694_10013118 3300025924 Bacteria 6239
188 Ga0207694_10014424 3300025924 Bacteria 5957
189 Ga0207694_10049465 3300025924 Bacteria 3254
190 Ga0207650_10000018 3300025925 Bacteria 352120
191 Ga0207650_10000294 3300025925 Bacteria 50141
192 Ga0207650_10004568 3300025925 Bacteria 9467
193 Ga0207650_10008589 3300025925 Bacteria 6974
194 Ga0207644_10000197 3300025931 Bacteria 42679
195 Ga0207644_10056031 3300025931 Bacteria 2843
196 Ga0207706_10011916 3300025933 Bacteria 7916
197 Ga0207706_10192545 3300025933 Bacteria 1789
198 Ga0207706_11060792 3300025933 Bacteria 679
199 Ga0207670_10010788 3300025936 Bacteria 5271
200 Ga0207691_10093950 3300025940 Bacteria 2684
201 Ga0207711_10000022 3300025941 Bacteria 340441
202 Ga0207711_10001064 3300025941 Bacteria 26287
203 Ga0207711_10010013 3300025941 Bacteria 7878
204 Ga0207711_10416240 3300025941 Bacteria 1250
205 Ga0207679_10238592 3300025945 Bacteria 1539
206 Ga0207667_10000651 3300025949 Bacteria 45008
207 Ga0207667_10005163 3300025949 Bacteria 15952
208 Ga0207651_10367660 3300025960 Bacteria 1216
209 Ga0207712_10000001 3300025961 Bacteria 750309
210 Ga0207712_10000224 3300025961 Bacteria 55674
211 Ga0207712_10213795 3300025961 Bacteria 1537
212 Ga0207712_10611587 3300025961 Bacteria 944
213 Ga0207668_10000026 3300025972 Bacteria 128309
214 Ga0207668_10309219 3300025972 Bacteria 1307
215 Ga0207668_10557372 3300025972 Bacteria 993
216 Ga0207640_10008627 3300025981 Bacteria 5665
217 Ga0207640_10011938 3300025981 Bacteria 4933
218 Ga0207640_10045658 3300025981 Bacteria 2814
219 Ga0207640_10182577 3300025981 Bacteria 1574
220 Ga0207658_10000002 3300025986 Bacteria 1364188
221 Ga0207658_10000364 3300025986 Bacteria 44527
222 Ga0207658_10000902 3300025986 Bacteria 24720
223 Ga0207658_10002462 3300025986 Bacteria 13518
224 Ga0207703_10000404 3300026035 Bacteria 46297
225 Ga0207703_10002475 3300026035 Bacteria 16017
226 Ga0207703_11504355 3300026035 Bacteria 648
227 Ga0207639_10016543 3300026041 Bacteria 5221
228 Ga0207639_10131249 3300026041 Bacteria 2074
229 Ga0207639_10469477 3300026041 Bacteria 1145
230 Ga0207678_10187042 3300026067 Bacteria 1769
231 Ga0207702_10003987 3300026078 Bacteria 13255
232 Ga0207702_10003988 3300026078 Bacteria 13255
233 Ga0207702_10076647 3300026078 Bacteria 2890
234 Ga0207641_10000002 3300026088 Bacteria 981004
235 Ga0207641_10000033 3300026088 Bacteria 219261
236 Ga0207641_10004973 3300026088 Bacteria 11403
237 Ga0207641_10006503 3300026088 Bacteria 9839
238 Ga0207676_10000004 3300026095 Bacteria 725417
239 Ga0207676_10000040 3300026095 Bacteria 167947
240 Ga0207676_10000546 3300026095 Bacteria 31410
241 Ga0207674_10012150 3300026116 Bacteria 9640
242 Ga0207674_10142596 3300026116 Bacteria 2355
243 Ga0207674_10143991 3300026116 Bacteria 2342
244 Ga0207674_10249348 3300026116 Bacteria 1722
245 Ga0207674_10279210 3300026116 Bacteria 1618
246 Ga0207675_100003280 3300026118 Bacteria 15849
247 Ga0207675_100004115 3300026118 Bacteria 14077
248 Ga0207675_100132806 3300026118 Bacteria 2360
249 Ga0207698_10026565 3300026142 Bacteria 4096
250 Ga0207698_10101825 3300026142 Bacteria 2383
251 Ga0207698_10524414 3300026142 Bacteria 1157
252 Ga0268266_10000028 3300028379 Bacteria 425294
253 Ga0268266_10001270 3300028379 Bacteria 30813
254 Ga0268265_10000002 3300028380 Bacteria 1035381
255 Ga0268265_10000003 3300028380 Bacteria 949201
256 Ga0268265_10000071 3300028380 Bacteria 132890
257 Ga0268265_10001985 3300028380 Bacteria 16188
258 Ga0268264_10000006 3300028381 Bacteria 827324
259 Ga0268264_10000101 3300028381 Bacteria 225109
260 Ga0268264_10754516 3300028381 Bacteria 970
261 Ga0307517_10511383 3300028786 Bacteria 609
262 Ga0307513_10614222 3300031456 Bacteria 796
263 Ga0307408_100253979 3300031548 Bacteria 1451
264 Ga0307408_101781625 3300031548 Bacteria 588
265 Ga0307405_10057984 3300031731 Bacteria 2435
266 Ga0307405_10068751 3300031731 Bacteria 2268
267 Ga0307405_10071128 3300031731 Bacteria 2237
268 Ga0307405_10458954 3300031731 Bacteria 1012
269 Ga0307410_10274723 3300031852 Bacteria 1320
270 Ga0307406_10103171 3300031901 Bacteria 1947
271 Ga0307412_10000165 3300031911 Bacteria 46841
272 Ga0307412_10000329 3300031911 Bacteria 30093
273 Ga0307412_10014384 3300031911 Bacteria 4665
274 Ga0307412_10022690 3300031911 Bacteria 3853
275 Ga0307412_10036493 3300031911 Bacteria 3150
276 Ga0307412_10162631 3300031911 Bacteria 1660
277 Ga0307416_100570300 3300032002 Bacteria 1208
278 Ga0307416_101789066 3300032002 Bacteria 718
279 Ga0307414_10000177 3300032004 Bacteria 43274
280 Ga0307414_10012210 3300032004 Bacteria 5068
281 Ga0307414_10189099 3300032004 Bacteria 1664
282 Ga0307414_10942952 3300032004 Bacteria 793
283 Ga0307411_10118034 3300032005 Bacteria 1913
284 Ga0307510_10151301 3300033180 Bacteria 1939
285 Ga0436364_0852694 3300037853 Bacteria 36694
286 Ga0237819_01727 3300038705 Bacteria 5207
287 Ga0436365_1329751 3300039437 Bacteria 890
288 Ga0436363_0443886 3300039450 Bacteria 4840
289 Ga0451793_0683499 3300041452 Bacteria 1342
290 Ga0451795_0780312 3300041456 Bacteria 1369
291 Ga0451802_0177882 3300041460 Bacteria 800
292 Ga0451804_0547077 3300041463 Bacteria 1096
293 Ga0451807_0425266 3300041486 Bacteria 1136
294 Ga0451807_2507748 3300041486 Bacteria 760
295 Ga0451853_2694079 3300041512 Bacteria 743
296 Ga0495585_0199770 3300046492 Bacteria 1019
297 Ga0495607_0041186 3300046501 Bacteria 2745
298 Ga0495616_0101965 3300046513 Bacteria 1345
299 Ga0495632_0134120 3300046519 Bacteria 1151
300 Ga0495663_0004262 3300046525 Bacteria 4033
301 Ga0495663_0024293 3300046525 Bacteria 1761
302 Ga0495654_0000736 3300046530 Bacteria 25435
303 Ga0495597_0012717 3300046542 Bacteria 4054
304 Ga0495668_0000076 3300046616 Bacteria 161826
305 Ga0495668_0001456 3300046616 Bacteria 22791
306 Ga0495668_0018394 3300046616 Bacteria 4037
307 Ga0495625_0000520 3300046660 Bacteria 56778
308 Ga0495589_0032112 3300046794 Bacteria 2641
309 Ga0495685_109341 3300047447 Bacteria 910
310 Ga0495686_0005031 3300047472 Bacteria 10612
311 Ga0496101_0080171 3300048904 Bacteria 2411
312 Ga0496101_0295850 3300048904 Bacteria 1267
313 Ga0496102_0003647 3300048905 Bacteria 13024
314 Ga0496102_0190213 3300048905 Bacteria 1934
315 Ga0496103_0000840 3300048906 Bacteria 22462
316 Ga0496103_0007333 3300048906 Bacteria 6572
317 Ga0496104_0591090 3300048907 Bacteria 1020
318 Ga0496105_0178867 3300048908 Bacteria 1737
319 Ga0496106_0050458 3300048909 Bacteria 3136
320 Ga0496107_0670902 3300048910 Bacteria 763
321 Ga0496108_0308095 3300048911 Bacteria 1380
322 Ga0496111_0348596 3300048914 Bacteria 1096
323 Ga0496116_0062100 3300048919 Bacteria 2414
324 Ga0496117_0037195 3300048920 Bacteria 3629
325 Ga0496118_0004860 3300048921 Bacteria 15648
326 Ga0496120_0015001 3300048923 Bacteria 5131
327 Ga0496121_0122657 3300048924 Bacteria 1959
328 Ga0496121_0182983 3300048924 Bacteria 1510
329 Ga0496122_0343163 3300048925 Bacteria 783
330 Ga0496123_0101512 3300048926 Bacteria 1672
331 Ga0496124_0002002 3300048927 Bacteria 27746
332 Ga0496124_0007069 3300048927 Bacteria 12023
333 Ga0496124_0131155 3300048927 Bacteria 1991
334 Ga0496124_0238959 3300048927 Bacteria 1352
335 Ga0496125_0177437 3300048928 Bacteria 1424
336 Ga0496125_0242506 3300048928 Bacteria 1143
337 Ga0496125_0311330 3300048928 Bacteria 959
338 Ga0496126_0096034 3300048929 Bacteria 2599
339 Ga0495678_068031 3300049459 Bacteria 1314
340 Ga0501290_000086 3300049513 Bacteria 13288
341 Ga0501290_017867 3300049513 Bacteria 952
342 Ga0501292_000019 3300049515 Bacteria 55694
343 Ga0501294_000190 3300049517 Bacteria 7585
344 Ga0501300_000128 3300049523 Bacteria 11180
345 Ga0501301_005570 3300049524 Bacteria 927
346 Ga0501031_0036268 3300049568 Bacteria 3216
347 Ga0501032_0016683 3300049569 Bacteria 5161
348 Ga0501032_0043876 3300049569 Bacteria 3027
349 Ga0501033_0321697 3300049570 Bacteria 1086
350 Ga0501034_0035875 3300049571 Bacteria 5027
351 Ga0501034_0530466 3300049571 Bacteria 1088
352 Ga0501036_0104308 3300049572 Bacteria 2397
353 Ga0501037_0053881 3300049573 Bacteria 2942
354 Ga0501038_0021428 3300049574 Bacteria 5800
355 Ga0501039_0029745 3300049575 Bacteria 4208
356 Ga0501040_0782656 3300049576 Bacteria 690
357 Ga0501043_0368799 3300049579 Bacteria 1088
358 Ga0501046_0148635 3300049580 Bacteria 1768
359 Ga0501047_0000402 3300049581 Bacteria 48648
360 Ga0501047_0131015 3300049581 Bacteria 2388
361 Ga0501048_0235742 3300049582 Bacteria 1298
362 Ga0501073_0400842 3300049589 Bacteria 948
363 Ga0501202_014388 3300049652 Bacteria 1515
364 Ga0501206_002061 3300049653 Bacteria 2537
365 Ga0501222_000809 3300049662 Bacteria 4497
366 Ga0501222_002076 3300049662 Bacteria 2772
367 Ga0501223_008808 3300049663 Bacteria 2054
368 Ga0501223_022810 3300049663 Bacteria 1222
369 Ga0501224_003397 3300049664 Bacteria 2217
370 Ga0501224_017889 3300049664 Bacteria 1055
371 Ga0501227_004681 3300049665 Bacteria 2936
372 Ga0501233_028842 3300049668 Bacteria 1241
373 Ga0501235_000351 3300049669 Bacteria 8794
374 Ga0501235_052167 3300049669 Bacteria 949
375 Ga0501236_002609 3300049670 Bacteria 2078
376 Ga0501249_000545 3300049679 Bacteria 9066
377 Ga0501257_071740 3300049686 Bacteria 885
378 Ga0501259_004339 3300049688 Bacteria 2258
379 Ga0501261_000061 3300049690 Bacteria 19269
380 Ga0501221_093313 3300049704 Bacteria 738
381 Ga0501225_0002229 3300049705 Bacteria 5993
382 Ga0501225_0009588 3300049705 Bacteria 2751
383 Ga0501245_005097 3300049708 Bacteria 1816
384 Ga0501279_000008 3300049775 Bacteria 125267
385 Ga0501280_000131 3300049776 Bacteria 19531
386 Ga0501280_007674 3300049776 Bacteria 1506
387 Ga0501281_00097 3300049777 Bacteria 10413
388 Ga0501282_002885 3300049778 Bacteria 1860
389 Ga0501282_009683 3300049778 Bacteria 1034
390 Ga0501283_005982 3300049779 Bacteria 1689
391 Ga0501035_0045752 3300049822 Bacteria 3936
392 Ga0501044_0015438 3300049823 Bacteria 8225
393 Ga0501044_0128928 3300049823 Bacteria 2525
394 Ga0501045_0241061 3300049824 Bacteria 1346
395 Ga0501204_008578 3300049850 Bacteria 1169
396 Ga0501284_10670 3300050005 Bacteria 564
397 Ga0500643_000338 3300053087 Bacteria 37288
398 Ga0500643_000351 3300053087 Bacteria 36635
399 Ga0500643_001549 3300053087 Bacteria 13025
400 Ga0500643_028605 3300053087 Bacteria 1722
401 Ga0500646_0028382 3300053090 Bacteria 1527
402 Ga0500647_0044368 3300053091 Bacteria 2134
403 Ga0500651_0042612 3300053093 Bacteria 2860
404 Ga0500566_0071474 3300053094 Bacteria 1947
405 Ga0500569_069374 3300053109 Bacteria 1106
406 Ga0500592_000232 3300053116 Bacteria 10092
407 Ga0500592_000578 3300053116 Bacteria 6035
408 Ga0500607_160345 3300053121 Bacteria 1029
409 Ga0500618_011999 3300053125 Bacteria 2281
410 Ga0500642_0018625 3300053130 Bacteria 2690
411 Ga0500655_011842 3300053133 Bacteria 1583
412 Ga0500658_0077662 3300053134 Bacteria 1414
413 Ga0500658_0112069 3300053134 Bacteria 1202
414 Ga0500559_0007211 3300053136 Bacteria 4944
415 Ga0500568_0003694 3300053139 Bacteria 8399
416 Ga0500568_0007935 3300053139 Bacteria 5159
417 Ga0500577_0039468 3300053142 Bacteria 1711
418 Ga0500588_0058586 3300053146 Bacteria 1226
419 Ga0500590_005065 3300053148 Bacteria 6310
420 Ga0500604_0000053 3300053151 Bacteria 41228
421 Ga0500604_0014126 3300053151 Bacteria 2171
422 Ga0500604_0269082 3300053151 Bacteria 590
423 Ga0500616_0000411 3300053153 Bacteria 57962
424 Ga0500622_0038995 3300053156 Bacteria 2477
425 Ga0500627_0000757 3300053158 Bacteria 8582
426 Ga0500627_0002521 3300053158 Bacteria 5454
427 Ga0500627_0075720 3300053158 Bacteria 1496
428 Ga0500627_0231290 3300053158 Bacteria 822
429 Ga0500570_001921 3300053724 Bacteria 9977
430 Ga0500645_028013 3300053730 Bacteria 1706
431 Ga0500587_001709 3300053739 Bacteria 3119

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0443886 Ga0436363_0443886_2579_3016 145
2 3300041486 Ga0451807_0425266 Ga0451807_0425266_323_763 145
3 3300041456 Ga0451795_0780312 Ga0451795_0780312_897_1346 149
4 3300049513 Ga0501290_000086 Ga0501290_000086_1851_2300 149
5 3300049524 Ga0501301_005570 Ga0501301_005570_380_829 149
6 3300049662 Ga0501222_002076 Ga0501222_002076_1898_2347 149
7 3300049663 Ga0501223_008808 Ga0501223_008808_1125_1574 149
8 3300049664 Ga0501224_017889 Ga0501224_017889_437_886 149
9 3300049669 Ga0501235_052167 Ga0501235_052167_152_601 149
10 3300049705 Ga0501225_0009588 Ga0501225_0009588_1828_2277 149
11 3300049776 Ga0501280_000131 Ga0501280_000131_1894_2343 149
12 3300049778 Ga0501282_009683 Ga0501282_009683_267_716 149
13 3300049686 Ga0501257_071740 Ga0501257_071740_148_627 159
14 3300005293 Ga0065715_10916673 Ga0065715_109166731 160
15 3300031456 Ga0307513_10614222 Ga0307513_106142221 161
16 3300032002 Ga0307416_101789066 Ga0307416_1017890661 161
17 iso_pu_bacteria 2643221541 2643730528 162
18 iso_pu_bacteria 2643221560 2643819760 162
19 iso_pu_bacteria 2643221605 2644037503 162
20 iso_pu_bacteria 2643221606 2644043697 162
21 iso_pu_bacteria 2643221671 2644393856 162
22 iso_pu_bacteria 2852653556 2852654387 162
23 iso_pu_bacteria 2582581305 2585260491 163
24 3300005843 Ga0068860_100040511 Ga0068860_1000405111 164
25 iso_pu_bacteria 2599185359 2600225829 164
26 iso_pu_bacteria 2818991466 2819716368 164
27 iso_pu_bacteria 2928526807 2928528825 164
28 iso_pu_bacteria 2928968154 2928970378 164
29 iso_pu_bacteria 2946787523 2946787628 164
30 iso_pu_bacteria 8057101203 8057101632 164
31 3300048928 Ga0496125_0177437 Ga0496125_0177437_762_1259 165
32 3300049569 Ga0501032_0043876 Ga0501032_0043876_1276_1773 165
33 3300049581 Ga0501047_0000402 Ga0501047_0000402_15959_16456 165
34 3300049582 Ga0501048_0235742 Ga0501048_0235742_386_883 165
35 3300049823 Ga0501044_0128928 Ga0501044_0128928_1562_2059 165
36 3300002076 JGI24749J21850_1000094 JGI24749J21850_10000946 166
37 3300002459 JGI24751J29686_10000093 JGI24751J29686_1000009327 166
38 3300002459 JGI24751J29686_10021088 JGI24751J29686_100210881 166
39 3300003781 Ga0055536_1010070 Ga0055536_10100704 166
40 3300003784 Ga0055534_1019334 Ga0055534_10193342 166
41 3300003791 Ga0055530_10000083 Ga0055530_1000008321 166
42 3300003791 Ga0055530_10068130 Ga0055530_100681301 166
43 3300003794 Ga0055531_10000316 Ga0055531_1000031640 166
44 3300003794 Ga0055531_10001717 Ga0055531_100017174 166
45 3300005295 Ga0065707_10082467 Ga0065707_1008246714 166
46 3300005327 Ga0070658_10137441 Ga0070658_101374412 166
47 3300005331 Ga0070670_100000005 Ga0070670_100000005110 166
48 3300005331 Ga0070670_100000528 Ga0070670_10000052819 166
49 3300005335 Ga0070666_10035929 Ga0070666_100359292 166
50 3300005347 Ga0070668_100000007 Ga0070668_100000007142 166
51 3300005353 Ga0070669_100000195 Ga0070669_10000019520 166
52 3300005353 Ga0070669_100034494 Ga0070669_1000344946 166
53 3300005355 Ga0070671_100000388 Ga0070671_10000038816 166
54 3300005356 Ga0070674_100707454 Ga0070674_1007074541 166
55 3300005364 Ga0070673_101380978 Ga0070673_1013809781 166
56 3300005366 Ga0070659_100369057 Ga0070659_1003690572 166
57 3300005367 Ga0070667_100000003 Ga0070667_100000003247 166
58 3300005367 Ga0070667_100001850 Ga0070667_1000018505 166
59 3300005457 Ga0070662_100608194 Ga0070662_1006081941 166
60 3300005457 Ga0070662_101024679 Ga0070662_1010246791 166
61 3300005458 Ga0070681_10237857 Ga0070681_102378572 166
62 3300005543 Ga0070672_100229285 Ga0070672_1002292852 166
63 3300005548 Ga0070665_100004060 Ga0070665_1000040606 166
64 3300005548 Ga0070665_100657668 Ga0070665_1006576682 166
65 3300005563 Ga0068855_100004366 Ga0068855_10000436616 166
66 3300005577 Ga0068857_100134454 Ga0068857_1001344542 166
67 3300005578 Ga0068854_100029193 Ga0068854_1000291933 166
68 3300005578 Ga0068854_100322165 Ga0068854_1003221652 166
69 3300005614 Ga0068856_100058625 Ga0068856_1000586253 166
70 3300005617 Ga0068859_100008939 Ga0068859_1000089397 166
71 3300005617 Ga0068859_100012820 Ga0068859_1000128207 166
72 3300005618 Ga0068864_100000011 Ga0068864_100000011109 166
73 3300005719 Ga0068861_100220277 Ga0068861_1002202772 166
74 3300005841 Ga0068863_100003398 Ga0068863_1000033988 166
75 3300005841 Ga0068863_100017965 Ga0068863_10001796510 166
76 3300005842 Ga0068858_100001881 Ga0068858_10000188118 166
77 3300005843 Ga0068860_100000045 Ga0068860_10000004516 166
78 3300005844 Ga0068862_100000011 Ga0068862_100000011127 166
79 3300005844 Ga0068862_100000989 Ga0068862_10000098915 166
80 3300006931 Ga0097620_100008939 Ga0097620_1000089395 166
81 3300006931 Ga0097620_100012820 Ga0097620_1000128207 166
82 3300009093 Ga0105240_10009282 Ga0105240_100092827 166
83 3300009094 Ga0111539_10382741 Ga0111539_103827412 166
84 3300009174 Ga0105241_10230273 Ga0105241_102302733 166
85 3300009177 Ga0105248_10000069 Ga0105248_1000006981 166
86 3300009545 Ga0105237_10599018 Ga0105237_105990182 166
87 3300009551 Ga0105238_10072055 Ga0105238_100720552 166
88 3300009551 Ga0105238_11100422 Ga0105238_111004222 166
89 3300009553 Ga0105249_10369014 Ga0105249_103690142 166
90 3300009553 Ga0105249_10810158 Ga0105249_108101582 166
91 3300010375 Ga0105239_10509252 Ga0105239_105092522 166
92 3300010375 Ga0105239_10852509 Ga0105239_108525091 166
93 3300012513 Ga0157326_1000303 Ga0157326_10003034 166
94 3300013104 Ga0157370_11603128 Ga0157370_116031281 166
95 3300013296 Ga0157374_10365013 Ga0157374_103650132 166
96 3300014326 Ga0157380_10000363 Ga0157380_1000036313 166
97 3300021384 Ga0213876_10432585 Ga0213876_104325852 166
98 3300021388 Ga0213875_10001461 Ga0213875_100014617 166
99 3300025291 Ga0209675_1000190 Ga0209675_100019074 166
100 3300025292 Ga0209676_1000081 Ga0209676_1000081142 166
101 3300025292 Ga0209676_1000133 Ga0209676_100013358 166
102 3300025292 Ga0209676_1000769 Ga0209676_10007696 166
103 3300025294 Ga0209025_1015501 Ga0209025_10155012 166
104 3300025298 Ga0209050_1000067 Ga0209050_100006752 166
105 3300025298 Ga0209050_1001738 Ga0209050_10017386 166
106 3300025298 Ga0209050_1011629 Ga0209050_10116295 166
107 3300025304 Ga0209257_1000132 Ga0209257_1000132129 166
108 3300025304 Ga0209257_1000206 Ga0209257_100020659 166
109 3300025903 Ga0207680_10019012 Ga0207680_100190122 166
110 3300025912 Ga0207707_10405559 Ga0207707_104055592 166
111 3300025913 Ga0207695_10007597 Ga0207695_100075977 166
112 3300025923 Ga0207681_10000001 Ga0207681_10000001550 166
113 3300025923 Ga0207681_10069244 Ga0207681_100692443 166
114 3300025923 Ga0207681_10122918 Ga0207681_101229182 166
115 3300025924 Ga0207694_10014424 Ga0207694_100144247 166
116 3300025925 Ga0207650_10000018 Ga0207650_10000018110 166
117 3300025925 Ga0207650_10004568 Ga0207650_100045682 166
118 3300025931 Ga0207644_10000197 Ga0207644_1000019728 166
119 3300025933 Ga0207706_11060792 Ga0207706_110607921 166
120 3300025940 Ga0207691_10093950 Ga0207691_100939504 166
121 3300025941 Ga0207711_10001064 Ga0207711_100010645 166
122 3300025949 Ga0207667_10000651 Ga0207667_1000065128 166
123 3300025960 Ga0207651_10367660 Ga0207651_103676601 166
124 3300025961 Ga0207712_10213795 Ga0207712_102137951 166
125 3300025961 Ga0207712_10611587 Ga0207712_106115872 166
126 3300025972 Ga0207668_10000026 Ga0207668_10000026108 166
127 3300025981 Ga0207640_10011938 Ga0207640_100119384 166
128 3300025981 Ga0207640_10182577 Ga0207640_101825772 166
129 3300025986 Ga0207658_10000002 Ga0207658_100000021148 166
130 3300025986 Ga0207658_10000902 Ga0207658_1000090219 166
131 3300026035 Ga0207703_10000404 Ga0207703_1000040416 166
132 3300026035 Ga0207703_11504355 Ga0207703_115043551 166
133 3300026041 Ga0207639_10016543 Ga0207639_100165436 166
134 3300026078 Ga0207702_10076647 Ga0207702_100766474 166
135 3300026088 Ga0207641_10004973 Ga0207641_1000497310 166
136 3300026088 Ga0207641_10006503 Ga0207641_100065033 166
137 3300026095 Ga0207676_10000004 Ga0207676_10000004503 166
138 3300026116 Ga0207674_10143991 Ga0207674_101439912 166
139 3300026116 Ga0207674_10249348 Ga0207674_102493482 166
140 3300026118 Ga0207675_100004115 Ga0207675_1000041152 166
141 3300026118 Ga0207675_100132806 Ga0207675_1001328062 166
142 3300026142 Ga0207698_10524414 Ga0207698_105244142 166
143 3300028379 Ga0268266_10001270 Ga0268266_1000127027 166
144 3300028380 Ga0268265_10000002 Ga0268265_10000002567 166
145 3300028380 Ga0268265_10001985 Ga0268265_100019856 166
146 3300028381 Ga0268264_10000101 Ga0268264_1000010118 166
147 3300028381 Ga0268264_10754516 Ga0268264_107545162 166
148 3300028786 Ga0307517_10511383 Ga0307517_105113831 166
149 3300031548 Ga0307408_101781625 Ga0307408_1017816251 166
150 3300031731 Ga0307405_10057984 Ga0307405_100579843 166
151 3300031731 Ga0307405_10068751 Ga0307405_100687514 166
152 3300031731 Ga0307405_10458954 Ga0307405_104589541 166
153 3300031852 Ga0307410_10274723 Ga0307410_102747232 166
154 3300031911 Ga0307412_10014384 Ga0307412_100143847 166
155 3300031911 Ga0307412_10022690 Ga0307412_100226903 166
156 3300031911 Ga0307412_10036493 Ga0307412_100364935 166
157 3300031911 Ga0307412_10162631 Ga0307412_101626312 166
158 3300032002 Ga0307416_100570300 Ga0307416_1005703001 166
159 3300032004 Ga0307414_10012210 Ga0307414_100122106 166
160 3300032004 Ga0307414_10189099 Ga0307414_101890992 166
161 3300032004 Ga0307414_10942952 Ga0307414_109429522 166
162 3300032005 Ga0307411_10118034 Ga0307411_101180342 166
163 3300037853 Ga0436364_0852694 Ga0436364_0852694_10802_11314 166
164 3300039437 Ga0436365_1329751 Ga0436365_1329751_134_646 166
165 3300041512 Ga0451853_2694079 Ga0451853_2694079_47_550 166
166 3300046519 Ga0495632_0134120 Ga0495632_0134120_61_576 166
167 3300046616 Ga0495668_0000076 Ga0495668_0000076_73131_73637 166
168 3300046660 Ga0495625_0000520 Ga0495625_0000520_18382_18888 166
169 3300048928 Ga0496125_0242506 Ga0496125_0242506_182_688 166
170 3300049568 Ga0501031_0036268 Ga0501031_0036268_2522_3028 166
171 3300049569 Ga0501032_0016683 Ga0501032_0016683_2638_3144 166
172 3300049570 Ga0501033_0321697 Ga0501033_0321697_355_861 166
173 3300049571 Ga0501034_0035875 Ga0501034_0035875_3560_4066 166
174 3300049571 Ga0501034_0530466 Ga0501034_0530466_425_928 166
175 3300049572 Ga0501036_0104308 Ga0501036_0104308_165_671 166
176 3300049573 Ga0501037_0053881 Ga0501037_0053881_1475_1981 166
177 3300049574 Ga0501038_0021428 Ga0501038_0021428_2077_2583 166
178 3300049575 Ga0501039_0029745 Ga0501039_0029745_1463_1969 166
179 3300049576 Ga0501040_0782656 Ga0501040_0782656_36_542 166
180 3300049579 Ga0501043_0368799 Ga0501043_0368799_475_981 166
181 3300049580 Ga0501046_0148635 Ga0501046_0148635_730_1236 166
182 3300049581 Ga0501047_0131015 Ga0501047_0131015_314_820 166
183 3300049589 Ga0501073_0400842 Ga0501073_0400842_362_862 166
184 3300049679 Ga0501249_000545 Ga0501249_000545_6740_7240 166
185 3300049822 Ga0501035_0045752 Ga0501035_0045752_172_678 166
186 3300049823 Ga0501044_0015438 Ga0501044_0015438_5284_5790 166
187 3300049824 Ga0501045_0241061 Ga0501045_0241061_396_902 166
188 3300049850 Ga0501204_008578 Ga0501204_008578_152_652 166
189 3300053090 Ga0500646_0028382 Ga0500646_0028382_802_1323 166
190 3300053116 Ga0500592_000232 Ga0500592_000232_9422_9922 166
191 3300053134 Ga0500658_0077662 Ga0500658_0077662_47_562 166
192 3300053134 Ga0500658_0112069 Ga0500658_0112069_335_835 166
193 3300053139 Ga0500568_0003694 Ga0500568_0003694_2146_2652 166
194 3300053139 Ga0500568_0007935 Ga0500568_0007935_1077_1598 166
195 3300053151 Ga0500604_0000053 Ga0500604_0000053_40450_40971 166
196 3300053153 Ga0500616_0000411 Ga0500616_0000411_37859_38380 166
197 3300053158 Ga0500627_0000757 Ga0500627_0000757_3243_3743 166
198 3300053158 Ga0500627_0231290 Ga0500627_0231290_301_801 166
199 3300053739 Ga0500587_001709 Ga0500587_001709_181_696 166
200 2162886007 SwRhRL2b_contig_1505805 SwRhRL2b_0491.00008690 167
201 2162886007 SwRhRL2b_contig_3439718 SwRhRL2b_0553.00000730 167
202 3300001915 JGI24741J21665_1013465 JGI24741J21665_10134652 167
203 3300001976 JGI24752J21851_1003188 JGI24752J21851_10031883 167
204 3300001979 JGI24740J21852_10002064 JGI24740J21852_100020642 167
205 3300001979 JGI24740J21852_10034057 JGI24740J21852_100340572 167
206 3300001989 JGI24739J22299_10001692 JGI24739J22299_100016929 167
207 3300001990 JGI24737J22298_10024726 JGI24737J22298_100247263 167
208 3300002067 JGI24735J21928_10005665 JGI24735J21928_100056654 167
209 3300002074 JGI24748J21848_1000029 JGI24748J21848_100002967 167
210 3300002075 JGI24738J21930_10000138 JGI24738J21930_100001388 167
211 3300002075 JGI24738J21930_10003295 JGI24738J21930_100032953 167
212 3300002076 JGI24749J21850_1001913 JGI24749J21850_10019132 167
213 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006214 167
214 3300002244 JGI24742J22300_10002513 JGI24742J22300_100025134 167
215 3300002459 JGI24751J29686_10008583 JGI24751J29686_100085832 167
216 3300005289 Ga0065704_10078399 Ga0065704_100783993 167
217 3300005289 Ga0065704_10202209 Ga0065704_102022092 167
218 3300005295 Ga0065707_10082105 Ga0065707_1008210524 167
219 3300005295 Ga0065707_10141585 Ga0065707_101415852 167
220 3300005295 Ga0065707_10484423 Ga0065707_104844232 167
221 3300005327 Ga0070658_10160617 Ga0070658_101606172 167
222 3300005330 Ga0070690_100000002 Ga0070690_100000002138 167
223 3300005331 Ga0070670_100000169 Ga0070670_10000016942 167
224 3300005331 Ga0070670_100073948 Ga0070670_1000739483 167
225 3300005335 Ga0070666_10000002 Ga0070666_10000002500 167
226 3300005340 Ga0070689_100007860 Ga0070689_1000078604 167
227 3300005347 Ga0070668_100324389 Ga0070668_1003243892 167
228 3300005347 Ga0070668_100609554 Ga0070668_1006095541 167
229 3300005353 Ga0070669_100000440 Ga0070669_10000044025 167
230 3300005355 Ga0070671_100027243 Ga0070671_1000272433 167
231 3300005365 Ga0070688_100011582 Ga0070688_1000115822 167
232 3300005366 Ga0070659_100042467 Ga0070659_1000424673 167
233 3300005367 Ga0070667_100000327 Ga0070667_10000032738 167
234 3300005367 Ga0070667_100008584 Ga0070667_1000085845 167
235 3300005455 Ga0070663_100185239 Ga0070663_1001852392 167
236 3300005457 Ga0070662_100006250 Ga0070662_1000062507 167
237 3300005457 Ga0070662_100060346 Ga0070662_1000603462 167
238 3300005466 Ga0070685_10000056 Ga0070685_1000005648 167
239 3300005530 Ga0070679_100354019 Ga0070679_1003540192 167
240 3300005535 Ga0070684_100693090 Ga0070684_1006930902 167
241 3300005539 Ga0068853_100096736 Ga0068853_1000967361 167
242 3300005544 Ga0070686_100000002 Ga0070686_100000002119 167
243 3300005547 Ga0070693_100829250 Ga0070693_1008292502 167
244 3300005548 Ga0070665_100000025 Ga0070665_100000025217 167
245 3300005577 Ga0068857_100015964 Ga0068857_1000159644 167
246 3300005577 Ga0068857_100166790 Ga0068857_1001667902 167
247 3300005578 Ga0068854_100036277 Ga0068854_1000362771 167
248 3300005616 Ga0068852_100215479 Ga0068852_1002154792 167
249 3300005617 Ga0068859_100012055 Ga0068859_1000120557 167
250 3300005617 Ga0068859_100025890 Ga0068859_1000258905 167
251 3300005618 Ga0068864_100000004 Ga0068864_100000004428 167
252 3300005618 Ga0068864_100004976 Ga0068864_1000049767 167
253 3300005834 Ga0068851_10027890 Ga0068851_100278903 167
254 3300005841 Ga0068863_100000002 Ga0068863_100000002429 167
255 3300005841 Ga0068863_100000070 Ga0068863_10000007058 167
256 3300005842 Ga0068858_100002924 Ga0068858_10000292412 167
257 3300005843 Ga0068860_100000001 Ga0068860_100000001507 167
258 3300005844 Ga0068862_100000002 Ga0068862_10000000273 167
259 3300005844 Ga0068862_100000020 Ga0068862_100000020198 167
260 3300005983 Ga0081540_1056312 Ga0081540_10563123 167
261 3300006931 Ga0097620_100012054 Ga0097620_1000120547 167
262 3300006931 Ga0097620_100025890 Ga0097620_1000258905 167
263 3300009011 Ga0105251_10000342 Ga0105251_1000034241 167
264 3300009092 Ga0105250_10260431 Ga0105250_102604311 167
265 3300009101 Ga0105247_10017026 Ga0105247_100170264 167
266 3300009101 Ga0105247_10041415 Ga0105247_100414154 167
267 3300009177 Ga0105248_10000016 Ga0105248_10000016169 167
268 3300009177 Ga0105248_10065895 Ga0105248_100658955 167
269 3300009177 Ga0105248_10509668 Ga0105248_105096682 167
270 3300009545 Ga0105237_10224635 Ga0105237_102246352 167
271 3300009545 Ga0105237_10586709 Ga0105237_105867092 167
272 3300009551 Ga0105238_10051291 Ga0105238_100512915 167
273 3300009553 Ga0105249_10000005 Ga0105249_10000005234 167
274 3300009553 Ga0105249_10000106 Ga0105249_1000010648 167
275 3300010375 Ga0105239_10446539 Ga0105239_104465392 167
276 3300013100 Ga0157373_10152970 Ga0157373_101529702 167
277 3300013104 Ga0157370_10025774 Ga0157370_100257744 167
278 3300013104 Ga0157370_11667324 Ga0157370_116673241 167
279 3300013105 Ga0157369_10133762 Ga0157369_101337624 167
280 3300013297 Ga0157378_10156954 Ga0157378_101569543 167
281 3300013306 Ga0163162_10060819 Ga0163162_100608193 167
282 3300013306 Ga0163162_10503157 Ga0163162_105031572 167
283 3300013307 Ga0157372_10138783 Ga0157372_101387834 167
284 3300013307 Ga0157372_10509317 Ga0157372_105093172 167
285 3300014325 Ga0163163_10101070 Ga0163163_101010704 167
286 3300014326 Ga0157380_10000304 Ga0157380_1000030424 167
287 3300014326 Ga0157380_10183104 Ga0157380_101831042 167
288 3300014968 Ga0157379_10007070 Ga0157379_100070707 167
289 3300014968 Ga0157379_10027796 Ga0157379_100277963 167
290 3300017792 Ga0163161_10000115 Ga0163161_1000011566 167
291 3300025321 Ga0207656_10002142 Ga0207656_100021422 167
292 3300025711 Ga0207696_1167430 Ga0207696_11674301 167
293 3300025735 Ga0207713_1003473 Ga0207713_10034736 167
294 3300025900 Ga0207710_10018928 Ga0207710_100189284 167
295 3300025900 Ga0207710_10065620 Ga0207710_100656202 167
296 3300025903 Ga0207680_10000004 Ga0207680_10000004361 167
297 3300025904 Ga0207647_10000069 Ga0207647_1000006968 167
298 3300025909 Ga0207705_10225117 Ga0207705_102251172 167
299 3300025911 Ga0207654_10006741 Ga0207654_100067415 167
300 3300025913 Ga0207695_10009337 Ga0207695_100093374 167
301 3300025914 Ga0207671_10001601 Ga0207671_100016014 167
302 3300025919 Ga0207657_10029090 Ga0207657_100290902 167
303 3300025921 Ga0207652_11444563 Ga0207652_114445631 167
304 3300025923 Ga0207681_10000130 Ga0207681_1000013039 167
305 3300025924 Ga0207694_10013118 Ga0207694_100131184 167
306 3300025924 Ga0207694_10049465 Ga0207694_100494654 167
307 3300025925 Ga0207650_10000294 Ga0207650_1000029421 167
308 3300025925 Ga0207650_10008589 Ga0207650_100085896 167
309 3300025931 Ga0207644_10056031 Ga0207644_100560312 167
310 3300025933 Ga0207706_10011916 Ga0207706_100119165 167
311 3300025933 Ga0207706_10192545 Ga0207706_101925452 167
312 3300025936 Ga0207670_10010788 Ga0207670_100107884 167
313 3300025941 Ga0207711_10000022 Ga0207711_10000022168 167
314 3300025941 Ga0207711_10010013 Ga0207711_100100135 167
315 3300025941 Ga0207711_10416240 Ga0207711_104162402 167
316 3300025945 Ga0207679_10238592 Ga0207679_102385922 167
317 3300025949 Ga0207667_10005163 Ga0207667_1000516316 167
318 3300025961 Ga0207712_10000001 Ga0207712_10000001235 167
319 3300025961 Ga0207712_10000224 Ga0207712_1000022438 167
320 3300025972 Ga0207668_10309219 Ga0207668_103092191 167
321 3300025972 Ga0207668_10557372 Ga0207668_105573722 167
322 3300025981 Ga0207640_10008627 Ga0207640_100086275 167
323 3300025981 Ga0207640_10045658 Ga0207640_100456581 167
324 3300025986 Ga0207658_10000364 Ga0207658_1000036438 167
325 3300025986 Ga0207658_10002462 Ga0207658_100024626 167
326 3300026035 Ga0207703_10002475 Ga0207703_1000247515 167
327 3300026041 Ga0207639_10131249 Ga0207639_101312492 167
328 3300026041 Ga0207639_10469477 Ga0207639_104694772 167
329 3300026067 Ga0207678_10187042 Ga0207678_101870422 167
330 3300026078 Ga0207702_10003987 Ga0207702_100039874 167
331 3300026078 Ga0207702_10003988 Ga0207702_100039884 167
332 3300026088 Ga0207641_10000002 Ga0207641_10000002908 167
333 3300026088 Ga0207641_10000033 Ga0207641_10000033167 167
334 3300026095 Ga0207676_10000040 Ga0207676_10000040103 167
335 3300026095 Ga0207676_10000546 Ga0207676_1000054615 167
336 3300026116 Ga0207674_10012150 Ga0207674_100121507 167
337 3300026116 Ga0207674_10142596 Ga0207674_101425962 167
338 3300026116 Ga0207674_10279210 Ga0207674_102792102 167
339 3300026118 Ga0207675_100003280 Ga0207675_10000328018 167
340 3300026142 Ga0207698_10026565 Ga0207698_100265652 167
341 3300026142 Ga0207698_10101825 Ga0207698_101018252 167
342 3300028379 Ga0268266_10000028 Ga0268266_10000028170 167
343 3300028380 Ga0268265_10000003 Ga0268265_1000000382 167
344 3300028380 Ga0268265_10000071 Ga0268265_1000007118 167
345 3300028381 Ga0268264_10000006 Ga0268264_10000006361 167
346 3300031548 Ga0307408_100253979 Ga0307408_1002539792 167
347 3300031731 Ga0307405_10071128 Ga0307405_100711283 167
348 3300031901 Ga0307406_10103171 Ga0307406_101031712 167
349 3300031911 Ga0307412_10000165 Ga0307412_1000016523 167
350 3300031911 Ga0307412_10000329 Ga0307412_1000032925 167
351 3300032004 Ga0307414_10000177 Ga0307414_1000017725 167
352 3300033180 Ga0307510_10151301 Ga0307510_101513012 167
353 3300038705 Ga0237819_01727 Ga0237819_01727_1525_2031 167
354 3300041452 Ga0451793_0683499 Ga0451793_0683499_661_1164 167
355 3300041460 Ga0451802_0177882 Ga0451802_0177882_223_732 167
356 3300041463 Ga0451804_0547077 Ga0451804_0547077_443_949 167
357 3300041486 Ga0451807_2507748 Ga0451807_2507748_203_709 167
358 3300046492 Ga0495585_0199770 Ga0495585_0199770_315_818 167
359 3300046501 Ga0495607_0041186 Ga0495607_0041186_712_1215 167
360 3300046513 Ga0495616_0101965 Ga0495616_0101965_208_711 167
361 3300046525 Ga0495663_0004262 Ga0495663_0004262_1925_2428 167
362 3300046525 Ga0495663_0024293 Ga0495663_0024293_985_1488 167
363 3300046530 Ga0495654_0000736 Ga0495654_0000736_9263_9766 167
364 3300046542 Ga0495597_0012717 Ga0495597_0012717_3505_4008 167
365 3300046616 Ga0495668_0001456 Ga0495668_0001456_21023_21526 167
366 3300046616 Ga0495668_0018394 Ga0495668_0018394_790_1293 167
367 3300046794 Ga0495589_0032112 Ga0495589_0032112_1174_1677 167
368 3300047447 Ga0495685_109341 Ga0495685_109341_138_641 167
369 3300047472 Ga0495686_0005031 Ga0495686_0005031_4699_5205 167
370 3300048904 Ga0496101_0080171 Ga0496101_0080171_1108_1611 167
371 3300048904 Ga0496101_0295850 Ga0496101_0295850_16_519 167
372 3300048905 Ga0496102_0003647 Ga0496102_0003647_1242_1745 167
373 3300048905 Ga0496102_0190213 Ga0496102_0190213_1173_1676 167
374 3300048906 Ga0496103_0000840 Ga0496103_0000840_14006_14509 167
375 3300048906 Ga0496103_0007333 Ga0496103_0007333_1154_1657 167
376 3300048907 Ga0496104_0591090 Ga0496104_0591090_127_630 167
377 3300048908 Ga0496105_0178867 Ga0496105_0178867_754_1257 167
378 3300048909 Ga0496106_0050458 Ga0496106_0050458_2205_2708 167
379 3300048910 Ga0496107_0670902 Ga0496107_0670902_142_645 167
380 3300048911 Ga0496108_0308095 Ga0496108_0308095_815_1318 167
381 3300048914 Ga0496111_0348596 Ga0496111_0348596_14_517 167
382 3300048919 Ga0496116_0062100 Ga0496116_0062100_362_865 167
383 3300048920 Ga0496117_0037195 Ga0496117_0037195_1905_2408 167
384 3300048921 Ga0496118_0004860 Ga0496118_0004860_7243_7746 167
385 3300048923 Ga0496120_0015001 Ga0496120_0015001_365_874 167
386 3300048924 Ga0496121_0122657 Ga0496121_0122657_108_611 167
387 3300048924 Ga0496121_0182983 Ga0496121_0182983_786_1289 167
388 3300048925 Ga0496122_0343163 Ga0496122_0343163_99_608 167
389 3300048926 Ga0496123_0101512 Ga0496123_0101512_257_766 167
390 3300048927 Ga0496124_0002002 Ga0496124_0002002_16618_17127 167
391 3300048927 Ga0496124_0007069 Ga0496124_0007069_1163_1672 167
392 3300048927 Ga0496124_0131155 Ga0496124_0131155_1044_1547 167
393 3300048927 Ga0496124_0238959 Ga0496124_0238959_177_686 167
394 3300048928 Ga0496125_0311330 Ga0496125_0311330_272_781 167
395 3300048929 Ga0496126_0096034 Ga0496126_0096034_761_1270 167
396 3300049459 Ga0495678_068031 Ga0495678_068031_735_1238 167
397 3300049513 Ga0501290_017867 Ga0501290_017867_380_883 167
398 3300049515 Ga0501292_000019 Ga0501292_000019_53355_53858 167
399 3300049517 Ga0501294_000190 Ga0501294_000190_1775_2278 167
400 3300049523 Ga0501300_000128 Ga0501300_000128_157_660 167
401 3300049652 Ga0501202_014388 Ga0501202_014388_194_697 167
402 3300049653 Ga0501206_002061 Ga0501206_002061_1620_2123 167
403 3300049662 Ga0501222_000809 Ga0501222_000809_451_954 167
404 3300049663 Ga0501223_022810 Ga0501223_022810_246_749 167
405 3300049664 Ga0501224_003397 Ga0501224_003397_1341_1844 167
406 3300049665 Ga0501227_004681 Ga0501227_004681_230_733 167
407 3300049668 Ga0501233_028842 Ga0501233_028842_516_1019 167
408 3300049669 Ga0501235_000351 Ga0501235_000351_6490_6993 167
409 3300049670 Ga0501236_002609 Ga0501236_002609_437_940 167
410 3300049688 Ga0501259_004339 Ga0501259_004339_1313_1816 167
411 3300049690 Ga0501261_000061 Ga0501261_000061_1800_2303 167
412 3300049704 Ga0501221_093313 Ga0501221_093313_158_661 167
413 3300049705 Ga0501225_0002229 Ga0501225_0002229_5291_5794 167
414 3300049708 Ga0501245_005097 Ga0501245_005097_644_1147 167
415 3300049775 Ga0501279_000008 Ga0501279_000008_74851_75354 167
416 3300049776 Ga0501280_007674 Ga0501280_007674_580_1083 167
417 3300049777 Ga0501281_00097 Ga0501281_00097_1827_2330 167
418 3300049778 Ga0501282_002885 Ga0501282_002885_267_770 167
419 3300049779 Ga0501283_005982 Ga0501283_005982_642_1145 167
420 3300050005 Ga0501284_10670 Ga0501284_10670_25_552 167
421 3300053087 Ga0500643_000338 Ga0500643_000338_8918_9421 167
422 3300053087 Ga0500643_000351 Ga0500643_000351_17156_17680 167
423 3300053087 Ga0500643_001549 Ga0500643_001549_3058_3564 167
424 3300053087 Ga0500643_028605 Ga0500643_028605_339_842 167
425 3300053091 Ga0500647_0044368 Ga0500647_0044368_718_1221 167
426 3300053093 Ga0500651_0042612 Ga0500651_0042612_139_642 167
427 3300053094 Ga0500566_0071474 Ga0500566_0071474_1061_1564 167
428 3300053109 Ga0500569_069374 Ga0500569_069374_549_1052 167
429 3300053116 Ga0500592_000578 Ga0500592_000578_2962_3465 167
430 3300053121 Ga0500607_160345 Ga0500607_160345_422_931 167
431 3300053125 Ga0500618_011999 Ga0500618_011999_1567_2070 167
432 3300053130 Ga0500642_0018625 Ga0500642_0018625_274_777 167
433 3300053133 Ga0500655_011842 Ga0500655_011842_189_692 167
434 3300053136 Ga0500559_0007211 Ga0500559_0007211_2283_2807 167
435 3300053142 Ga0500577_0039468 Ga0500577_0039468_856_1359 167
436 3300053146 Ga0500588_0058586 Ga0500588_0058586_456_965 167
437 3300053148 Ga0500590_005065 Ga0500590_005065_3402_3905 167
438 3300053151 Ga0500604_0014126 Ga0500604_0014126_1215_1718 167
439 3300053151 Ga0500604_0269082 Ga0500604_0269082_53_556 167
440 3300053156 Ga0500622_0038995 Ga0500622_0038995_743_1246 167
441 3300053158 Ga0500627_0002521 Ga0500627_0002521_4369_4872 167
442 3300053158 Ga0500627_0075720 Ga0500627_0075720_376_879 167
443 3300053724 Ga0500570_001921 Ga0500570_001921_8414_8917 167
444 3300053730 Ga0500645_028013 Ga0500645_028013_777_1295 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

5

137

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9388 1 160
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9346 1 160
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9295 3 159
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9285 3 159
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9273 1 160
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9224 3 159 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9154 1 159 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9135 1 159 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9045 3 159 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8944 1 159 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A520HSR6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9836 1 90 GO:0004595
GO:0005737
GO:0015937
AF-A0A520HSR6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9729 1 90 GO:0004595
GO:0005737
GO:0015937
AF-A0A520DEJ7-F1-model_v4 deleted 0.9588 1 105
AF-A0A660VY32-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9474 3 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9472 3 167 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
89.24 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map