F445372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 444 | 264 | 431 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300053090|Ga0500646_0028382|Ga0500646_0028382_802_1323 |
| Length | 173 |
| Sequence | MRTGVYPGTFDPITLGHMDIIRRAAHLVDRLVIGVTTNPSKSPMFTVEERLAMVERETASVTDGAALSVVAFDSLLMDFAEAQGASMIVRGLRAVADFEYEYQMAGMNQQLNADIETVFLMADVSLQPIASKLVKEIAIYGGDISRFVPPAVVGEVSRRVAEIGRKGTPPPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 6 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 7 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 8 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 9 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 10 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 11 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 12 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 13 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 14 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 15 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 185 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 186 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 187 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 188 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 189 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 196 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 197 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 198 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 199 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 216 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 225 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 228 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 230 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 232 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 233 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 234 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 239 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 240 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 241 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 242 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 243 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 244 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 245 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 246 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 247 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 248 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 250 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 251 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 253 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 255 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 256 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 257 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 258 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 259 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 260 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 262 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 264 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.07 |
| Metatranscriptomes | 0 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.49 |
| Nodule | 0 |
| Rhizoplane | 4.28 |
| Rhizosphere | 76.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1505805 | 2162886007 | Bacteria | 987 |
| 2 | SwRhRL2b_contig_3439718 | 2162886007 | Bacteria | 1009 |
| 3 | JGI24741J21665_1013465 | 3300001915 | Bacteria | 1387 |
| 4 | JGI24752J21851_1003188 | 3300001976 | Bacteria | 2164 |
| 5 | JGI24740J21852_10002064 | 3300001979 | Bacteria | 9182 |
| 6 | JGI24740J21852_10034057 | 3300001979 | Bacteria | 1609 |
| 7 | JGI24739J22299_10001692 | 3300001989 | Bacteria | 8378 |
| 8 | JGI24737J22298_10024726 | 3300001990 | Bacteria | 1901 |
| 9 | JGI24735J21928_10005665 | 3300002067 | Bacteria | 4130 |
| 10 | JGI24748J21848_1000029 | 3300002074 | Bacteria | 90134 |
| 11 | JGI24738J21930_10000138 | 3300002075 | Bacteria | 17795 |
| 12 | JGI24738J21930_10003295 | 3300002075 | Bacteria | 4103 |
| 13 | JGI24749J21850_1000094 | 3300002076 | Bacteria | 15838 |
| 14 | JGI24749J21850_1001913 | 3300002076 | Bacteria | 2941 |
| 15 | JGI24034J26672_10000006 | 3300002239 | Bacteria | 294495 |
| 16 | JGI24742J22300_10002513 | 3300002244 | Bacteria | 2931 |
| 17 | JGI24751J29686_10000093 | 3300002459 | Bacteria | 50074 |
| 18 | JGI24751J29686_10008583 | 3300002459 | Bacteria | 2092 |
| 19 | JGI24751J29686_10021088 | 3300002459 | Bacteria | 1351 |
| 20 | Ga0055536_1010070 | 3300003781 | Bacteria | 3809 |
| 21 | Ga0055534_1019334 | 3300003784 | Bacteria | 1171 |
| 22 | Ga0055530_10000083 | 3300003791 | Bacteria | 81772 |
| 23 | Ga0055530_10068130 | 3300003791 | Bacteria | 774 |
| 24 | Ga0055531_10000316 | 3300003794 | Bacteria | 47444 |
| 25 | Ga0055531_10001717 | 3300003794 | Bacteria | 15697 |
| 26 | Ga0065704_10078399 | 3300005289 | Bacteria | 4441 |
| 27 | Ga0065704_10202209 | 3300005289 | Bacteria | 1141 |
| 28 | Ga0065715_10916673 | 3300005293 | Bacteria | 570 |
| 29 | Ga0065707_10082105 | 3300005295 | Bacteria | 21836 |
| 30 | Ga0065707_10082467 | 3300005295 | Bacteria | 14795 |
| 31 | Ga0065707_10141585 | 3300005295 | Bacteria | 1765 |
| 32 | Ga0065707_10484423 | 3300005295 | Bacteria | 771 |
| 33 | Ga0070658_10137441 | 3300005327 | Bacteria | 2040 |
| 34 | Ga0070658_10160617 | 3300005327 | Bacteria | 1885 |
| 35 | Ga0070690_100000002 | 3300005330 | Bacteria | 176748 |
| 36 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 37 | Ga0070670_100000169 | 3300005331 | Bacteria | 59093 |
| 38 | Ga0070670_100000528 | 3300005331 | Bacteria | 30641 |
| 39 | Ga0070670_100073948 | 3300005331 | Bacteria | 2927 |
| 40 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 41 | Ga0070666_10035929 | 3300005335 | Bacteria | 3286 |
| 42 | Ga0070689_100007860 | 3300005340 | Bacteria | 7477 |
| 43 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 44 | Ga0070668_100324389 | 3300005347 | Bacteria | 1297 |
| 45 | Ga0070668_100609554 | 3300005347 | Bacteria | 956 |
| 46 | Ga0070669_100000195 | 3300005353 | Bacteria | 53791 |
| 47 | Ga0070669_100000440 | 3300005353 | Bacteria | 31718 |
| 48 | Ga0070669_100034494 | 3300005353 | Bacteria | 3663 |
| 49 | Ga0070671_100000388 | 3300005355 | Bacteria | 30256 |
| 50 | Ga0070671_100027243 | 3300005355 | Bacteria | 4702 |
| 51 | Ga0070674_100707454 | 3300005356 | Bacteria | 862 |
| 52 | Ga0070673_101380978 | 3300005364 | Bacteria | 663 |
| 53 | Ga0070688_100011582 | 3300005365 | Bacteria | 4905 |
| 54 | Ga0070659_100042467 | 3300005366 | Bacteria | 3554 |
| 55 | Ga0070659_100369057 | 3300005366 | Bacteria | 1207 |
| 56 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 57 | Ga0070667_100000327 | 3300005367 | Bacteria | 52972 |
| 58 | Ga0070667_100001850 | 3300005367 | Bacteria | 18783 |
| 59 | Ga0070667_100008584 | 3300005367 | Bacteria | 8468 |
| 60 | Ga0070663_100185239 | 3300005455 | Bacteria | 1617 |
| 61 | Ga0070662_100006250 | 3300005457 | Bacteria | 7670 |
| 62 | Ga0070662_100060346 | 3300005457 | Bacteria | 2765 |
| 63 | Ga0070662_100608194 | 3300005457 | Bacteria | 920 |
| 64 | Ga0070662_101024679 | 3300005457 | Bacteria | 707 |
| 65 | Ga0070681_10237857 | 3300005458 | Bacteria | 1735 |
| 66 | Ga0070685_10000056 | 3300005466 | Bacteria | 68183 |
| 67 | Ga0070679_100354019 | 3300005530 | Bacteria | 1416 |
| 68 | Ga0070684_100693090 | 3300005535 | Bacteria | 949 |
| 69 | Ga0068853_100096736 | 3300005539 | Bacteria | 2605 |
| 70 | Ga0070672_100229285 | 3300005543 | Bacteria | 1560 |
| 71 | Ga0070686_100000002 | 3300005544 | Bacteria | 336303 |
| 72 | Ga0070693_100829250 | 3300005547 | Bacteria | 688 |
| 73 | Ga0070665_100000025 | 3300005548 | Bacteria | 367488 |
| 74 | Ga0070665_100004060 | 3300005548 | Bacteria | 15401 |
| 75 | Ga0070665_100657668 | 3300005548 | Bacteria | 1061 |
| 76 | Ga0068855_100004366 | 3300005563 | Bacteria | 17285 |
| 77 | Ga0068857_100015964 | 3300005577 | Bacteria | 6577 |
| 78 | Ga0068857_100134454 | 3300005577 | Bacteria | 2232 |
| 79 | Ga0068857_100166790 | 3300005577 | Bacteria | 2000 |
| 80 | Ga0068854_100029193 | 3300005578 | Bacteria | 3817 |
| 81 | Ga0068854_100036277 | 3300005578 | Bacteria | 3456 |
| 82 | Ga0068854_100322165 | 3300005578 | Bacteria | 1257 |
| 83 | Ga0068856_100058625 | 3300005614 | Bacteria | 3803 |
| 84 | Ga0068852_100215479 | 3300005616 | Bacteria | 1824 |
| 85 | Ga0068859_100008939 | 3300005617 | Bacteria | 10118 |
| 86 | Ga0068859_100012055 | 3300005617 | Bacteria | 8685 |
| 87 | Ga0068859_100012820 | 3300005617 | Bacteria | 8419 |
| 88 | Ga0068859_100025890 | 3300005617 | Bacteria | 5886 |
| 89 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 90 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 91 | Ga0068864_100004976 | 3300005618 | Bacteria | 10896 |
| 92 | Ga0068861_100220277 | 3300005719 | Bacteria | 1603 |
| 93 | Ga0068851_10027890 | 3300005834 | Bacteria | 2786 |
| 94 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 95 | Ga0068863_100000070 | 3300005841 | Bacteria | 115715 |
| 96 | Ga0068863_100003398 | 3300005841 | Bacteria | 15704 |
| 97 | Ga0068863_100017965 | 3300005841 | Bacteria | 6769 |
| 98 | Ga0068858_100001881 | 3300005842 | Bacteria | 21432 |
| 99 | Ga0068858_100002924 | 3300005842 | Bacteria | 17185 |
| 100 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 101 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 102 | Ga0068860_100040511 | 3300005843 | Bacteria | 4451 |
| 103 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 104 | Ga0068862_100000011 | 3300005844 | Bacteria | 270105 |
| 105 | Ga0068862_100000020 | 3300005844 | Bacteria | 219516 |
| 106 | Ga0068862_100000989 | 3300005844 | Bacteria | 27179 |
| 107 | Ga0081540_1056312 | 3300005983 | Bacteria | 1909 |
| 108 | Ga0097620_100008939 | 3300006931 | Bacteria | 10118 |
| 109 | Ga0097620_100012054 | 3300006931 | Bacteria | 8685 |
| 110 | Ga0097620_100012820 | 3300006931 | Bacteria | 8419 |
| 111 | Ga0097620_100025890 | 3300006931 | Bacteria | 5886 |
| 112 | Ga0105251_10000342 | 3300009011 | Bacteria | 46221 |
| 113 | Ga0105250_10260431 | 3300009092 | Bacteria | 743 |
| 114 | Ga0105240_10009282 | 3300009093 | Bacteria | 13947 |
| 115 | Ga0111539_10382741 | 3300009094 | Bacteria | 1638 |
| 116 | Ga0105247_10017026 | 3300009101 | Bacteria | 4361 |
| 117 | Ga0105247_10041415 | 3300009101 | Bacteria | 2819 |
| 118 | Ga0105241_10230273 | 3300009174 | Bacteria | 1562 |
| 119 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 120 | Ga0105248_10000069 | 3300009177 | Bacteria | 120989 |
| 121 | Ga0105248_10065895 | 3300009177 | Bacteria | 4067 |
| 122 | Ga0105248_10509668 | 3300009177 | Bacteria | 1357 |
| 123 | Ga0105237_10224635 | 3300009545 | Bacteria | 1878 |
| 124 | Ga0105237_10586709 | 3300009545 | Bacteria | 1121 |
| 125 | Ga0105237_10599018 | 3300009545 | Bacteria | 1109 |
| 126 | Ga0105238_10051291 | 3300009551 | Bacteria | 4150 |
| 127 | Ga0105238_10072055 | 3300009551 | Bacteria | 3452 |
| 128 | Ga0105238_11100422 | 3300009551 | Bacteria | 817 |
| 129 | Ga0105249_10000005 | 3300009553 | Bacteria | 362467 |
| 130 | Ga0105249_10000106 | 3300009553 | Bacteria | 115526 |
| 131 | Ga0105249_10369014 | 3300009553 | Bacteria | 1458 |
| 132 | Ga0105249_10810158 | 3300009553 | Bacteria | 1001 |
| 133 | Ga0105239_10446539 | 3300010375 | Bacteria | 1467 |
| 134 | Ga0105239_10509252 | 3300010375 | Bacteria | 1369 |
| 135 | Ga0105239_10852509 | 3300010375 | Bacteria | 1045 |
| 136 | Ga0157326_1000303 | 3300012513 | Bacteria | 5782 |
| 137 | Ga0157373_10152970 | 3300013100 | Bacteria | 1623 |
| 138 | Ga0157370_10025774 | 3300013104 | Bacteria | 5818 |
| 139 | Ga0157370_11603128 | 3300013104 | Bacteria | 585 |
| 140 | Ga0157370_11667324 | 3300013104 | Bacteria | 572 |
| 141 | Ga0157369_10133762 | 3300013105 | Bacteria | 2626 |
| 142 | Ga0157374_10365013 | 3300013296 | Bacteria | 1436 |
| 143 | Ga0157378_10156954 | 3300013297 | Bacteria | 2125 |
| 144 | Ga0163162_10060819 | 3300013306 | Bacteria | 3814 |
| 145 | Ga0163162_10503157 | 3300013306 | Bacteria | 1342 |
| 146 | Ga0157372_10138783 | 3300013307 | Bacteria | 2800 |
| 147 | Ga0157372_10509317 | 3300013307 | Bacteria | 1403 |
| 148 | Ga0163163_10101070 | 3300014325 | Bacteria | 2906 |
| 149 | Ga0157380_10000304 | 3300014326 | Bacteria | 29589 |
| 150 | Ga0157380_10000363 | 3300014326 | Bacteria | 27231 |
| 151 | Ga0157380_10183104 | 3300014326 | Bacteria | 1842 |
| 152 | Ga0157379_10007070 | 3300014968 | Bacteria | 9701 |
| 153 | Ga0157379_10027796 | 3300014968 | Bacteria | 5035 |
| 154 | Ga0163161_10000115 | 3300017792 | Bacteria | 76319 |
| 155 | Ga0213876_10432585 | 3300021384 | Bacteria | 700 |
| 156 | Ga0213875_10001461 | 3300021388 | Bacteria | 15300 |
| 157 | Ga0209675_1000190 | 3300025291 | Bacteria | 67514 |
| 158 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 159 | Ga0209676_1000133 | 3300025292 | Bacteria | 184430 |
| 160 | Ga0209676_1000769 | 3300025292 | Bacteria | 42909 |
| 161 | Ga0209025_1015501 | 3300025294 | Bacteria | 4587 |
| 162 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 163 | Ga0209050_1001738 | 3300025298 | Bacteria | 21673 |
| 164 | Ga0209050_1011629 | 3300025298 | Bacteria | 4145 |
| 165 | Ga0209257_1000132 | 3300025304 | Bacteria | 210870 |
| 166 | Ga0209257_1000206 | 3300025304 | Bacteria | 142184 |
| 167 | Ga0207656_10002142 | 3300025321 | Bacteria | 6593 |
| 168 | Ga0207696_1167430 | 3300025711 | Bacteria | 583 |
| 169 | Ga0207713_1003473 | 3300025735 | Bacteria | 10729 |
| 170 | Ga0207710_10018928 | 3300025900 | Bacteria | 2934 |
| 171 | Ga0207710_10065620 | 3300025900 | Bacteria | 1655 |
| 172 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 173 | Ga0207680_10019012 | 3300025903 | Bacteria | 3668 |
| 174 | Ga0207647_10000069 | 3300025904 | Bacteria | 80952 |
| 175 | Ga0207705_10225117 | 3300025909 | Bacteria | 1425 |
| 176 | Ga0207654_10006741 | 3300025911 | Bacteria | 5775 |
| 177 | Ga0207707_10405559 | 3300025912 | Bacteria | 1170 |
| 178 | Ga0207695_10007597 | 3300025913 | Bacteria | 13744 |
| 179 | Ga0207695_10009337 | 3300025913 | Bacteria | 12132 |
| 180 | Ga0207671_10001601 | 3300025914 | Bacteria | 25733 |
| 181 | Ga0207657_10029090 | 3300025919 | Bacteria | 5034 |
| 182 | Ga0207652_11444563 | 3300025921 | Bacteria | 591 |
| 183 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 184 | Ga0207681_10000130 | 3300025923 | Bacteria | 61067 |
| 185 | Ga0207681_10069244 | 3300025923 | Bacteria | 2454 |
| 186 | Ga0207681_10122918 | 3300025923 | Bacteria | 1906 |
| 187 | Ga0207694_10013118 | 3300025924 | Bacteria | 6239 |
| 188 | Ga0207694_10014424 | 3300025924 | Bacteria | 5957 |
| 189 | Ga0207694_10049465 | 3300025924 | Bacteria | 3254 |
| 190 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 191 | Ga0207650_10000294 | 3300025925 | Bacteria | 50141 |
| 192 | Ga0207650_10004568 | 3300025925 | Bacteria | 9467 |
| 193 | Ga0207650_10008589 | 3300025925 | Bacteria | 6974 |
| 194 | Ga0207644_10000197 | 3300025931 | Bacteria | 42679 |
| 195 | Ga0207644_10056031 | 3300025931 | Bacteria | 2843 |
| 196 | Ga0207706_10011916 | 3300025933 | Bacteria | 7916 |
| 197 | Ga0207706_10192545 | 3300025933 | Bacteria | 1789 |
| 198 | Ga0207706_11060792 | 3300025933 | Bacteria | 679 |
| 199 | Ga0207670_10010788 | 3300025936 | Bacteria | 5271 |
| 200 | Ga0207691_10093950 | 3300025940 | Bacteria | 2684 |
| 201 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 202 | Ga0207711_10001064 | 3300025941 | Bacteria | 26287 |
| 203 | Ga0207711_10010013 | 3300025941 | Bacteria | 7878 |
| 204 | Ga0207711_10416240 | 3300025941 | Bacteria | 1250 |
| 205 | Ga0207679_10238592 | 3300025945 | Bacteria | 1539 |
| 206 | Ga0207667_10000651 | 3300025949 | Bacteria | 45008 |
| 207 | Ga0207667_10005163 | 3300025949 | Bacteria | 15952 |
| 208 | Ga0207651_10367660 | 3300025960 | Bacteria | 1216 |
| 209 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 210 | Ga0207712_10000224 | 3300025961 | Bacteria | 55674 |
| 211 | Ga0207712_10213795 | 3300025961 | Bacteria | 1537 |
| 212 | Ga0207712_10611587 | 3300025961 | Bacteria | 944 |
| 213 | Ga0207668_10000026 | 3300025972 | Bacteria | 128309 |
| 214 | Ga0207668_10309219 | 3300025972 | Bacteria | 1307 |
| 215 | Ga0207668_10557372 | 3300025972 | Bacteria | 993 |
| 216 | Ga0207640_10008627 | 3300025981 | Bacteria | 5665 |
| 217 | Ga0207640_10011938 | 3300025981 | Bacteria | 4933 |
| 218 | Ga0207640_10045658 | 3300025981 | Bacteria | 2814 |
| 219 | Ga0207640_10182577 | 3300025981 | Bacteria | 1574 |
| 220 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 221 | Ga0207658_10000364 | 3300025986 | Bacteria | 44527 |
| 222 | Ga0207658_10000902 | 3300025986 | Bacteria | 24720 |
| 223 | Ga0207658_10002462 | 3300025986 | Bacteria | 13518 |
| 224 | Ga0207703_10000404 | 3300026035 | Bacteria | 46297 |
| 225 | Ga0207703_10002475 | 3300026035 | Bacteria | 16017 |
| 226 | Ga0207703_11504355 | 3300026035 | Bacteria | 648 |
| 227 | Ga0207639_10016543 | 3300026041 | Bacteria | 5221 |
| 228 | Ga0207639_10131249 | 3300026041 | Bacteria | 2074 |
| 229 | Ga0207639_10469477 | 3300026041 | Bacteria | 1145 |
| 230 | Ga0207678_10187042 | 3300026067 | Bacteria | 1769 |
| 231 | Ga0207702_10003987 | 3300026078 | Bacteria | 13255 |
| 232 | Ga0207702_10003988 | 3300026078 | Bacteria | 13255 |
| 233 | Ga0207702_10076647 | 3300026078 | Bacteria | 2890 |
| 234 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 235 | Ga0207641_10000033 | 3300026088 | Bacteria | 219261 |
| 236 | Ga0207641_10004973 | 3300026088 | Bacteria | 11403 |
| 237 | Ga0207641_10006503 | 3300026088 | Bacteria | 9839 |
| 238 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 239 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 240 | Ga0207676_10000546 | 3300026095 | Bacteria | 31410 |
| 241 | Ga0207674_10012150 | 3300026116 | Bacteria | 9640 |
| 242 | Ga0207674_10142596 | 3300026116 | Bacteria | 2355 |
| 243 | Ga0207674_10143991 | 3300026116 | Bacteria | 2342 |
| 244 | Ga0207674_10249348 | 3300026116 | Bacteria | 1722 |
| 245 | Ga0207674_10279210 | 3300026116 | Bacteria | 1618 |
| 246 | Ga0207675_100003280 | 3300026118 | Bacteria | 15849 |
| 247 | Ga0207675_100004115 | 3300026118 | Bacteria | 14077 |
| 248 | Ga0207675_100132806 | 3300026118 | Bacteria | 2360 |
| 249 | Ga0207698_10026565 | 3300026142 | Bacteria | 4096 |
| 250 | Ga0207698_10101825 | 3300026142 | Bacteria | 2383 |
| 251 | Ga0207698_10524414 | 3300026142 | Bacteria | 1157 |
| 252 | Ga0268266_10000028 | 3300028379 | Bacteria | 425294 |
| 253 | Ga0268266_10001270 | 3300028379 | Bacteria | 30813 |
| 254 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 255 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 256 | Ga0268265_10000071 | 3300028380 | Bacteria | 132890 |
| 257 | Ga0268265_10001985 | 3300028380 | Bacteria | 16188 |
| 258 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 259 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 260 | Ga0268264_10754516 | 3300028381 | Bacteria | 970 |
| 261 | Ga0307517_10511383 | 3300028786 | Bacteria | 609 |
| 262 | Ga0307513_10614222 | 3300031456 | Bacteria | 796 |
| 263 | Ga0307408_100253979 | 3300031548 | Bacteria | 1451 |
| 264 | Ga0307408_101781625 | 3300031548 | Bacteria | 588 |
| 265 | Ga0307405_10057984 | 3300031731 | Bacteria | 2435 |
| 266 | Ga0307405_10068751 | 3300031731 | Bacteria | 2268 |
| 267 | Ga0307405_10071128 | 3300031731 | Bacteria | 2237 |
| 268 | Ga0307405_10458954 | 3300031731 | Bacteria | 1012 |
| 269 | Ga0307410_10274723 | 3300031852 | Bacteria | 1320 |
| 270 | Ga0307406_10103171 | 3300031901 | Bacteria | 1947 |
| 271 | Ga0307412_10000165 | 3300031911 | Bacteria | 46841 |
| 272 | Ga0307412_10000329 | 3300031911 | Bacteria | 30093 |
| 273 | Ga0307412_10014384 | 3300031911 | Bacteria | 4665 |
| 274 | Ga0307412_10022690 | 3300031911 | Bacteria | 3853 |
| 275 | Ga0307412_10036493 | 3300031911 | Bacteria | 3150 |
| 276 | Ga0307412_10162631 | 3300031911 | Bacteria | 1660 |
| 277 | Ga0307416_100570300 | 3300032002 | Bacteria | 1208 |
| 278 | Ga0307416_101789066 | 3300032002 | Bacteria | 718 |
| 279 | Ga0307414_10000177 | 3300032004 | Bacteria | 43274 |
| 280 | Ga0307414_10012210 | 3300032004 | Bacteria | 5068 |
| 281 | Ga0307414_10189099 | 3300032004 | Bacteria | 1664 |
| 282 | Ga0307414_10942952 | 3300032004 | Bacteria | 793 |
| 283 | Ga0307411_10118034 | 3300032005 | Bacteria | 1913 |
| 284 | Ga0307510_10151301 | 3300033180 | Bacteria | 1939 |
| 285 | Ga0436364_0852694 | 3300037853 | Bacteria | 36694 |
| 286 | Ga0237819_01727 | 3300038705 | Bacteria | 5207 |
| 287 | Ga0436365_1329751 | 3300039437 | Bacteria | 890 |
| 288 | Ga0436363_0443886 | 3300039450 | Bacteria | 4840 |
| 289 | Ga0451793_0683499 | 3300041452 | Bacteria | 1342 |
| 290 | Ga0451795_0780312 | 3300041456 | Bacteria | 1369 |
| 291 | Ga0451802_0177882 | 3300041460 | Bacteria | 800 |
| 292 | Ga0451804_0547077 | 3300041463 | Bacteria | 1096 |
| 293 | Ga0451807_0425266 | 3300041486 | Bacteria | 1136 |
| 294 | Ga0451807_2507748 | 3300041486 | Bacteria | 760 |
| 295 | Ga0451853_2694079 | 3300041512 | Bacteria | 743 |
| 296 | Ga0495585_0199770 | 3300046492 | Bacteria | 1019 |
| 297 | Ga0495607_0041186 | 3300046501 | Bacteria | 2745 |
| 298 | Ga0495616_0101965 | 3300046513 | Bacteria | 1345 |
| 299 | Ga0495632_0134120 | 3300046519 | Bacteria | 1151 |
| 300 | Ga0495663_0004262 | 3300046525 | Bacteria | 4033 |
| 301 | Ga0495663_0024293 | 3300046525 | Bacteria | 1761 |
| 302 | Ga0495654_0000736 | 3300046530 | Bacteria | 25435 |
| 303 | Ga0495597_0012717 | 3300046542 | Bacteria | 4054 |
| 304 | Ga0495668_0000076 | 3300046616 | Bacteria | 161826 |
| 305 | Ga0495668_0001456 | 3300046616 | Bacteria | 22791 |
| 306 | Ga0495668_0018394 | 3300046616 | Bacteria | 4037 |
| 307 | Ga0495625_0000520 | 3300046660 | Bacteria | 56778 |
| 308 | Ga0495589_0032112 | 3300046794 | Bacteria | 2641 |
| 309 | Ga0495685_109341 | 3300047447 | Bacteria | 910 |
| 310 | Ga0495686_0005031 | 3300047472 | Bacteria | 10612 |
| 311 | Ga0496101_0080171 | 3300048904 | Bacteria | 2411 |
| 312 | Ga0496101_0295850 | 3300048904 | Bacteria | 1267 |
| 313 | Ga0496102_0003647 | 3300048905 | Bacteria | 13024 |
| 314 | Ga0496102_0190213 | 3300048905 | Bacteria | 1934 |
| 315 | Ga0496103_0000840 | 3300048906 | Bacteria | 22462 |
| 316 | Ga0496103_0007333 | 3300048906 | Bacteria | 6572 |
| 317 | Ga0496104_0591090 | 3300048907 | Bacteria | 1020 |
| 318 | Ga0496105_0178867 | 3300048908 | Bacteria | 1737 |
| 319 | Ga0496106_0050458 | 3300048909 | Bacteria | 3136 |
| 320 | Ga0496107_0670902 | 3300048910 | Bacteria | 763 |
| 321 | Ga0496108_0308095 | 3300048911 | Bacteria | 1380 |
| 322 | Ga0496111_0348596 | 3300048914 | Bacteria | 1096 |
| 323 | Ga0496116_0062100 | 3300048919 | Bacteria | 2414 |
| 324 | Ga0496117_0037195 | 3300048920 | Bacteria | 3629 |
| 325 | Ga0496118_0004860 | 3300048921 | Bacteria | 15648 |
| 326 | Ga0496120_0015001 | 3300048923 | Bacteria | 5131 |
| 327 | Ga0496121_0122657 | 3300048924 | Bacteria | 1959 |
| 328 | Ga0496121_0182983 | 3300048924 | Bacteria | 1510 |
| 329 | Ga0496122_0343163 | 3300048925 | Bacteria | 783 |
| 330 | Ga0496123_0101512 | 3300048926 | Bacteria | 1672 |
| 331 | Ga0496124_0002002 | 3300048927 | Bacteria | 27746 |
| 332 | Ga0496124_0007069 | 3300048927 | Bacteria | 12023 |
| 333 | Ga0496124_0131155 | 3300048927 | Bacteria | 1991 |
| 334 | Ga0496124_0238959 | 3300048927 | Bacteria | 1352 |
| 335 | Ga0496125_0177437 | 3300048928 | Bacteria | 1424 |
| 336 | Ga0496125_0242506 | 3300048928 | Bacteria | 1143 |
| 337 | Ga0496125_0311330 | 3300048928 | Bacteria | 959 |
| 338 | Ga0496126_0096034 | 3300048929 | Bacteria | 2599 |
| 339 | Ga0495678_068031 | 3300049459 | Bacteria | 1314 |
| 340 | Ga0501290_000086 | 3300049513 | Bacteria | 13288 |
| 341 | Ga0501290_017867 | 3300049513 | Bacteria | 952 |
| 342 | Ga0501292_000019 | 3300049515 | Bacteria | 55694 |
| 343 | Ga0501294_000190 | 3300049517 | Bacteria | 7585 |
| 344 | Ga0501300_000128 | 3300049523 | Bacteria | 11180 |
| 345 | Ga0501301_005570 | 3300049524 | Bacteria | 927 |
| 346 | Ga0501031_0036268 | 3300049568 | Bacteria | 3216 |
| 347 | Ga0501032_0016683 | 3300049569 | Bacteria | 5161 |
| 348 | Ga0501032_0043876 | 3300049569 | Bacteria | 3027 |
| 349 | Ga0501033_0321697 | 3300049570 | Bacteria | 1086 |
| 350 | Ga0501034_0035875 | 3300049571 | Bacteria | 5027 |
| 351 | Ga0501034_0530466 | 3300049571 | Bacteria | 1088 |
| 352 | Ga0501036_0104308 | 3300049572 | Bacteria | 2397 |
| 353 | Ga0501037_0053881 | 3300049573 | Bacteria | 2942 |
| 354 | Ga0501038_0021428 | 3300049574 | Bacteria | 5800 |
| 355 | Ga0501039_0029745 | 3300049575 | Bacteria | 4208 |
| 356 | Ga0501040_0782656 | 3300049576 | Bacteria | 690 |
| 357 | Ga0501043_0368799 | 3300049579 | Bacteria | 1088 |
| 358 | Ga0501046_0148635 | 3300049580 | Bacteria | 1768 |
| 359 | Ga0501047_0000402 | 3300049581 | Bacteria | 48648 |
| 360 | Ga0501047_0131015 | 3300049581 | Bacteria | 2388 |
| 361 | Ga0501048_0235742 | 3300049582 | Bacteria | 1298 |
| 362 | Ga0501073_0400842 | 3300049589 | Bacteria | 948 |
| 363 | Ga0501202_014388 | 3300049652 | Bacteria | 1515 |
| 364 | Ga0501206_002061 | 3300049653 | Bacteria | 2537 |
| 365 | Ga0501222_000809 | 3300049662 | Bacteria | 4497 |
| 366 | Ga0501222_002076 | 3300049662 | Bacteria | 2772 |
| 367 | Ga0501223_008808 | 3300049663 | Bacteria | 2054 |
| 368 | Ga0501223_022810 | 3300049663 | Bacteria | 1222 |
| 369 | Ga0501224_003397 | 3300049664 | Bacteria | 2217 |
| 370 | Ga0501224_017889 | 3300049664 | Bacteria | 1055 |
| 371 | Ga0501227_004681 | 3300049665 | Bacteria | 2936 |
| 372 | Ga0501233_028842 | 3300049668 | Bacteria | 1241 |
| 373 | Ga0501235_000351 | 3300049669 | Bacteria | 8794 |
| 374 | Ga0501235_052167 | 3300049669 | Bacteria | 949 |
| 375 | Ga0501236_002609 | 3300049670 | Bacteria | 2078 |
| 376 | Ga0501249_000545 | 3300049679 | Bacteria | 9066 |
| 377 | Ga0501257_071740 | 3300049686 | Bacteria | 885 |
| 378 | Ga0501259_004339 | 3300049688 | Bacteria | 2258 |
| 379 | Ga0501261_000061 | 3300049690 | Bacteria | 19269 |
| 380 | Ga0501221_093313 | 3300049704 | Bacteria | 738 |
| 381 | Ga0501225_0002229 | 3300049705 | Bacteria | 5993 |
| 382 | Ga0501225_0009588 | 3300049705 | Bacteria | 2751 |
| 383 | Ga0501245_005097 | 3300049708 | Bacteria | 1816 |
| 384 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 385 | Ga0501280_000131 | 3300049776 | Bacteria | 19531 |
| 386 | Ga0501280_007674 | 3300049776 | Bacteria | 1506 |
| 387 | Ga0501281_00097 | 3300049777 | Bacteria | 10413 |
| 388 | Ga0501282_002885 | 3300049778 | Bacteria | 1860 |
| 389 | Ga0501282_009683 | 3300049778 | Bacteria | 1034 |
| 390 | Ga0501283_005982 | 3300049779 | Bacteria | 1689 |
| 391 | Ga0501035_0045752 | 3300049822 | Bacteria | 3936 |
| 392 | Ga0501044_0015438 | 3300049823 | Bacteria | 8225 |
| 393 | Ga0501044_0128928 | 3300049823 | Bacteria | 2525 |
| 394 | Ga0501045_0241061 | 3300049824 | Bacteria | 1346 |
| 395 | Ga0501204_008578 | 3300049850 | Bacteria | 1169 |
| 396 | Ga0501284_10670 | 3300050005 | Bacteria | 564 |
| 397 | Ga0500643_000338 | 3300053087 | Bacteria | 37288 |
| 398 | Ga0500643_000351 | 3300053087 | Bacteria | 36635 |
| 399 | Ga0500643_001549 | 3300053087 | Bacteria | 13025 |
| 400 | Ga0500643_028605 | 3300053087 | Bacteria | 1722 |
| 401 | Ga0500646_0028382 | 3300053090 | Bacteria | 1527 |
| 402 | Ga0500647_0044368 | 3300053091 | Bacteria | 2134 |
| 403 | Ga0500651_0042612 | 3300053093 | Bacteria | 2860 |
| 404 | Ga0500566_0071474 | 3300053094 | Bacteria | 1947 |
| 405 | Ga0500569_069374 | 3300053109 | Bacteria | 1106 |
| 406 | Ga0500592_000232 | 3300053116 | Bacteria | 10092 |
| 407 | Ga0500592_000578 | 3300053116 | Bacteria | 6035 |
| 408 | Ga0500607_160345 | 3300053121 | Bacteria | 1029 |
| 409 | Ga0500618_011999 | 3300053125 | Bacteria | 2281 |
| 410 | Ga0500642_0018625 | 3300053130 | Bacteria | 2690 |
| 411 | Ga0500655_011842 | 3300053133 | Bacteria | 1583 |
| 412 | Ga0500658_0077662 | 3300053134 | Bacteria | 1414 |
| 413 | Ga0500658_0112069 | 3300053134 | Bacteria | 1202 |
| 414 | Ga0500559_0007211 | 3300053136 | Bacteria | 4944 |
| 415 | Ga0500568_0003694 | 3300053139 | Bacteria | 8399 |
| 416 | Ga0500568_0007935 | 3300053139 | Bacteria | 5159 |
| 417 | Ga0500577_0039468 | 3300053142 | Bacteria | 1711 |
| 418 | Ga0500588_0058586 | 3300053146 | Bacteria | 1226 |
| 419 | Ga0500590_005065 | 3300053148 | Bacteria | 6310 |
| 420 | Ga0500604_0000053 | 3300053151 | Bacteria | 41228 |
| 421 | Ga0500604_0014126 | 3300053151 | Bacteria | 2171 |
| 422 | Ga0500604_0269082 | 3300053151 | Bacteria | 590 |
| 423 | Ga0500616_0000411 | 3300053153 | Bacteria | 57962 |
| 424 | Ga0500622_0038995 | 3300053156 | Bacteria | 2477 |
| 425 | Ga0500627_0000757 | 3300053158 | Bacteria | 8582 |
| 426 | Ga0500627_0002521 | 3300053158 | Bacteria | 5454 |
| 427 | Ga0500627_0075720 | 3300053158 | Bacteria | 1496 |
| 428 | Ga0500627_0231290 | 3300053158 | Bacteria | 822 |
| 429 | Ga0500570_001921 | 3300053724 | Bacteria | 9977 |
| 430 | Ga0500645_028013 | 3300053730 | Bacteria | 1706 |
| 431 | Ga0500587_001709 | 3300053739 | Bacteria | 3119 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0443886 | Ga0436363_0443886_2579_3016 | 145 |
| 2 | 3300041486 | Ga0451807_0425266 | Ga0451807_0425266_323_763 | 145 |
| 3 | 3300041456 | Ga0451795_0780312 | Ga0451795_0780312_897_1346 | 149 |
| 4 | 3300049513 | Ga0501290_000086 | Ga0501290_000086_1851_2300 | 149 |
| 5 | 3300049524 | Ga0501301_005570 | Ga0501301_005570_380_829 | 149 |
| 6 | 3300049662 | Ga0501222_002076 | Ga0501222_002076_1898_2347 | 149 |
| 7 | 3300049663 | Ga0501223_008808 | Ga0501223_008808_1125_1574 | 149 |
| 8 | 3300049664 | Ga0501224_017889 | Ga0501224_017889_437_886 | 149 |
| 9 | 3300049669 | Ga0501235_052167 | Ga0501235_052167_152_601 | 149 |
| 10 | 3300049705 | Ga0501225_0009588 | Ga0501225_0009588_1828_2277 | 149 |
| 11 | 3300049776 | Ga0501280_000131 | Ga0501280_000131_1894_2343 | 149 |
| 12 | 3300049778 | Ga0501282_009683 | Ga0501282_009683_267_716 | 149 |
| 13 | 3300049686 | Ga0501257_071740 | Ga0501257_071740_148_627 | 159 |
| 14 | 3300005293 | Ga0065715_10916673 | Ga0065715_109166731 | 160 |
| 15 | 3300031456 | Ga0307513_10614222 | Ga0307513_106142221 | 161 |
| 16 | 3300032002 | Ga0307416_101789066 | Ga0307416_1017890661 | 161 |
| 17 | iso_pu_bacteria | 2643221541 | 2643730528 | 162 |
| 18 | iso_pu_bacteria | 2643221560 | 2643819760 | 162 |
| 19 | iso_pu_bacteria | 2643221605 | 2644037503 | 162 |
| 20 | iso_pu_bacteria | 2643221606 | 2644043697 | 162 |
| 21 | iso_pu_bacteria | 2643221671 | 2644393856 | 162 |
| 22 | iso_pu_bacteria | 2852653556 | 2852654387 | 162 |
| 23 | iso_pu_bacteria | 2582581305 | 2585260491 | 163 |
| 24 | 3300005843 | Ga0068860_100040511 | Ga0068860_1000405111 | 164 |
| 25 | iso_pu_bacteria | 2599185359 | 2600225829 | 164 |
| 26 | iso_pu_bacteria | 2818991466 | 2819716368 | 164 |
| 27 | iso_pu_bacteria | 2928526807 | 2928528825 | 164 |
| 28 | iso_pu_bacteria | 2928968154 | 2928970378 | 164 |
| 29 | iso_pu_bacteria | 2946787523 | 2946787628 | 164 |
| 30 | iso_pu_bacteria | 8057101203 | 8057101632 | 164 |
| 31 | 3300048928 | Ga0496125_0177437 | Ga0496125_0177437_762_1259 | 165 |
| 32 | 3300049569 | Ga0501032_0043876 | Ga0501032_0043876_1276_1773 | 165 |
| 33 | 3300049581 | Ga0501047_0000402 | Ga0501047_0000402_15959_16456 | 165 |
| 34 | 3300049582 | Ga0501048_0235742 | Ga0501048_0235742_386_883 | 165 |
| 35 | 3300049823 | Ga0501044_0128928 | Ga0501044_0128928_1562_2059 | 165 |
| 36 | 3300002076 | JGI24749J21850_1000094 | JGI24749J21850_10000946 | 166 |
| 37 | 3300002459 | JGI24751J29686_10000093 | JGI24751J29686_1000009327 | 166 |
| 38 | 3300002459 | JGI24751J29686_10021088 | JGI24751J29686_100210881 | 166 |
| 39 | 3300003781 | Ga0055536_1010070 | Ga0055536_10100704 | 166 |
| 40 | 3300003784 | Ga0055534_1019334 | Ga0055534_10193342 | 166 |
| 41 | 3300003791 | Ga0055530_10000083 | Ga0055530_1000008321 | 166 |
| 42 | 3300003791 | Ga0055530_10068130 | Ga0055530_100681301 | 166 |
| 43 | 3300003794 | Ga0055531_10000316 | Ga0055531_1000031640 | 166 |
| 44 | 3300003794 | Ga0055531_10001717 | Ga0055531_100017174 | 166 |
| 45 | 3300005295 | Ga0065707_10082467 | Ga0065707_1008246714 | 166 |
| 46 | 3300005327 | Ga0070658_10137441 | Ga0070658_101374412 | 166 |
| 47 | 3300005331 | Ga0070670_100000005 | Ga0070670_100000005110 | 166 |
| 48 | 3300005331 | Ga0070670_100000528 | Ga0070670_10000052819 | 166 |
| 49 | 3300005335 | Ga0070666_10035929 | Ga0070666_100359292 | 166 |
| 50 | 3300005347 | Ga0070668_100000007 | Ga0070668_100000007142 | 166 |
| 51 | 3300005353 | Ga0070669_100000195 | Ga0070669_10000019520 | 166 |
| 52 | 3300005353 | Ga0070669_100034494 | Ga0070669_1000344946 | 166 |
| 53 | 3300005355 | Ga0070671_100000388 | Ga0070671_10000038816 | 166 |
| 54 | 3300005356 | Ga0070674_100707454 | Ga0070674_1007074541 | 166 |
| 55 | 3300005364 | Ga0070673_101380978 | Ga0070673_1013809781 | 166 |
| 56 | 3300005366 | Ga0070659_100369057 | Ga0070659_1003690572 | 166 |
| 57 | 3300005367 | Ga0070667_100000003 | Ga0070667_100000003247 | 166 |
| 58 | 3300005367 | Ga0070667_100001850 | Ga0070667_1000018505 | 166 |
| 59 | 3300005457 | Ga0070662_100608194 | Ga0070662_1006081941 | 166 |
| 60 | 3300005457 | Ga0070662_101024679 | Ga0070662_1010246791 | 166 |
| 61 | 3300005458 | Ga0070681_10237857 | Ga0070681_102378572 | 166 |
| 62 | 3300005543 | Ga0070672_100229285 | Ga0070672_1002292852 | 166 |
| 63 | 3300005548 | Ga0070665_100004060 | Ga0070665_1000040606 | 166 |
| 64 | 3300005548 | Ga0070665_100657668 | Ga0070665_1006576682 | 166 |
| 65 | 3300005563 | Ga0068855_100004366 | Ga0068855_10000436616 | 166 |
| 66 | 3300005577 | Ga0068857_100134454 | Ga0068857_1001344542 | 166 |
| 67 | 3300005578 | Ga0068854_100029193 | Ga0068854_1000291933 | 166 |
| 68 | 3300005578 | Ga0068854_100322165 | Ga0068854_1003221652 | 166 |
| 69 | 3300005614 | Ga0068856_100058625 | Ga0068856_1000586253 | 166 |
| 70 | 3300005617 | Ga0068859_100008939 | Ga0068859_1000089397 | 166 |
| 71 | 3300005617 | Ga0068859_100012820 | Ga0068859_1000128207 | 166 |
| 72 | 3300005618 | Ga0068864_100000011 | Ga0068864_100000011109 | 166 |
| 73 | 3300005719 | Ga0068861_100220277 | Ga0068861_1002202772 | 166 |
| 74 | 3300005841 | Ga0068863_100003398 | Ga0068863_1000033988 | 166 |
| 75 | 3300005841 | Ga0068863_100017965 | Ga0068863_10001796510 | 166 |
| 76 | 3300005842 | Ga0068858_100001881 | Ga0068858_10000188118 | 166 |
| 77 | 3300005843 | Ga0068860_100000045 | Ga0068860_10000004516 | 166 |
| 78 | 3300005844 | Ga0068862_100000011 | Ga0068862_100000011127 | 166 |
| 79 | 3300005844 | Ga0068862_100000989 | Ga0068862_10000098915 | 166 |
| 80 | 3300006931 | Ga0097620_100008939 | Ga0097620_1000089395 | 166 |
| 81 | 3300006931 | Ga0097620_100012820 | Ga0097620_1000128207 | 166 |
| 82 | 3300009093 | Ga0105240_10009282 | Ga0105240_100092827 | 166 |
| 83 | 3300009094 | Ga0111539_10382741 | Ga0111539_103827412 | 166 |
| 84 | 3300009174 | Ga0105241_10230273 | Ga0105241_102302733 | 166 |
| 85 | 3300009177 | Ga0105248_10000069 | Ga0105248_1000006981 | 166 |
| 86 | 3300009545 | Ga0105237_10599018 | Ga0105237_105990182 | 166 |
| 87 | 3300009551 | Ga0105238_10072055 | Ga0105238_100720552 | 166 |
| 88 | 3300009551 | Ga0105238_11100422 | Ga0105238_111004222 | 166 |
| 89 | 3300009553 | Ga0105249_10369014 | Ga0105249_103690142 | 166 |
| 90 | 3300009553 | Ga0105249_10810158 | Ga0105249_108101582 | 166 |
| 91 | 3300010375 | Ga0105239_10509252 | Ga0105239_105092522 | 166 |
| 92 | 3300010375 | Ga0105239_10852509 | Ga0105239_108525091 | 166 |
| 93 | 3300012513 | Ga0157326_1000303 | Ga0157326_10003034 | 166 |
| 94 | 3300013104 | Ga0157370_11603128 | Ga0157370_116031281 | 166 |
| 95 | 3300013296 | Ga0157374_10365013 | Ga0157374_103650132 | 166 |
| 96 | 3300014326 | Ga0157380_10000363 | Ga0157380_1000036313 | 166 |
| 97 | 3300021384 | Ga0213876_10432585 | Ga0213876_104325852 | 166 |
| 98 | 3300021388 | Ga0213875_10001461 | Ga0213875_100014617 | 166 |
| 99 | 3300025291 | Ga0209675_1000190 | Ga0209675_100019074 | 166 |
| 100 | 3300025292 | Ga0209676_1000081 | Ga0209676_1000081142 | 166 |
| 101 | 3300025292 | Ga0209676_1000133 | Ga0209676_100013358 | 166 |
| 102 | 3300025292 | Ga0209676_1000769 | Ga0209676_10007696 | 166 |
| 103 | 3300025294 | Ga0209025_1015501 | Ga0209025_10155012 | 166 |
| 104 | 3300025298 | Ga0209050_1000067 | Ga0209050_100006752 | 166 |
| 105 | 3300025298 | Ga0209050_1001738 | Ga0209050_10017386 | 166 |
| 106 | 3300025298 | Ga0209050_1011629 | Ga0209050_10116295 | 166 |
| 107 | 3300025304 | Ga0209257_1000132 | Ga0209257_1000132129 | 166 |
| 108 | 3300025304 | Ga0209257_1000206 | Ga0209257_100020659 | 166 |
| 109 | 3300025903 | Ga0207680_10019012 | Ga0207680_100190122 | 166 |
| 110 | 3300025912 | Ga0207707_10405559 | Ga0207707_104055592 | 166 |
| 111 | 3300025913 | Ga0207695_10007597 | Ga0207695_100075977 | 166 |
| 112 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001550 | 166 |
| 113 | 3300025923 | Ga0207681_10069244 | Ga0207681_100692443 | 166 |
| 114 | 3300025923 | Ga0207681_10122918 | Ga0207681_101229182 | 166 |
| 115 | 3300025924 | Ga0207694_10014424 | Ga0207694_100144247 | 166 |
| 116 | 3300025925 | Ga0207650_10000018 | Ga0207650_10000018110 | 166 |
| 117 | 3300025925 | Ga0207650_10004568 | Ga0207650_100045682 | 166 |
| 118 | 3300025931 | Ga0207644_10000197 | Ga0207644_1000019728 | 166 |
| 119 | 3300025933 | Ga0207706_11060792 | Ga0207706_110607921 | 166 |
| 120 | 3300025940 | Ga0207691_10093950 | Ga0207691_100939504 | 166 |
| 121 | 3300025941 | Ga0207711_10001064 | Ga0207711_100010645 | 166 |
| 122 | 3300025949 | Ga0207667_10000651 | Ga0207667_1000065128 | 166 |
| 123 | 3300025960 | Ga0207651_10367660 | Ga0207651_103676601 | 166 |
| 124 | 3300025961 | Ga0207712_10213795 | Ga0207712_102137951 | 166 |
| 125 | 3300025961 | Ga0207712_10611587 | Ga0207712_106115872 | 166 |
| 126 | 3300025972 | Ga0207668_10000026 | Ga0207668_10000026108 | 166 |
| 127 | 3300025981 | Ga0207640_10011938 | Ga0207640_100119384 | 166 |
| 128 | 3300025981 | Ga0207640_10182577 | Ga0207640_101825772 | 166 |
| 129 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000021148 | 166 |
| 130 | 3300025986 | Ga0207658_10000902 | Ga0207658_1000090219 | 166 |
| 131 | 3300026035 | Ga0207703_10000404 | Ga0207703_1000040416 | 166 |
| 132 | 3300026035 | Ga0207703_11504355 | Ga0207703_115043551 | 166 |
| 133 | 3300026041 | Ga0207639_10016543 | Ga0207639_100165436 | 166 |
| 134 | 3300026078 | Ga0207702_10076647 | Ga0207702_100766474 | 166 |
| 135 | 3300026088 | Ga0207641_10004973 | Ga0207641_1000497310 | 166 |
| 136 | 3300026088 | Ga0207641_10006503 | Ga0207641_100065033 | 166 |
| 137 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004503 | 166 |
| 138 | 3300026116 | Ga0207674_10143991 | Ga0207674_101439912 | 166 |
| 139 | 3300026116 | Ga0207674_10249348 | Ga0207674_102493482 | 166 |
| 140 | 3300026118 | Ga0207675_100004115 | Ga0207675_1000041152 | 166 |
| 141 | 3300026118 | Ga0207675_100132806 | Ga0207675_1001328062 | 166 |
| 142 | 3300026142 | Ga0207698_10524414 | Ga0207698_105244142 | 166 |
| 143 | 3300028379 | Ga0268266_10001270 | Ga0268266_1000127027 | 166 |
| 144 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002567 | 166 |
| 145 | 3300028380 | Ga0268265_10001985 | Ga0268265_100019856 | 166 |
| 146 | 3300028381 | Ga0268264_10000101 | Ga0268264_1000010118 | 166 |
| 147 | 3300028381 | Ga0268264_10754516 | Ga0268264_107545162 | 166 |
| 148 | 3300028786 | Ga0307517_10511383 | Ga0307517_105113831 | 166 |
| 149 | 3300031548 | Ga0307408_101781625 | Ga0307408_1017816251 | 166 |
| 150 | 3300031731 | Ga0307405_10057984 | Ga0307405_100579843 | 166 |
| 151 | 3300031731 | Ga0307405_10068751 | Ga0307405_100687514 | 166 |
| 152 | 3300031731 | Ga0307405_10458954 | Ga0307405_104589541 | 166 |
| 153 | 3300031852 | Ga0307410_10274723 | Ga0307410_102747232 | 166 |
| 154 | 3300031911 | Ga0307412_10014384 | Ga0307412_100143847 | 166 |
| 155 | 3300031911 | Ga0307412_10022690 | Ga0307412_100226903 | 166 |
| 156 | 3300031911 | Ga0307412_10036493 | Ga0307412_100364935 | 166 |
| 157 | 3300031911 | Ga0307412_10162631 | Ga0307412_101626312 | 166 |
| 158 | 3300032002 | Ga0307416_100570300 | Ga0307416_1005703001 | 166 |
| 159 | 3300032004 | Ga0307414_10012210 | Ga0307414_100122106 | 166 |
| 160 | 3300032004 | Ga0307414_10189099 | Ga0307414_101890992 | 166 |
| 161 | 3300032004 | Ga0307414_10942952 | Ga0307414_109429522 | 166 |
| 162 | 3300032005 | Ga0307411_10118034 | Ga0307411_101180342 | 166 |
| 163 | 3300037853 | Ga0436364_0852694 | Ga0436364_0852694_10802_11314 | 166 |
| 164 | 3300039437 | Ga0436365_1329751 | Ga0436365_1329751_134_646 | 166 |
| 165 | 3300041512 | Ga0451853_2694079 | Ga0451853_2694079_47_550 | 166 |
| 166 | 3300046519 | Ga0495632_0134120 | Ga0495632_0134120_61_576 | 166 |
| 167 | 3300046616 | Ga0495668_0000076 | Ga0495668_0000076_73131_73637 | 166 |
| 168 | 3300046660 | Ga0495625_0000520 | Ga0495625_0000520_18382_18888 | 166 |
| 169 | 3300048928 | Ga0496125_0242506 | Ga0496125_0242506_182_688 | 166 |
| 170 | 3300049568 | Ga0501031_0036268 | Ga0501031_0036268_2522_3028 | 166 |
| 171 | 3300049569 | Ga0501032_0016683 | Ga0501032_0016683_2638_3144 | 166 |
| 172 | 3300049570 | Ga0501033_0321697 | Ga0501033_0321697_355_861 | 166 |
| 173 | 3300049571 | Ga0501034_0035875 | Ga0501034_0035875_3560_4066 | 166 |
| 174 | 3300049571 | Ga0501034_0530466 | Ga0501034_0530466_425_928 | 166 |
| 175 | 3300049572 | Ga0501036_0104308 | Ga0501036_0104308_165_671 | 166 |
| 176 | 3300049573 | Ga0501037_0053881 | Ga0501037_0053881_1475_1981 | 166 |
| 177 | 3300049574 | Ga0501038_0021428 | Ga0501038_0021428_2077_2583 | 166 |
| 178 | 3300049575 | Ga0501039_0029745 | Ga0501039_0029745_1463_1969 | 166 |
| 179 | 3300049576 | Ga0501040_0782656 | Ga0501040_0782656_36_542 | 166 |
| 180 | 3300049579 | Ga0501043_0368799 | Ga0501043_0368799_475_981 | 166 |
| 181 | 3300049580 | Ga0501046_0148635 | Ga0501046_0148635_730_1236 | 166 |
| 182 | 3300049581 | Ga0501047_0131015 | Ga0501047_0131015_314_820 | 166 |
| 183 | 3300049589 | Ga0501073_0400842 | Ga0501073_0400842_362_862 | 166 |
| 184 | 3300049679 | Ga0501249_000545 | Ga0501249_000545_6740_7240 | 166 |
| 185 | 3300049822 | Ga0501035_0045752 | Ga0501035_0045752_172_678 | 166 |
| 186 | 3300049823 | Ga0501044_0015438 | Ga0501044_0015438_5284_5790 | 166 |
| 187 | 3300049824 | Ga0501045_0241061 | Ga0501045_0241061_396_902 | 166 |
| 188 | 3300049850 | Ga0501204_008578 | Ga0501204_008578_152_652 | 166 |
| 189 | 3300053090 | Ga0500646_0028382 | Ga0500646_0028382_802_1323 | 166 |
| 190 | 3300053116 | Ga0500592_000232 | Ga0500592_000232_9422_9922 | 166 |
| 191 | 3300053134 | Ga0500658_0077662 | Ga0500658_0077662_47_562 | 166 |
| 192 | 3300053134 | Ga0500658_0112069 | Ga0500658_0112069_335_835 | 166 |
| 193 | 3300053139 | Ga0500568_0003694 | Ga0500568_0003694_2146_2652 | 166 |
| 194 | 3300053139 | Ga0500568_0007935 | Ga0500568_0007935_1077_1598 | 166 |
| 195 | 3300053151 | Ga0500604_0000053 | Ga0500604_0000053_40450_40971 | 166 |
| 196 | 3300053153 | Ga0500616_0000411 | Ga0500616_0000411_37859_38380 | 166 |
| 197 | 3300053158 | Ga0500627_0000757 | Ga0500627_0000757_3243_3743 | 166 |
| 198 | 3300053158 | Ga0500627_0231290 | Ga0500627_0231290_301_801 | 166 |
| 199 | 3300053739 | Ga0500587_001709 | Ga0500587_001709_181_696 | 166 |
| 200 | 2162886007 | SwRhRL2b_contig_1505805 | SwRhRL2b_0491.00008690 | 167 |
| 201 | 2162886007 | SwRhRL2b_contig_3439718 | SwRhRL2b_0553.00000730 | 167 |
| 202 | 3300001915 | JGI24741J21665_1013465 | JGI24741J21665_10134652 | 167 |
| 203 | 3300001976 | JGI24752J21851_1003188 | JGI24752J21851_10031883 | 167 |
| 204 | 3300001979 | JGI24740J21852_10002064 | JGI24740J21852_100020642 | 167 |
| 205 | 3300001979 | JGI24740J21852_10034057 | JGI24740J21852_100340572 | 167 |
| 206 | 3300001989 | JGI24739J22299_10001692 | JGI24739J22299_100016929 | 167 |
| 207 | 3300001990 | JGI24737J22298_10024726 | JGI24737J22298_100247263 | 167 |
| 208 | 3300002067 | JGI24735J21928_10005665 | JGI24735J21928_100056654 | 167 |
| 209 | 3300002074 | JGI24748J21848_1000029 | JGI24748J21848_100002967 | 167 |
| 210 | 3300002075 | JGI24738J21930_10000138 | JGI24738J21930_100001388 | 167 |
| 211 | 3300002075 | JGI24738J21930_10003295 | JGI24738J21930_100032953 | 167 |
| 212 | 3300002076 | JGI24749J21850_1001913 | JGI24749J21850_10019132 | 167 |
| 213 | 3300002239 | JGI24034J26672_10000006 | JGI24034J26672_10000006214 | 167 |
| 214 | 3300002244 | JGI24742J22300_10002513 | JGI24742J22300_100025134 | 167 |
| 215 | 3300002459 | JGI24751J29686_10008583 | JGI24751J29686_100085832 | 167 |
| 216 | 3300005289 | Ga0065704_10078399 | Ga0065704_100783993 | 167 |
| 217 | 3300005289 | Ga0065704_10202209 | Ga0065704_102022092 | 167 |
| 218 | 3300005295 | Ga0065707_10082105 | Ga0065707_1008210524 | 167 |
| 219 | 3300005295 | Ga0065707_10141585 | Ga0065707_101415852 | 167 |
| 220 | 3300005295 | Ga0065707_10484423 | Ga0065707_104844232 | 167 |
| 221 | 3300005327 | Ga0070658_10160617 | Ga0070658_101606172 | 167 |
| 222 | 3300005330 | Ga0070690_100000002 | Ga0070690_100000002138 | 167 |
| 223 | 3300005331 | Ga0070670_100000169 | Ga0070670_10000016942 | 167 |
| 224 | 3300005331 | Ga0070670_100073948 | Ga0070670_1000739483 | 167 |
| 225 | 3300005335 | Ga0070666_10000002 | Ga0070666_10000002500 | 167 |
| 226 | 3300005340 | Ga0070689_100007860 | Ga0070689_1000078604 | 167 |
| 227 | 3300005347 | Ga0070668_100324389 | Ga0070668_1003243892 | 167 |
| 228 | 3300005347 | Ga0070668_100609554 | Ga0070668_1006095541 | 167 |
| 229 | 3300005353 | Ga0070669_100000440 | Ga0070669_10000044025 | 167 |
| 230 | 3300005355 | Ga0070671_100027243 | Ga0070671_1000272433 | 167 |
| 231 | 3300005365 | Ga0070688_100011582 | Ga0070688_1000115822 | 167 |
| 232 | 3300005366 | Ga0070659_100042467 | Ga0070659_1000424673 | 167 |
| 233 | 3300005367 | Ga0070667_100000327 | Ga0070667_10000032738 | 167 |
| 234 | 3300005367 | Ga0070667_100008584 | Ga0070667_1000085845 | 167 |
| 235 | 3300005455 | Ga0070663_100185239 | Ga0070663_1001852392 | 167 |
| 236 | 3300005457 | Ga0070662_100006250 | Ga0070662_1000062507 | 167 |
| 237 | 3300005457 | Ga0070662_100060346 | Ga0070662_1000603462 | 167 |
| 238 | 3300005466 | Ga0070685_10000056 | Ga0070685_1000005648 | 167 |
| 239 | 3300005530 | Ga0070679_100354019 | Ga0070679_1003540192 | 167 |
| 240 | 3300005535 | Ga0070684_100693090 | Ga0070684_1006930902 | 167 |
| 241 | 3300005539 | Ga0068853_100096736 | Ga0068853_1000967361 | 167 |
| 242 | 3300005544 | Ga0070686_100000002 | Ga0070686_100000002119 | 167 |
| 243 | 3300005547 | Ga0070693_100829250 | Ga0070693_1008292502 | 167 |
| 244 | 3300005548 | Ga0070665_100000025 | Ga0070665_100000025217 | 167 |
| 245 | 3300005577 | Ga0068857_100015964 | Ga0068857_1000159644 | 167 |
| 246 | 3300005577 | Ga0068857_100166790 | Ga0068857_1001667902 | 167 |
| 247 | 3300005578 | Ga0068854_100036277 | Ga0068854_1000362771 | 167 |
| 248 | 3300005616 | Ga0068852_100215479 | Ga0068852_1002154792 | 167 |
| 249 | 3300005617 | Ga0068859_100012055 | Ga0068859_1000120557 | 167 |
| 250 | 3300005617 | Ga0068859_100025890 | Ga0068859_1000258905 | 167 |
| 251 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004428 | 167 |
| 252 | 3300005618 | Ga0068864_100004976 | Ga0068864_1000049767 | 167 |
| 253 | 3300005834 | Ga0068851_10027890 | Ga0068851_100278903 | 167 |
| 254 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002429 | 167 |
| 255 | 3300005841 | Ga0068863_100000070 | Ga0068863_10000007058 | 167 |
| 256 | 3300005842 | Ga0068858_100002924 | Ga0068858_10000292412 | 167 |
| 257 | 3300005843 | Ga0068860_100000001 | Ga0068860_100000001507 | 167 |
| 258 | 3300005844 | Ga0068862_100000002 | Ga0068862_10000000273 | 167 |
| 259 | 3300005844 | Ga0068862_100000020 | Ga0068862_100000020198 | 167 |
| 260 | 3300005983 | Ga0081540_1056312 | Ga0081540_10563123 | 167 |
| 261 | 3300006931 | Ga0097620_100012054 | Ga0097620_1000120547 | 167 |
| 262 | 3300006931 | Ga0097620_100025890 | Ga0097620_1000258905 | 167 |
| 263 | 3300009011 | Ga0105251_10000342 | Ga0105251_1000034241 | 167 |
| 264 | 3300009092 | Ga0105250_10260431 | Ga0105250_102604311 | 167 |
| 265 | 3300009101 | Ga0105247_10017026 | Ga0105247_100170264 | 167 |
| 266 | 3300009101 | Ga0105247_10041415 | Ga0105247_100414154 | 167 |
| 267 | 3300009177 | Ga0105248_10000016 | Ga0105248_10000016169 | 167 |
| 268 | 3300009177 | Ga0105248_10065895 | Ga0105248_100658955 | 167 |
| 269 | 3300009177 | Ga0105248_10509668 | Ga0105248_105096682 | 167 |
| 270 | 3300009545 | Ga0105237_10224635 | Ga0105237_102246352 | 167 |
| 271 | 3300009545 | Ga0105237_10586709 | Ga0105237_105867092 | 167 |
| 272 | 3300009551 | Ga0105238_10051291 | Ga0105238_100512915 | 167 |
| 273 | 3300009553 | Ga0105249_10000005 | Ga0105249_10000005234 | 167 |
| 274 | 3300009553 | Ga0105249_10000106 | Ga0105249_1000010648 | 167 |
| 275 | 3300010375 | Ga0105239_10446539 | Ga0105239_104465392 | 167 |
| 276 | 3300013100 | Ga0157373_10152970 | Ga0157373_101529702 | 167 |
| 277 | 3300013104 | Ga0157370_10025774 | Ga0157370_100257744 | 167 |
| 278 | 3300013104 | Ga0157370_11667324 | Ga0157370_116673241 | 167 |
| 279 | 3300013105 | Ga0157369_10133762 | Ga0157369_101337624 | 167 |
| 280 | 3300013297 | Ga0157378_10156954 | Ga0157378_101569543 | 167 |
| 281 | 3300013306 | Ga0163162_10060819 | Ga0163162_100608193 | 167 |
| 282 | 3300013306 | Ga0163162_10503157 | Ga0163162_105031572 | 167 |
| 283 | 3300013307 | Ga0157372_10138783 | Ga0157372_101387834 | 167 |
| 284 | 3300013307 | Ga0157372_10509317 | Ga0157372_105093172 | 167 |
| 285 | 3300014325 | Ga0163163_10101070 | Ga0163163_101010704 | 167 |
| 286 | 3300014326 | Ga0157380_10000304 | Ga0157380_1000030424 | 167 |
| 287 | 3300014326 | Ga0157380_10183104 | Ga0157380_101831042 | 167 |
| 288 | 3300014968 | Ga0157379_10007070 | Ga0157379_100070707 | 167 |
| 289 | 3300014968 | Ga0157379_10027796 | Ga0157379_100277963 | 167 |
| 290 | 3300017792 | Ga0163161_10000115 | Ga0163161_1000011566 | 167 |
| 291 | 3300025321 | Ga0207656_10002142 | Ga0207656_100021422 | 167 |
| 292 | 3300025711 | Ga0207696_1167430 | Ga0207696_11674301 | 167 |
| 293 | 3300025735 | Ga0207713_1003473 | Ga0207713_10034736 | 167 |
| 294 | 3300025900 | Ga0207710_10018928 | Ga0207710_100189284 | 167 |
| 295 | 3300025900 | Ga0207710_10065620 | Ga0207710_100656202 | 167 |
| 296 | 3300025903 | Ga0207680_10000004 | Ga0207680_10000004361 | 167 |
| 297 | 3300025904 | Ga0207647_10000069 | Ga0207647_1000006968 | 167 |
| 298 | 3300025909 | Ga0207705_10225117 | Ga0207705_102251172 | 167 |
| 299 | 3300025911 | Ga0207654_10006741 | Ga0207654_100067415 | 167 |
| 300 | 3300025913 | Ga0207695_10009337 | Ga0207695_100093374 | 167 |
| 301 | 3300025914 | Ga0207671_10001601 | Ga0207671_100016014 | 167 |
| 302 | 3300025919 | Ga0207657_10029090 | Ga0207657_100290902 | 167 |
| 303 | 3300025921 | Ga0207652_11444563 | Ga0207652_114445631 | 167 |
| 304 | 3300025923 | Ga0207681_10000130 | Ga0207681_1000013039 | 167 |
| 305 | 3300025924 | Ga0207694_10013118 | Ga0207694_100131184 | 167 |
| 306 | 3300025924 | Ga0207694_10049465 | Ga0207694_100494654 | 167 |
| 307 | 3300025925 | Ga0207650_10000294 | Ga0207650_1000029421 | 167 |
| 308 | 3300025925 | Ga0207650_10008589 | Ga0207650_100085896 | 167 |
| 309 | 3300025931 | Ga0207644_10056031 | Ga0207644_100560312 | 167 |
| 310 | 3300025933 | Ga0207706_10011916 | Ga0207706_100119165 | 167 |
| 311 | 3300025933 | Ga0207706_10192545 | Ga0207706_101925452 | 167 |
| 312 | 3300025936 | Ga0207670_10010788 | Ga0207670_100107884 | 167 |
| 313 | 3300025941 | Ga0207711_10000022 | Ga0207711_10000022168 | 167 |
| 314 | 3300025941 | Ga0207711_10010013 | Ga0207711_100100135 | 167 |
| 315 | 3300025941 | Ga0207711_10416240 | Ga0207711_104162402 | 167 |
| 316 | 3300025945 | Ga0207679_10238592 | Ga0207679_102385922 | 167 |
| 317 | 3300025949 | Ga0207667_10005163 | Ga0207667_1000516316 | 167 |
| 318 | 3300025961 | Ga0207712_10000001 | Ga0207712_10000001235 | 167 |
| 319 | 3300025961 | Ga0207712_10000224 | Ga0207712_1000022438 | 167 |
| 320 | 3300025972 | Ga0207668_10309219 | Ga0207668_103092191 | 167 |
| 321 | 3300025972 | Ga0207668_10557372 | Ga0207668_105573722 | 167 |
| 322 | 3300025981 | Ga0207640_10008627 | Ga0207640_100086275 | 167 |
| 323 | 3300025981 | Ga0207640_10045658 | Ga0207640_100456581 | 167 |
| 324 | 3300025986 | Ga0207658_10000364 | Ga0207658_1000036438 | 167 |
| 325 | 3300025986 | Ga0207658_10002462 | Ga0207658_100024626 | 167 |
| 326 | 3300026035 | Ga0207703_10002475 | Ga0207703_1000247515 | 167 |
| 327 | 3300026041 | Ga0207639_10131249 | Ga0207639_101312492 | 167 |
| 328 | 3300026041 | Ga0207639_10469477 | Ga0207639_104694772 | 167 |
| 329 | 3300026067 | Ga0207678_10187042 | Ga0207678_101870422 | 167 |
| 330 | 3300026078 | Ga0207702_10003987 | Ga0207702_100039874 | 167 |
| 331 | 3300026078 | Ga0207702_10003988 | Ga0207702_100039884 | 167 |
| 332 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002908 | 167 |
| 333 | 3300026088 | Ga0207641_10000033 | Ga0207641_10000033167 | 167 |
| 334 | 3300026095 | Ga0207676_10000040 | Ga0207676_10000040103 | 167 |
| 335 | 3300026095 | Ga0207676_10000546 | Ga0207676_1000054615 | 167 |
| 336 | 3300026116 | Ga0207674_10012150 | Ga0207674_100121507 | 167 |
| 337 | 3300026116 | Ga0207674_10142596 | Ga0207674_101425962 | 167 |
| 338 | 3300026116 | Ga0207674_10279210 | Ga0207674_102792102 | 167 |
| 339 | 3300026118 | Ga0207675_100003280 | Ga0207675_10000328018 | 167 |
| 340 | 3300026142 | Ga0207698_10026565 | Ga0207698_100265652 | 167 |
| 341 | 3300026142 | Ga0207698_10101825 | Ga0207698_101018252 | 167 |
| 342 | 3300028379 | Ga0268266_10000028 | Ga0268266_10000028170 | 167 |
| 343 | 3300028380 | Ga0268265_10000003 | Ga0268265_1000000382 | 167 |
| 344 | 3300028380 | Ga0268265_10000071 | Ga0268265_1000007118 | 167 |
| 345 | 3300028381 | Ga0268264_10000006 | Ga0268264_10000006361 | 167 |
| 346 | 3300031548 | Ga0307408_100253979 | Ga0307408_1002539792 | 167 |
| 347 | 3300031731 | Ga0307405_10071128 | Ga0307405_100711283 | 167 |
| 348 | 3300031901 | Ga0307406_10103171 | Ga0307406_101031712 | 167 |
| 349 | 3300031911 | Ga0307412_10000165 | Ga0307412_1000016523 | 167 |
| 350 | 3300031911 | Ga0307412_10000329 | Ga0307412_1000032925 | 167 |
| 351 | 3300032004 | Ga0307414_10000177 | Ga0307414_1000017725 | 167 |
| 352 | 3300033180 | Ga0307510_10151301 | Ga0307510_101513012 | 167 |
| 353 | 3300038705 | Ga0237819_01727 | Ga0237819_01727_1525_2031 | 167 |
| 354 | 3300041452 | Ga0451793_0683499 | Ga0451793_0683499_661_1164 | 167 |
| 355 | 3300041460 | Ga0451802_0177882 | Ga0451802_0177882_223_732 | 167 |
| 356 | 3300041463 | Ga0451804_0547077 | Ga0451804_0547077_443_949 | 167 |
| 357 | 3300041486 | Ga0451807_2507748 | Ga0451807_2507748_203_709 | 167 |
| 358 | 3300046492 | Ga0495585_0199770 | Ga0495585_0199770_315_818 | 167 |
| 359 | 3300046501 | Ga0495607_0041186 | Ga0495607_0041186_712_1215 | 167 |
| 360 | 3300046513 | Ga0495616_0101965 | Ga0495616_0101965_208_711 | 167 |
| 361 | 3300046525 | Ga0495663_0004262 | Ga0495663_0004262_1925_2428 | 167 |
| 362 | 3300046525 | Ga0495663_0024293 | Ga0495663_0024293_985_1488 | 167 |
| 363 | 3300046530 | Ga0495654_0000736 | Ga0495654_0000736_9263_9766 | 167 |
| 364 | 3300046542 | Ga0495597_0012717 | Ga0495597_0012717_3505_4008 | 167 |
| 365 | 3300046616 | Ga0495668_0001456 | Ga0495668_0001456_21023_21526 | 167 |
| 366 | 3300046616 | Ga0495668_0018394 | Ga0495668_0018394_790_1293 | 167 |
| 367 | 3300046794 | Ga0495589_0032112 | Ga0495589_0032112_1174_1677 | 167 |
| 368 | 3300047447 | Ga0495685_109341 | Ga0495685_109341_138_641 | 167 |
| 369 | 3300047472 | Ga0495686_0005031 | Ga0495686_0005031_4699_5205 | 167 |
| 370 | 3300048904 | Ga0496101_0080171 | Ga0496101_0080171_1108_1611 | 167 |
| 371 | 3300048904 | Ga0496101_0295850 | Ga0496101_0295850_16_519 | 167 |
| 372 | 3300048905 | Ga0496102_0003647 | Ga0496102_0003647_1242_1745 | 167 |
| 373 | 3300048905 | Ga0496102_0190213 | Ga0496102_0190213_1173_1676 | 167 |
| 374 | 3300048906 | Ga0496103_0000840 | Ga0496103_0000840_14006_14509 | 167 |
| 375 | 3300048906 | Ga0496103_0007333 | Ga0496103_0007333_1154_1657 | 167 |
| 376 | 3300048907 | Ga0496104_0591090 | Ga0496104_0591090_127_630 | 167 |
| 377 | 3300048908 | Ga0496105_0178867 | Ga0496105_0178867_754_1257 | 167 |
| 378 | 3300048909 | Ga0496106_0050458 | Ga0496106_0050458_2205_2708 | 167 |
| 379 | 3300048910 | Ga0496107_0670902 | Ga0496107_0670902_142_645 | 167 |
| 380 | 3300048911 | Ga0496108_0308095 | Ga0496108_0308095_815_1318 | 167 |
| 381 | 3300048914 | Ga0496111_0348596 | Ga0496111_0348596_14_517 | 167 |
| 382 | 3300048919 | Ga0496116_0062100 | Ga0496116_0062100_362_865 | 167 |
| 383 | 3300048920 | Ga0496117_0037195 | Ga0496117_0037195_1905_2408 | 167 |
| 384 | 3300048921 | Ga0496118_0004860 | Ga0496118_0004860_7243_7746 | 167 |
| 385 | 3300048923 | Ga0496120_0015001 | Ga0496120_0015001_365_874 | 167 |
| 386 | 3300048924 | Ga0496121_0122657 | Ga0496121_0122657_108_611 | 167 |
| 387 | 3300048924 | Ga0496121_0182983 | Ga0496121_0182983_786_1289 | 167 |
| 388 | 3300048925 | Ga0496122_0343163 | Ga0496122_0343163_99_608 | 167 |
| 389 | 3300048926 | Ga0496123_0101512 | Ga0496123_0101512_257_766 | 167 |
| 390 | 3300048927 | Ga0496124_0002002 | Ga0496124_0002002_16618_17127 | 167 |
| 391 | 3300048927 | Ga0496124_0007069 | Ga0496124_0007069_1163_1672 | 167 |
| 392 | 3300048927 | Ga0496124_0131155 | Ga0496124_0131155_1044_1547 | 167 |
| 393 | 3300048927 | Ga0496124_0238959 | Ga0496124_0238959_177_686 | 167 |
| 394 | 3300048928 | Ga0496125_0311330 | Ga0496125_0311330_272_781 | 167 |
| 395 | 3300048929 | Ga0496126_0096034 | Ga0496126_0096034_761_1270 | 167 |
| 396 | 3300049459 | Ga0495678_068031 | Ga0495678_068031_735_1238 | 167 |
| 397 | 3300049513 | Ga0501290_017867 | Ga0501290_017867_380_883 | 167 |
| 398 | 3300049515 | Ga0501292_000019 | Ga0501292_000019_53355_53858 | 167 |
| 399 | 3300049517 | Ga0501294_000190 | Ga0501294_000190_1775_2278 | 167 |
| 400 | 3300049523 | Ga0501300_000128 | Ga0501300_000128_157_660 | 167 |
| 401 | 3300049652 | Ga0501202_014388 | Ga0501202_014388_194_697 | 167 |
| 402 | 3300049653 | Ga0501206_002061 | Ga0501206_002061_1620_2123 | 167 |
| 403 | 3300049662 | Ga0501222_000809 | Ga0501222_000809_451_954 | 167 |
| 404 | 3300049663 | Ga0501223_022810 | Ga0501223_022810_246_749 | 167 |
| 405 | 3300049664 | Ga0501224_003397 | Ga0501224_003397_1341_1844 | 167 |
| 406 | 3300049665 | Ga0501227_004681 | Ga0501227_004681_230_733 | 167 |
| 407 | 3300049668 | Ga0501233_028842 | Ga0501233_028842_516_1019 | 167 |
| 408 | 3300049669 | Ga0501235_000351 | Ga0501235_000351_6490_6993 | 167 |
| 409 | 3300049670 | Ga0501236_002609 | Ga0501236_002609_437_940 | 167 |
| 410 | 3300049688 | Ga0501259_004339 | Ga0501259_004339_1313_1816 | 167 |
| 411 | 3300049690 | Ga0501261_000061 | Ga0501261_000061_1800_2303 | 167 |
| 412 | 3300049704 | Ga0501221_093313 | Ga0501221_093313_158_661 | 167 |
| 413 | 3300049705 | Ga0501225_0002229 | Ga0501225_0002229_5291_5794 | 167 |
| 414 | 3300049708 | Ga0501245_005097 | Ga0501245_005097_644_1147 | 167 |
| 415 | 3300049775 | Ga0501279_000008 | Ga0501279_000008_74851_75354 | 167 |
| 416 | 3300049776 | Ga0501280_007674 | Ga0501280_007674_580_1083 | 167 |
| 417 | 3300049777 | Ga0501281_00097 | Ga0501281_00097_1827_2330 | 167 |
| 418 | 3300049778 | Ga0501282_002885 | Ga0501282_002885_267_770 | 167 |
| 419 | 3300049779 | Ga0501283_005982 | Ga0501283_005982_642_1145 | 167 |
| 420 | 3300050005 | Ga0501284_10670 | Ga0501284_10670_25_552 | 167 |
| 421 | 3300053087 | Ga0500643_000338 | Ga0500643_000338_8918_9421 | 167 |
| 422 | 3300053087 | Ga0500643_000351 | Ga0500643_000351_17156_17680 | 167 |
| 423 | 3300053087 | Ga0500643_001549 | Ga0500643_001549_3058_3564 | 167 |
| 424 | 3300053087 | Ga0500643_028605 | Ga0500643_028605_339_842 | 167 |
| 425 | 3300053091 | Ga0500647_0044368 | Ga0500647_0044368_718_1221 | 167 |
| 426 | 3300053093 | Ga0500651_0042612 | Ga0500651_0042612_139_642 | 167 |
| 427 | 3300053094 | Ga0500566_0071474 | Ga0500566_0071474_1061_1564 | 167 |
| 428 | 3300053109 | Ga0500569_069374 | Ga0500569_069374_549_1052 | 167 |
| 429 | 3300053116 | Ga0500592_000578 | Ga0500592_000578_2962_3465 | 167 |
| 430 | 3300053121 | Ga0500607_160345 | Ga0500607_160345_422_931 | 167 |
| 431 | 3300053125 | Ga0500618_011999 | Ga0500618_011999_1567_2070 | 167 |
| 432 | 3300053130 | Ga0500642_0018625 | Ga0500642_0018625_274_777 | 167 |
| 433 | 3300053133 | Ga0500655_011842 | Ga0500655_011842_189_692 | 167 |
| 434 | 3300053136 | Ga0500559_0007211 | Ga0500559_0007211_2283_2807 | 167 |
| 435 | 3300053142 | Ga0500577_0039468 | Ga0500577_0039468_856_1359 | 167 |
| 436 | 3300053146 | Ga0500588_0058586 | Ga0500588_0058586_456_965 | 167 |
| 437 | 3300053148 | Ga0500590_005065 | Ga0500590_005065_3402_3905 | 167 |
| 438 | 3300053151 | Ga0500604_0014126 | Ga0500604_0014126_1215_1718 | 167 |
| 439 | 3300053151 | Ga0500604_0269082 | Ga0500604_0269082_53_556 | 167 |
| 440 | 3300053156 | Ga0500622_0038995 | Ga0500622_0038995_743_1246 | 167 |
| 441 | 3300053158 | Ga0500627_0002521 | Ga0500627_0002521_4369_4872 | 167 |
| 442 | 3300053158 | Ga0500627_0075720 | Ga0500627_0075720_376_879 | 167 |
| 443 | 3300053724 | Ga0500570_001921 | Ga0500570_001921_8414_8917 | 167 |
| 444 | 3300053730 | Ga0500645_028013 | Ga0500645_028013_777_1295 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9388 | 1 | 160 |
| 6b7d-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine | 0.9346 | 1 | 160 |
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9295 | 3 | 159 |
| 7yy8-assembly1.cif.gz_B-2 | crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 | 0.9285 | 3 | 159 |
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9273 | 1 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9224 | 3 | 159 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9154 | 1 | 159 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9135 | 1 | 159 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9045 | 3 | 159 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8944 | 1 | 159 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520HSR6-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) | 0.9836 | 1 | 90 |
GO:0004595
GO:0005737 GO:0015937 |
| AF-A0A520HSR6-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) | 0.9729 | 1 | 90 |
GO:0004595
GO:0005737 GO:0015937 |
| AF-A0A520DEJ7-F1-model_v4 | deleted | 0.9588 | 1 | 105 |
|
| AF-A0A660VY32-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9474 | 3 | 162 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A5V280-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9472 | 3 | 167 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar