F445240

General Info

Members Datasets Scaffolds Average Seq Length
444 305 414 84

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100650978|Ga0070662_1006509782
Length 93
Sequence MMGGVEQGGEIAGYTVPVHRALTEPILLGGAPRGLAILNGTLAGAVGLGLRLWLIGXXXWAIGHVVAVWAAKRDPLFVDVVRRHLRIPGHLSV

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
10 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
11 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
12 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
13 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
14 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
15 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
16 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
17 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
18 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
19 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
20 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
21 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
22 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
23 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
24 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
25 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
71 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
277 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
297 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
300 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
303 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
304 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
305 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 4.95
Rhizoplane 2.25
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 6.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000006 3300003214 Bacteria 529784
2 JGI25160J50197_1047490 3300003354 Bacteria 934
3 Ga0055525_1000035 3300003759 Bacteria 300887
4 Ga0070660_100278708 3300005339 Bacteria 1368
5 Ga0070691_10616818 3300005341 Bacteria 642
6 Ga0070687_101205694 3300005343 Bacteria 558
7 Ga0070675_100460823 3300005354 Bacteria 1141
8 Ga0070674_100162798 3300005356 Bacteria 1694
9 Ga0070674_100548238 3300005356 Bacteria 970
10 Ga0070674_101094931 3300005356 Bacteria 703
11 Ga0070688_101397773 3300005365 Bacteria 567
12 Ga0070659_100339104 3300005366 Bacteria 1259
13 Ga0070709_10001426 3300005434 Bacteria 12925
14 Ga0070709_10002689 3300005434 Bacteria 9601
15 Ga0070709_11566942 3300005434 Bacteria 536
16 Ga0070709_11754270 3300005434 Bacteria 507
17 Ga0070714_100322051 3300005435 Bacteria 1446
18 Ga0070714_100500704 3300005435 Bacteria 1158
19 Ga0070713_100017236 3300005436 Bacteria 5457
20 Ga0070713_100452103 3300005436 Bacteria 1206
21 Ga0070713_100968599 3300005436 Bacteria 820
22 Ga0070710_10001964 3300005437 Bacteria 9746
23 Ga0070710_10003785 3300005437 Bacteria 7147
24 Ga0070710_10159477 3300005437 Bacteria 1398
25 Ga0070710_10231890 3300005437 Bacteria 1179
26 Ga0070711_100011707 3300005439 Bacteria 5453
27 Ga0070711_100031224 3300005439 Bacteria 3534
28 Ga0070711_100230290 3300005439 Bacteria 1444
29 Ga0070711_100255121 3300005439 Bacteria 1377
30 Ga0070711_100626639 3300005439 Bacteria 899
31 Ga0070705_100781034 3300005440 Bacteria 758
32 Ga0070708_101795993 3300005445 Bacteria 569
33 Ga0070678_101062030 3300005456 Bacteria 746
34 Ga0070662_100650978 3300005457 Bacteria 889
35 Ga0070681_10060046 3300005458 Bacteria 3781
36 Ga0070681_10150638 3300005458 Bacteria 2252
37 Ga0070681_10167788 3300005458 Bacteria 2117
38 Ga0070681_10517783 3300005458 Bacteria 1106
39 Ga0070681_10520510 3300005458 Bacteria 1103
40 Ga0068867_100805002 3300005459 Bacteria 838
41 Ga0070706_100055685 3300005467 Bacteria 3650
42 Ga0070706_100566272 3300005467 Bacteria 1056
43 Ga0070706_100987806 3300005467 Bacteria 776
44 Ga0070707_100110266 3300005468 Bacteria 2669
45 Ga0070707_101107979 3300005468 Bacteria 758
46 Ga0070707_101315606 3300005468 Bacteria 689
47 Ga0070698_100311305 3300005471 Bacteria 1505
48 Ga0070698_100409761 3300005471 Bacteria 1289
49 Ga0070699_100691539 3300005518 Bacteria 932
50 Ga0070699_101567201 3300005518 Bacteria 604
51 Ga0070679_100559963 3300005530 Bacteria 1087
52 Ga0070679_101633238 3300005530 Bacteria 592
53 Ga0070684_100357620 3300005535 Bacteria 1344
54 Ga0070697_100725448 3300005536 Bacteria 878
55 Ga0070697_100745063 3300005536 Bacteria 866
56 Ga0070697_101172030 3300005536 Bacteria 685
57 Ga0068853_100002801 3300005539 Bacteria 13191
58 Ga0068853_100010537 3300005539 Bacteria 7475
59 Ga0070665_101049202 3300005548 Bacteria 827
60 Ga0068855_102617427 3300005563 Bacteria 500
61 Ga0068857_100010210 3300005577 Bacteria 8164
62 Ga0068852_100128879 3300005616 Bacteria 2327
63 Ga0068861_102689332 3300005719 Bacteria 502
64 Ga0068862_100075141 3300005844 Bacteria 2922
65 Ga0081455_10400491 3300005937 Bacteria 952
66 Ga0081540_1021917 3300005983 Bacteria 3785
67 Ga0081540_1026680 3300005983 Bacteria 3290
68 Ga0081540_1237099 3300005983 Bacteria 641
69 Ga0070717_10254414 3300006028 Bacteria 1552
70 Ga0070717_10665079 3300006028 Bacteria 946
71 Ga0070715_10119456 3300006163 Bacteria 1255
72 Ga0070715_10415880 3300006163 Bacteria 751
73 Ga0070716_100092006 3300006173 Bacteria 1838
74 Ga0070716_100477390 3300006173 Bacteria 915
75 Ga0070712_100077132 3300006175 Bacteria 2401
76 Ga0070712_100112975 3300006175 Bacteria 2030
77 Ga0070712_101801714 3300006175 Bacteria 536
78 Ga0075367_10495985 3300006178 Bacteria 774
79 Ga0097621_100885160 3300006237 Bacteria 831
80 Ga0068865_101137370 3300006881 Bacteria 689
81 Ga0099825_1032259 3300006941 Bacteria 2141
82 Ga0099824_1005593 3300006942 Bacteria 17633
83 Ga0079104_1074915 3300006946 Bacteria 704
84 Ga0099794_10000295 3300007265 Bacteria 17188
85 Ga0099795_10001530 3300007788 Bacteria 5064
86 Ga0099795_10002423 3300007788 Bacteria 4387
87 Ga0099795_10055790 3300007788 Bacteria 1451
88 Ga0105240_10179268 3300009093 Bacteria 2502
89 Ga0105240_10930590 3300009093 Bacteria 933
90 Ga0105240_12249293 3300009093 Bacteria 565
91 Ga0105240_12567866 3300009093 Bacteria 526
92 Ga0105243_10350868 3300009148 Bacteria 1355
93 Ga0105243_10621924 3300009148 Bacteria 1043
94 Ga0105242_10443946 3300009176 Bacteria 1221
95 Ga0105242_10728123 3300009176 Bacteria 974
96 Ga0105237_10055611 3300009545 Bacteria 3963
97 Ga0105237_10310566 3300009545 Bacteria 1580
98 Ga0105238_10009276 3300009551 Bacteria 9848
99 Ga0105249_10170282 3300009553 Bacteria 2111
100 Ga0099796_10017044 3300010159 Bacteria 2156
101 Ga0099796_10050250 3300010159 Bacteria 1445
102 Ga0105239_10979850 3300010375 Bacteria 972
103 Ga0105239_13095335 3300010375 Bacteria 542
104 Ga0157373_10840761 3300013100 Bacteria 679
105 Ga0157371_10040556 3300013102 Bacteria 3324
106 Ga0157370_10006168 3300013104 Bacteria 13298
107 Ga0157369_10007094 3300013105 Bacteria 12922
108 Ga0157372_10002242 3300013307 Bacteria 20986
109 Ga0157372_11518971 3300013307 Bacteria 771
110 Ga0157372_12086697 3300013307 Bacteria 651
111 Ga0157379_10658528 3300014968 Bacteria 981
112 Ga0157376_11587315 3300014969 Bacteria 688
113 Ga0157376_12091764 3300014969 Bacteria 604
114 Ga0163161_10535394 3300017792 Bacteria 958
115 Ga0213873_10222946 3300021358 Bacteria 591
116 Ga0213872_10182762 3300021361 Bacteria 905
117 Ga0213876_10000534 3300021384 Bacteria 28772
118 Ga0213875_10204200 3300021388 Bacteria 930
119 Ga0209563_100047 3300025230 Bacteria 366620
120 Ga0209233_1000010 3300025261 Bacteria 1194329
121 Ga0209130_1002111 3300025284 Bacteria 10598
122 Ga0209676_1036019 3300025292 Bacteria 1445
123 Ga0207426_1000361 3300025302 Bacteria 81889
124 Ga0207692_10057618 3300025898 Bacteria 1999
125 Ga0207692_10058373 3300025898 Bacteria 1988
126 Ga0207692_10163859 3300025898 Bacteria 1283
127 Ga0207692_10181730 3300025898 Bacteria 1226
128 Ga0207642_10641876 3300025899 Bacteria 664
129 Ga0207647_10217666 3300025904 Bacteria 1101
130 Ga0207685_10048081 3300025905 Bacteria 1632
131 Ga0207685_10210665 3300025905 Bacteria 919
132 Ga0207685_10330905 3300025905 Bacteria 762
133 Ga0207699_10002420 3300025906 Bacteria 8817
134 Ga0207699_10010115 3300025906 Bacteria 4721
135 Ga0207699_10225831 3300025906 Bacteria 1280
136 Ga0207699_10909434 3300025906 Bacteria 649
137 Ga0207699_11452165 3300025906 Bacteria 507
138 Ga0207684_10112062 3300025910 Bacteria 2335
139 Ga0207684_10428968 3300025910 Bacteria 1135
140 Ga0207654_11432667 3300025911 Bacteria 504
141 Ga0207707_10215222 3300025912 Bacteria 1673
142 Ga0207707_10419318 3300025912 Bacteria 1148
143 Ga0207707_11044121 3300025912 Bacteria 668
144 Ga0207707_11646980 3300025912 Bacteria 504
145 Ga0207695_10286417 3300025913 Bacteria 1540
146 Ga0207695_10408291 3300025913 Bacteria 1242
147 Ga0207671_10097099 3300025914 Bacteria 2227
148 Ga0207693_10018518 3300025915 Bacteria 5545
149 Ga0207693_10024050 3300025915 Bacteria 4836
150 Ga0207693_10093939 3300025915 Bacteria 2351
151 Ga0207693_10380136 3300025915 Bacteria 1104
152 Ga0207693_10404329 3300025915 Bacteria 1067
153 Ga0207663_10003384 3300025916 Bacteria 7794
154 Ga0207663_10011370 3300025916 Bacteria 4778
155 Ga0207663_10320022 3300025916 Bacteria 1165
156 Ga0207663_10602671 3300025916 Bacteria 863
157 Ga0207663_10878480 3300025916 Bacteria 716
158 Ga0207660_10176028 3300025917 Bacteria 1659
159 Ga0207657_10193338 3300025919 Bacteria 1640
160 Ga0207652_11825515 3300025921 Bacteria 513
161 Ga0207646_10247230 3300025922 Bacteria 1611
162 Ga0207681_11872138 3300025923 Bacteria 500
163 Ga0207694_10002066 3300025924 Bacteria 16586
164 Ga0207659_10436854 3300025926 Bacteria 1100
165 Ga0207700_10167881 3300025928 Bacteria 1828
166 Ga0207700_10450436 3300025928 Bacteria 1134
167 Ga0207700_11723939 3300025928 Bacteria 552
168 Ga0207664_11888156 3300025929 Bacteria 520
169 Ga0207690_10949658 3300025932 Bacteria 714
170 Ga0207706_10461751 3300025933 Bacteria 1098
171 Ga0207686_10790732 3300025934 Bacteria 760
172 Ga0207669_11316468 3300025937 Bacteria 614
173 Ga0207669_11694391 3300025937 Bacteria 540
174 Ga0207665_10056031 3300025939 Bacteria 2661
175 Ga0207665_10228123 3300025939 Bacteria 1368
176 Ga0207665_10384812 3300025939 Bacteria 1065
177 Ga0207712_10738108 3300025961 Bacteria 862
178 Ga0207639_10005959 3300026041 Bacteria 8269
179 Ga0207639_10008392 3300026041 Bacteria 7082
180 Ga0207678_10530227 3300026067 Bacteria 1028
181 Ga0207641_10046520 3300026088 Bacteria 3658
182 Ga0207641_11870338 3300026088 Bacteria 602
183 Ga0207648_10748913 3300026089 Bacteria 907
184 Ga0207674_10008186 3300026116 Bacteria 12120
185 Ga0207674_11060902 3300026116 Bacteria 779
186 Ga0207675_101904295 3300026118 Bacteria 613
187 Ga0207683_10270472 3300026121 Bacteria 1552
188 Ga0207698_10040518 3300026142 Bacteria 3462
189 Ga0209588_1006494 3300027671 Bacteria 3401
190 Ga0268266_11049852 3300028379 Bacteria 788
191 Ga0268265_10006671 3300028380 Bacteria 7813
192 Ga0265337_1001390 3300028556 Bacteria 11879
193 Ga0265326_10000352 3300028558 Bacteria 19508
194 Ga0265319_1001943 3300028563 Bacteria 11708
195 Ga0265334_10002049 3300028573 Bacteria 9536
196 Ga0265318_10002935 3300028577 Bacteria 8848
197 Ga0265318_10103289 3300028577 Bacteria 1048
198 Ga0265323_10000035 3300028653 Bacteria 72657
199 Ga0265323_10054828 3300028653 Bacteria 1403
200 Ga0265322_10012111 3300028654 Bacteria 2494
201 Ga0265336_10000201 3300028666 Bacteria 41891
202 Ga0265336_10003340 3300028666 Bacteria 6307
203 Ga0265338_10000018 3300028800 Bacteria 338910
204 Ga0265338_10000572 3300028800 Bacteria 64902
205 Ga0265324_10000236 3300029957 Bacteria 41791
206 Ga0265331_10082856 3300031250 Bacteria 1488
207 Ga0265331_10479326 3300031250 Bacteria 559
208 Ga0307509_10225680 3300031507 Bacteria 1681
209 Ga0307509_10803579 3300031507 Bacteria 605
210 Ga0307508_10364515 3300031616 Bacteria 1036
211 Ga0265314_10030774 3300031711 Bacteria 3970
212 Ga0307412_10121014 3300031911 Bacteria 1884
213 Ga0307412_10194907 3300031911 Bacteria 1534
214 Ga0307414_10000674 3300032004 Bacteria 17500
215 Ga0307510_10330479 3300033180 Bacteria 979
216 Ga0373926_0206527 3300035083 Bacteria 757
217 Ga0373936_0341722 3300035113 Bacteria 681
218 Ga0373945_0354032 3300035116 Bacteria 637
219 Ga0373953_0235917 3300035117 Bacteria 793
220 Ga0373954_0045138 3300035118 Bacteria 2058
221 Ga0373943_0646650 3300035170 Bacteria 625
222 Ga0373943_0699161 3300035170 Bacteria 601
223 Ga0373955_0081338 3300035172 Bacteria 1831
224 Ga0373935_0198676 3300035692 Bacteria 1385
225 Ga0373935_0339656 3300035692 Bacteria 1069
226 Ga0373935_0474751 3300035692 Bacteria 906
227 Ga0373927_0103707 3300035695 Bacteria 1851
228 Ga0373927_0337067 3300035695 Bacteria 993
229 Ga0373933_0017339 3300035724 Bacteria 4040
230 Ga0373947_0367230 3300035725 Bacteria 967
231 Ga0373937_0004074 3300036401 Bacteria 12396
232 Ga0373925_0103874 3300037068 Bacteria 2188
233 Ga0373925_0123792 3300037068 Bacteria 2010
234 Ga0373925_1161781 3300037068 Bacteria 635
235 Ga0395900_0876903 3300037418 Bacteria 822
236 Ga0395898_0077544 3300037466 Bacteria 3208
237 Ga0395905_0053150 3300037471 Bacteria 3792
238 Ga0436364_0304108 3300037853 Bacteria 697
239 Ga0395901_1855334 3300038443 Bacteria 551
240 Ga0436365_0316876 3300039437 Bacteria 563
241 Ga0436365_0915242 3300039437 Bacteria 771
242 Ga0436365_1262966 3300039437 Bacteria 2109
243 Ga0436365_1869782 3300039437 Bacteria 4722
244 Ga0436360_0575863 3300039438 Bacteria 1857
245 Ga0436360_1302090 3300039438 Bacteria 712
246 Ga0436361_0293023 3300039447 Bacteria 1770
247 Ga0436361_0563642 3300039447 Bacteria 703
248 Ga0436361_1006063 3300039447 Bacteria 540
249 Ga0436363_0114580 3300039450 Bacteria 1821
250 Ga0436363_0902215 3300039450 Bacteria 969
251 Ga0436363_1459244 3300039450 Bacteria 1716
252 Ga0436362_0988361 3300039453 Bacteria 792
253 Ga0436362_1280182 3300039453 Bacteria 975
254 Ga0451787_461119 3300041441 Bacteria 1253
255 Ga0466972_0603843 3300044658 Bacteria 519
256 Ga0466964_0352829 3300044706 Bacteria 756
257 Ga0466968_0090820 3300044735 Bacteria 1353
258 Ga0466970_0472219 3300044765 Bacteria 720
259 Ga0466970_0618769 3300044765 Bacteria 629
260 Ga0466959_0217180 3300045049 Bacteria 1327
261 Ga0451576_0241726 3300045051 Bacteria 1886
262 Ga0451576_2729755 3300045051 Bacteria 502
263 Ga0466958_0001512 3300045836 Bacteria 11127
264 Ga0466967_0004334 3300045976 Bacteria 9545
265 Ga0495617_033917 3300046452 Bacteria 1713
266 Ga0495592_0400340 3300046454 Bacteria 870
267 Ga0495592_0914155 3300046454 Bacteria 515
268 Ga0495603_0046741 3300046455 Bacteria 2578
269 Ga0495603_0657503 3300046455 Bacteria 600
270 Ga0495590_0031614 3300046457 Bacteria 1853
271 Ga0495629_0132812 3300046459 Bacteria 1734
272 Ga0495638_0045651 3300046460 Bacteria 2755
273 Ga0495651_0008937 3300046462 Bacteria 7692
274 Ga0495653_0358879 3300046463 Bacteria 935
275 Ga0495650_0002433 3300046471 Bacteria 15084
276 Ga0495650_0163374 3300046471 Bacteria 792
277 Ga0495580_0167046 3300046472 Bacteria 1522
278 Ga0495580_0834437 3300046472 Bacteria 596
279 Ga0495582_0815034 3300046473 Bacteria 540
280 Ga0495639_0078437 3300046475 Bacteria 1535
281 Ga0495639_0553121 3300046475 Bacteria 590
282 Ga0495639_0644700 3300046475 Bacteria 546
283 Ga0495584_0060590 3300046491 Bacteria 1903
284 Ga0495585_0311143 3300046492 Bacteria 772
285 Ga0495585_0593347 3300046492 Bacteria 521
286 Ga0495594_0113906 3300046499 Bacteria 1526
287 Ga0495596_0000171 3300046500 Bacteria 45024
288 Ga0495607_0229720 3300046501 Bacteria 903
289 Ga0495583_0376312 3300046506 Bacteria 559
290 Ga0495606_0243565 3300046507 Bacteria 1001
291 Ga0495608_0014258 3300046511 Bacteria 5515
292 Ga0495618_0129657 3300046514 Bacteria 1614
293 Ga0495620_0002150 3300046515 Bacteria 11452
294 Ga0495628_1049962 3300046516 Bacteria 558
295 Ga0495631_0030236 3300046518 Bacteria 2458
296 Ga0495632_0029051 3300046519 Bacteria 2882
297 Ga0495643_0001609 3300046522 Bacteria 19996
298 Ga0495652_0003657 3300046529 Bacteria 15059
299 Ga0495665_0461368 3300046531 Bacteria 642
300 Ga0495640_0595416 3300046533 Bacteria 668
301 Ga0495587_0007784 3300046536 Bacteria 6922
302 Ga0495645_0526977 3300046543 Bacteria 735
303 Ga0495622_0235910 3300046557 Bacteria 807
304 Ga0495633_0295914 3300046558 Bacteria 735
305 Ga0495667_0000267 3300046559 Bacteria 33933
306 Ga0495656_0141751 3300046615 Bacteria 1153
307 Ga0495668_0004073 3300046616 Bacteria 10601
308 Ga0495634_0291459 3300046642 Bacteria 989
309 Ga0495634_0301141 3300046642 Bacteria 969
310 Ga0495634_0532167 3300046642 Bacteria 687
311 Ga0495611_0167478 3300046648 Bacteria 1027
312 Ga0495625_0019072 3300046660 Bacteria 5336
313 Ga0495635_0036018 3300046663 Bacteria 3431
314 Ga0495588_0028119 3300046674 Bacteria 2813
315 Ga0495588_0653536 3300046674 Bacteria 550
316 Ga0495657_0004443 3300046675 Bacteria 11202
317 Ga0495623_0000216 3300046679 Bacteria 36827
318 Ga0495646_0238781 3300046680 Bacteria 977
319 Ga0495658_0317811 3300046683 Bacteria 987
320 Ga0495669_0144653 3300046684 Bacteria 1123
321 Ga0495624_0799088 3300046690 Bacteria 558
322 Ga0495670_0512332 3300046691 Bacteria 652
323 Ga0495589_0031147 3300046794 Bacteria 2686
324 Ga0495600_0002526 3300046809 Bacteria 10525
325 Ga0495581_0024103 3300047315 Bacteria 3526
326 Ga0495604_0001204 3300047317 Bacteria 21379
327 Ga0495674_0274038 3300047319 Bacteria 1384
328 Ga0495676_0343174 3300047321 Bacteria 999
329 Ga0495680_0003008 3300047322 Bacteria 16811
330 Ga0495683_0121306 3300047323 Bacteria 1240
331 Ga0495683_0225824 3300047323 Bacteria 833
332 Ga0495675_0000122 3300047444 Bacteria 56354
333 Ga0495677_0133559 3300047445 Bacteria 951
334 Ga0495673_0000025 3300047469 Bacteria 512352
335 Ga0495681_0000209 3300047470 Bacteria 48667
336 Ga0495684_0034950 3300047471 Bacteria 3856
337 Ga0495593_0059077 3300047673 Bacteria 2010
338 Ga0495593_0493523 3300047673 Bacteria 614
339 Ga0495602_0003180 3300048088 Bacteria 16937
340 Ga0495614_0331781 3300048089 Bacteria 707
341 Ga0496100_0318275 3300048903 Bacteria 1168
342 Ga0496100_0333774 3300048903 Bacteria 1142
343 Ga0496100_0785286 3300048903 Bacteria 746
344 Ga0496101_0459547 3300048904 Bacteria 1005
345 Ga0496102_0526188 3300048905 Bacteria 1105
346 Ga0496102_1207941 3300048905 Bacteria 676
347 Ga0496106_1249646 3300048909 Bacteria 578
348 Ga0496109_1117893 3300048912 Bacteria 725
349 Ga0496113_1053730 3300048916 Bacteria 639
350 Ga0496118_0042470 3300048921 Bacteria 3586
351 Ga0496120_0000502 3300048923 Bacteria 61039
352 Ga0496121_0293484 3300048924 Bacteria 1106
353 Ga0496125_0351243 3300048928 Bacteria 881
354 Ga0496126_0029620 3300048929 Bacteria 5199
355 Ga0496126_0189323 3300048929 Bacteria 1744
356 Ga0496126_0208371 3300048929 Bacteria 1647
357 Ga0496126_0429596 3300048929 Bacteria 1066
358 Ga0496126_0934745 3300048929 Bacteria 655
359 Ga0495682_0015256 3300049460 Bacteria 2912
360 Ga0495682_0125617 3300049460 Bacteria 918
361 Ga0495682_0294804 3300049460 Bacteria 572
362 Ga0501290_078485 3300049513 Bacteria 559
363 Ga0501032_0032722 3300049569 Bacteria 3563
364 Ga0501033_0000180 3300049570 Bacteria 60526
365 Ga0501033_0003190 3300049570 Bacteria 13598
366 Ga0501033_0991766 3300049570 Bacteria 562
367 Ga0501034_0661017 3300049571 Bacteria 946
368 Ga0501034_0687909 3300049571 Bacteria 922
369 Ga0501037_0161167 3300049573 Bacteria 1599
370 Ga0501037_0590158 3300049573 Bacteria 747
371 Ga0501038_0002115 3300049574 Bacteria 18425
372 Ga0501042_1266550 3300049578 Bacteria 538
373 Ga0501043_0177935 3300049579 Bacteria 1658
374 Ga0501043_0822508 3300049579 Bacteria 671
375 Ga0501046_0112933 3300049580 Bacteria 2074
376 Ga0501047_0071547 3300049581 Bacteria 3338
377 Ga0501047_0165274 3300049581 Bacteria 2083
378 Ga0501047_0363183 3300049581 Bacteria 1283
379 Ga0501069_0166902 3300049585 Bacteria 1269
380 Ga0501070_0152269 3300049586 Bacteria 1908
381 Ga0501074_0357371 3300049590 Bacteria 1037
382 Ga0501249_000034 3300049679 Bacteria 72400
383 Ga0501259_110781 3300049688 Bacteria 641
384 Ga0501080_0267743 3300049742 Bacteria 1556
385 Ga0501080_0279622 3300049742 Bacteria 1518
386 Ga0501081_1287536 3300049743 Bacteria 554
387 Ga0501083_0450065 3300049744 Bacteria 838
388 Ga0501035_0002894 3300049822 Bacteria 16541
389 Ga0501035_0558131 3300049822 Bacteria 937
390 Ga0501044_0000058 3300049823 Bacteria 135713
391 Ga0501044_0007189 3300049823 Bacteria 12241
392 Ga0501044_0079435 3300049823 Bacteria 3324
393 Ga0501044_0319226 3300049823 Bacteria 1478
394 Ga0501044_0417647 3300049823 Bacteria 1252
395 Ga0501044_0823473 3300049823 Bacteria 806
396 Ga0501204_000529 3300049850 Bacteria 3318
397 nmdc:mga06z11_445514_c1 3300050494 Bacteria 782
398 Ga0495601_0488927 3300053077 Bacteria 795
399 Ga0495595_0116431 3300053084 Bacteria 1299
400 Ga0495619_0004043 3300053085 Bacteria 9395
401 Ga0500578_0331662 3300053086 Bacteria 894
402 Ga0500583_0418219 3300053092 Bacteria 641
403 Ga0500566_0345271 3300053094 Bacteria 684
404 Ga0500562_037185 3300053108 Bacteria 1292
405 Ga0500595_024977 3300053119 Bacteria 2079
406 Ga0500608_000742 3300053122 Bacteria 11917
407 Ga0500658_0002194 3300053134 Bacteria 7582
408 Ga0500568_0168791 3300053139 Bacteria 806
409 Ga0500589_108304 3300053147 Bacteria 1196
410 Ga0500603_079608 3300053150 Bacteria 947
411 Ga0500616_0000170 3300053153 Bacteria 108126
412 Ga0500639_088136 3300053163 Bacteria 1551
413 Ga0500636_0290265 3300053177 Bacteria 811
414 Ga0501082_1210324 3300060353 Bacteria 660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0163374 Ga0495650_0163374_532_762 65
2 3300053139 Ga0500568_0168791 Ga0500568_0168791_12_242 65
3 3300047469 Ga0495673_0000025 Ga0495673_0000025_130660_130929 67
4 3300048921 Ga0496118_0042470 Ga0496118_0042470_524_760 67
5 3300048928 Ga0496125_0351243 Ga0496125_0351243_624_860 67
6 iso_pu_bacteria 2824732956 2824734173 68
7 iso_pu_bacteria 2885374607 2885382053 68
8 3300005983 Ga0081540_1021917 Ga0081540_10219174 69
9 3300041441 Ga0451787_461119 Ga0451787_461119_481_729 69
10 3300049579 Ga0501043_0177935 Ga0501043_0177935_1303_1575 69
11 3300049581 Ga0501047_0165274 Ga0501047_0165274_96_368 69
12 3300049823 Ga0501044_0823473 Ga0501044_0823473_372_644 69
13 3300053092 Ga0500583_0418219 Ga0500583_0418219_187_441 69
14 3300053122 Ga0500608_000742 Ga0500608_000742_2048_2320 69
15 iso_pu_bacteria 2508501009 2508540353 69
16 3300049571 Ga0501034_0687909 Ga0501034_0687909_246_515 70
17 3300049585 Ga0501069_0166902 Ga0501069_0166902_715_984 70
18 3300049586 Ga0501070_0152269 Ga0501070_0152269_545_814 70
19 3300049823 Ga0501044_0007189 Ga0501044_0007189_7243_7512 70
20 3300060353 Ga0501082_1210324 Ga0501082_1210324_21_290 70
21 3300005459 Ga0068867_100805002 Ga0068867_1008050021 71
22 3300005539 Ga0068853_100010537 Ga0068853_1000105372 71
23 3300005548 Ga0070665_101049202 Ga0070665_1010492022 71
24 3300005844 Ga0068862_100075141 Ga0068862_1000751414 71
25 3300009545 Ga0105237_10055611 Ga0105237_100556112 71
26 3300009553 Ga0105249_10170282 Ga0105249_101702822 71
27 3300025914 Ga0207671_10097099 Ga0207671_100970992 71
28 3300026041 Ga0207639_10008392 Ga0207639_100083922 71
29 3300026067 Ga0207678_10530227 Ga0207678_105302273 71
30 3300026088 Ga0207641_11870338 Ga0207641_118703382 71
31 3300026089 Ga0207648_10748913 Ga0207648_107489132 71
32 3300028379 Ga0268266_11049852 Ga0268266_110498522 71
33 3300028380 Ga0268265_10006671 Ga0268265_100066717 71
34 3300031507 Ga0307509_10803579 Ga0307509_108035792 71
35 3300033180 Ga0307510_10330479 Ga0307510_103304792 71
36 3300037853 Ga0436364_0304108 Ga0436364_0304108_285_548 71
37 3300046454 Ga0495592_0914155 Ga0495592_0914155_201_461 71
38 3300048903 Ga0496100_0333774 Ga0496100_0333774_384_653 71
39 3300048904 Ga0496101_0459547 Ga0496101_0459547_368_637 71
40 3300048916 Ga0496113_1053730 Ga0496113_1053730_193_462 71
41 3300049570 Ga0501033_0000180 Ga0501033_0000180_33647_33916 71
42 3300049823 Ga0501044_0417647 Ga0501044_0417647_292_561 71
43 3300053153 Ga0500616_0000170 Ga0500616_0000170_83064_83345 71
44 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006127 72
45 3300003354 JGI25160J50197_1047490 JGI25160J50197_10474902 72
46 3300003759 Ga0055525_1000035 Ga0055525_100003525 72
47 3300005339 Ga0070660_100278708 Ga0070660_1002787083 72
48 3300005341 Ga0070691_10616818 Ga0070691_106168181 72
49 3300005343 Ga0070687_101205694 Ga0070687_1012056942 72
50 3300005354 Ga0070675_100460823 Ga0070675_1004608233 72
51 3300005356 Ga0070674_100162798 Ga0070674_1001627983 72
52 3300005356 Ga0070674_100548238 Ga0070674_1005482381 72
53 3300005356 Ga0070674_101094931 Ga0070674_1010949312 72
54 3300005365 Ga0070688_101397773 Ga0070688_1013977731 72
55 3300005366 Ga0070659_100339104 Ga0070659_1003391042 72
56 3300005434 Ga0070709_10001426 Ga0070709_1000142614 72
57 3300005434 Ga0070709_10002689 Ga0070709_100026893 72
58 3300005434 Ga0070709_11566942 Ga0070709_115669421 72
59 3300005434 Ga0070709_11754270 Ga0070709_117542701 72
60 3300005435 Ga0070714_100322051 Ga0070714_1003220511 72
61 3300005435 Ga0070714_100500704 Ga0070714_1005007042 72
62 3300005436 Ga0070713_100017236 Ga0070713_1000172362 72
63 3300005436 Ga0070713_100452103 Ga0070713_1004521031 72
64 3300005436 Ga0070713_100968599 Ga0070713_1009685992 72
65 3300005437 Ga0070710_10001964 Ga0070710_100019649 72
66 3300005437 Ga0070710_10003785 Ga0070710_100037852 72
67 3300005437 Ga0070710_10159477 Ga0070710_101594771 72
68 3300005437 Ga0070710_10231890 Ga0070710_102318902 72
69 3300005439 Ga0070711_100011707 Ga0070711_1000117074 72
70 3300005439 Ga0070711_100031224 Ga0070711_1000312242 72
71 3300005439 Ga0070711_100230290 Ga0070711_1002302903 72
72 3300005439 Ga0070711_100255121 Ga0070711_1002551212 72
73 3300005439 Ga0070711_100626639 Ga0070711_1006266391 72
74 3300005440 Ga0070705_100781034 Ga0070705_1007810342 72
75 3300005445 Ga0070708_101795993 Ga0070708_1017959932 72
76 3300005456 Ga0070678_101062030 Ga0070678_1010620301 72
77 3300005457 Ga0070662_100650978 Ga0070662_1006509782 72
78 3300005458 Ga0070681_10060046 Ga0070681_100600462 72
79 3300005458 Ga0070681_10150638 Ga0070681_101506383 72
80 3300005458 Ga0070681_10167788 Ga0070681_101677883 72
81 3300005458 Ga0070681_10517783 Ga0070681_105177831 72
82 3300005458 Ga0070681_10520510 Ga0070681_105205102 72
83 3300005467 Ga0070706_100055685 Ga0070706_1000556853 72
84 3300005467 Ga0070706_100566272 Ga0070706_1005662722 72
85 3300005467 Ga0070706_100987806 Ga0070706_1009878063 72
86 3300005468 Ga0070707_100110266 Ga0070707_1001102663 72
87 3300005468 Ga0070707_101107979 Ga0070707_1011079792 72
88 3300005468 Ga0070707_101315606 Ga0070707_1013156061 72
89 3300005471 Ga0070698_100311305 Ga0070698_1003113051 72
90 3300005471 Ga0070698_100409761 Ga0070698_1004097612 72
91 3300005518 Ga0070699_100691539 Ga0070699_1006915392 72
92 3300005518 Ga0070699_101567201 Ga0070699_1015672012 72
93 3300005530 Ga0070679_100559963 Ga0070679_1005599632 72
94 3300005530 Ga0070679_101633238 Ga0070679_1016332382 72
95 3300005535 Ga0070684_100357620 Ga0070684_1003576202 72
96 3300005536 Ga0070697_100725448 Ga0070697_1007254482 72
97 3300005536 Ga0070697_100745063 Ga0070697_1007450632 72
98 3300005536 Ga0070697_101172030 Ga0070697_1011720302 72
99 3300005539 Ga0068853_100002801 Ga0068853_1000028017 72
100 3300005563 Ga0068855_102617427 Ga0068855_1026174272 72
101 3300005577 Ga0068857_100010210 Ga0068857_1000102109 72
102 3300005616 Ga0068852_100128879 Ga0068852_1001288792 72
103 3300005719 Ga0068861_102689332 Ga0068861_1026893322 72
104 3300005937 Ga0081455_10400491 Ga0081455_104004913 72
105 3300005983 Ga0081540_1026680 Ga0081540_10266803 72
106 3300005983 Ga0081540_1237099 Ga0081540_12370991 72
107 3300006028 Ga0070717_10254414 Ga0070717_102544142 72
108 3300006028 Ga0070717_10665079 Ga0070717_106650793 72
109 3300006163 Ga0070715_10119456 Ga0070715_101194562 72
110 3300006163 Ga0070715_10415880 Ga0070715_104158801 72
111 3300006173 Ga0070716_100092006 Ga0070716_1000920063 72
112 3300006173 Ga0070716_100477390 Ga0070716_1004773902 72
113 3300006175 Ga0070712_100077132 Ga0070712_1000771324 72
114 3300006175 Ga0070712_100112975 Ga0070712_1001129752 72
115 3300006175 Ga0070712_101801714 Ga0070712_1018017141 72
116 3300006178 Ga0075367_10495985 Ga0075367_104959852 72
117 3300006237 Ga0097621_100885160 Ga0097621_1008851602 72
118 3300006881 Ga0068865_101137370 Ga0068865_1011373702 72
119 3300006941 Ga0099825_1032259 Ga0099825_10322594 72
120 3300006942 Ga0099824_1005593 Ga0099824_100559316 72
121 3300006946 Ga0079104_1074915 Ga0079104_10749152 72
122 3300007265 Ga0099794_10000295 Ga0099794_1000029510 72
123 3300007788 Ga0099795_10001530 Ga0099795_100015305 72
124 3300007788 Ga0099795_10002423 Ga0099795_100024233 72
125 3300007788 Ga0099795_10055790 Ga0099795_100557903 72
126 3300009093 Ga0105240_10179268 Ga0105240_101792684 72
127 3300009093 Ga0105240_10930590 Ga0105240_109305902 72
128 3300009093 Ga0105240_12249293 Ga0105240_122492932 72
129 3300009093 Ga0105240_12567866 Ga0105240_125678662 72
130 3300009148 Ga0105243_10350868 Ga0105243_103508683 72
131 3300009148 Ga0105243_10621924 Ga0105243_106219244 72
132 3300009176 Ga0105242_10443946 Ga0105242_104439462 72
133 3300009176 Ga0105242_10728123 Ga0105242_107281232 72
134 3300009545 Ga0105237_10310566 Ga0105237_103105663 72
135 3300009551 Ga0105238_10009276 Ga0105238_100092764 72
136 3300010159 Ga0099796_10017044 Ga0099796_100170442 72
137 3300010159 Ga0099796_10050250 Ga0099796_100502502 72
138 3300010375 Ga0105239_10979850 Ga0105239_109798502 72
139 3300010375 Ga0105239_13095335 Ga0105239_130953351 72
140 3300013100 Ga0157373_10840761 Ga0157373_108407611 72
141 3300013102 Ga0157371_10040556 Ga0157371_100405562 72
142 3300013104 Ga0157370_10006168 Ga0157370_100061687 72
143 3300013105 Ga0157369_10007094 Ga0157369_100070946 72
144 3300013307 Ga0157372_10002242 Ga0157372_1000224217 72
145 3300013307 Ga0157372_11518971 Ga0157372_115189713 72
146 3300013307 Ga0157372_12086697 Ga0157372_120866972 72
147 3300014968 Ga0157379_10658528 Ga0157379_106585282 72
148 3300014969 Ga0157376_11587315 Ga0157376_115873152 72
149 3300014969 Ga0157376_12091764 Ga0157376_120917642 72
150 3300017792 Ga0163161_10535394 Ga0163161_105353941 72
151 3300021358 Ga0213873_10222946 Ga0213873_102229461 72
152 3300021361 Ga0213872_10182762 Ga0213872_101827622 72
153 3300021384 Ga0213876_10000534 Ga0213876_1000053420 72
154 3300021388 Ga0213875_10204200 Ga0213875_102042002 72
155 3300025230 Ga0209563_100047 Ga0209563_100047325 72
156 3300025261 Ga0209233_1000010 Ga0209233_1000010707 72
157 3300025284 Ga0209130_1002111 Ga0209130_10021119 72
158 3300025292 Ga0209676_1036019 Ga0209676_10360192 72
159 3300025302 Ga0207426_1000361 Ga0207426_100036136 72
160 3300025898 Ga0207692_10057618 Ga0207692_100576183 72
161 3300025898 Ga0207692_10058373 Ga0207692_100583733 72
162 3300025898 Ga0207692_10163859 Ga0207692_101638593 72
163 3300025898 Ga0207692_10181730 Ga0207692_101817302 72
164 3300025899 Ga0207642_10641876 Ga0207642_106418762 72
165 3300025904 Ga0207647_10217666 Ga0207647_102176662 72
166 3300025905 Ga0207685_10048081 Ga0207685_100480813 72
167 3300025905 Ga0207685_10210665 Ga0207685_102106652 72
168 3300025905 Ga0207685_10330905 Ga0207685_103309053 72
169 3300025906 Ga0207699_10002420 Ga0207699_100024206 72
170 3300025906 Ga0207699_10010115 Ga0207699_100101152 72
171 3300025906 Ga0207699_10225831 Ga0207699_102258312 72
172 3300025906 Ga0207699_10909434 Ga0207699_109094342 72
173 3300025906 Ga0207699_11452165 Ga0207699_114521651 72
174 3300025910 Ga0207684_10112062 Ga0207684_101120623 72
175 3300025910 Ga0207684_10428968 Ga0207684_104289682 72
176 3300025911 Ga0207654_11432667 Ga0207654_114326671 72
177 3300025912 Ga0207707_10215222 Ga0207707_102152223 72
178 3300025912 Ga0207707_10419318 Ga0207707_104193182 72
179 3300025912 Ga0207707_11044121 Ga0207707_110441212 72
180 3300025912 Ga0207707_11646980 Ga0207707_116469801 72
181 3300025913 Ga0207695_10286417 Ga0207695_102864172 72
182 3300025913 Ga0207695_10408291 Ga0207695_104082912 72
183 3300025915 Ga0207693_10018518 Ga0207693_100185185 72
184 3300025915 Ga0207693_10024050 Ga0207693_100240502 72
185 3300025915 Ga0207693_10093939 Ga0207693_100939392 72
186 3300025915 Ga0207693_10380136 Ga0207693_103801362 72
187 3300025915 Ga0207693_10404329 Ga0207693_104043293 72
188 3300025916 Ga0207663_10003384 Ga0207663_100033848 72
189 3300025916 Ga0207663_10011370 Ga0207663_100113703 72
190 3300025916 Ga0207663_10320022 Ga0207663_103200222 72
191 3300025916 Ga0207663_10602671 Ga0207663_106026712 72
192 3300025916 Ga0207663_10878480 Ga0207663_108784802 72
193 3300025917 Ga0207660_10176028 Ga0207660_101760282 72
194 3300025919 Ga0207657_10193338 Ga0207657_101933383 72
195 3300025921 Ga0207652_11825515 Ga0207652_118255152 72
196 3300025922 Ga0207646_10247230 Ga0207646_102472302 72
197 3300025923 Ga0207681_11872138 Ga0207681_118721382 72
198 3300025924 Ga0207694_10002066 Ga0207694_1000206612 72
199 3300025926 Ga0207659_10436854 Ga0207659_104368543 72
200 3300025928 Ga0207700_10167881 Ga0207700_101678813 72
201 3300025928 Ga0207700_10450436 Ga0207700_104504362 72
202 3300025928 Ga0207700_11723939 Ga0207700_117239391 72
203 3300025929 Ga0207664_11888156 Ga0207664_118881562 72
204 3300025932 Ga0207690_10949658 Ga0207690_109496582 72
205 3300025933 Ga0207706_10461751 Ga0207706_104617512 72
206 3300025934 Ga0207686_10790732 Ga0207686_107907321 72
207 3300025937 Ga0207669_11316468 Ga0207669_113164681 72
208 3300025937 Ga0207669_11694391 Ga0207669_116943911 72
209 3300025939 Ga0207665_10056031 Ga0207665_100560312 72
210 3300025939 Ga0207665_10228123 Ga0207665_102281232 72
211 3300025939 Ga0207665_10384812 Ga0207665_103848121 72
212 3300025961 Ga0207712_10738108 Ga0207712_107381082 72
213 3300026041 Ga0207639_10005959 Ga0207639_100059597 72
214 3300026088 Ga0207641_10046520 Ga0207641_100465204 72
215 3300026116 Ga0207674_10008186 Ga0207674_100081866 72
216 3300026116 Ga0207674_11060902 Ga0207674_110609022 72
217 3300026118 Ga0207675_101904295 Ga0207675_1019042952 72
218 3300026121 Ga0207683_10270472 Ga0207683_102704723 72
219 3300026142 Ga0207698_10040518 Ga0207698_100405183 72
220 3300027671 Ga0209588_1006494 Ga0209588_10064944 72
221 3300028556 Ga0265337_1001390 Ga0265337_10013905 72
222 3300028558 Ga0265326_10000352 Ga0265326_1000035213 72
223 3300028563 Ga0265319_1001943 Ga0265319_10019435 72
224 3300028573 Ga0265334_10002049 Ga0265334_100020495 72
225 3300028577 Ga0265318_10002935 Ga0265318_100029355 72
226 3300028577 Ga0265318_10103289 Ga0265318_101032892 72
227 3300028653 Ga0265323_10000035 Ga0265323_1000003545 72
228 3300028653 Ga0265323_10054828 Ga0265323_100548283 72
229 3300028654 Ga0265322_10012111 Ga0265322_100121113 72
230 3300028666 Ga0265336_10000201 Ga0265336_1000020128 72
231 3300028666 Ga0265336_10003340 Ga0265336_100033402 72
232 3300028800 Ga0265338_10000018 Ga0265338_1000001828 72
233 3300028800 Ga0265338_10000572 Ga0265338_1000057230 72
234 3300029957 Ga0265324_10000236 Ga0265324_100002368 72
235 3300031250 Ga0265331_10082856 Ga0265331_100828562 72
236 3300031250 Ga0265331_10479326 Ga0265331_104793261 72
237 3300031507 Ga0307509_10225680 Ga0307509_102256802 72
238 3300031616 Ga0307508_10364515 Ga0307508_103645151 72
239 3300031711 Ga0265314_10030774 Ga0265314_100307745 72
240 3300031911 Ga0307412_10121014 Ga0307412_101210142 72
241 3300031911 Ga0307412_10194907 Ga0307412_101949072 72
242 3300032004 Ga0307414_10000674 Ga0307414_1000067414 72
243 3300035083 Ga0373926_0206527 Ga0373926_0206527_42_305 72
244 3300035113 Ga0373936_0341722 Ga0373936_0341722_387_650 72
245 3300035116 Ga0373945_0354032 Ga0373945_0354032_83_346 72
246 3300035117 Ga0373953_0235917 Ga0373953_0235917_476_739 72
247 3300035118 Ga0373954_0045138 Ga0373954_0045138_636_899 72
248 3300035170 Ga0373943_0646650 Ga0373943_0646650_42_305 72
249 3300035170 Ga0373943_0699161 Ga0373943_0699161_314_577 72
250 3300035172 Ga0373955_0081338 Ga0373955_0081338_1204_1467 72
251 3300035692 Ga0373935_0198676 Ga0373935_0198676_72_335 72
252 3300035692 Ga0373935_0339656 Ga0373935_0339656_66_329 72
253 3300035692 Ga0373935_0474751 Ga0373935_0474751_163_426 72
254 3300035695 Ga0373927_0103707 Ga0373927_0103707_1044_1307 72
255 3300035695 Ga0373927_0337067 Ga0373927_0337067_422_685 72
256 3300035724 Ga0373933_0017339 Ga0373933_0017339_3481_3744 72
257 3300035725 Ga0373947_0367230 Ga0373947_0367230_351_614 72
258 3300036401 Ga0373937_0004074 Ga0373937_0004074_10777_11040 72
259 3300037068 Ga0373925_0103874 Ga0373925_0103874_1681_1944 72
260 3300037068 Ga0373925_0123792 Ga0373925_0123792_101_364 72
261 3300037068 Ga0373925_1161781 Ga0373925_1161781_331_594 72
262 3300037418 Ga0395900_0876903 Ga0395900_0876903_380_643 72
263 3300037466 Ga0395898_0077544 Ga0395898_0077544_814_1077 72
264 3300037471 Ga0395905_0053150 Ga0395905_0053150_2058_2330 72
265 3300038443 Ga0395901_1855334 Ga0395901_1855334_172_435 72
266 3300039437 Ga0436365_0316876 Ga0436365_0316876_185_448 72
267 3300039437 Ga0436365_0915242 Ga0436365_0915242_417_680 72
268 3300039437 Ga0436365_1262966 Ga0436365_1262966_593_856 72
269 3300039437 Ga0436365_1869782 Ga0436365_1869782_1079_1342 72
270 3300039438 Ga0436360_0575863 Ga0436360_0575863_138_401 72
271 3300039438 Ga0436360_1302090 Ga0436360_1302090_328_591 72
272 3300039447 Ga0436361_0293023 Ga0436361_0293023_934_1197 72
273 3300039447 Ga0436361_0563642 Ga0436361_0563642_415_678 72
274 3300039447 Ga0436361_1006063 Ga0436361_1006063_88_351 72
275 3300039450 Ga0436363_0114580 Ga0436363_0114580_1067_1330 72
276 3300039450 Ga0436363_0902215 Ga0436363_0902215_47_310 72
277 3300039450 Ga0436363_1459244 Ga0436363_1459244_999_1262 72
278 3300039453 Ga0436362_0988361 Ga0436362_0988361_192_455 72
279 3300039453 Ga0436362_1280182 Ga0436362_1280182_326_589 72
280 3300044658 Ga0466972_0603843 Ga0466972_0603843_222_494 72
281 3300044706 Ga0466964_0352829 Ga0466964_0352829_155_418 72
282 3300044735 Ga0466968_0090820 Ga0466968_0090820_408_671 72
283 3300044765 Ga0466970_0472219 Ga0466970_0472219_421_684 72
284 3300044765 Ga0466970_0618769 Ga0466970_0618769_28_294 72
285 3300045049 Ga0466959_0217180 Ga0466959_0217180_325_588 72
286 3300045051 Ga0451576_0241726 Ga0451576_0241726_57_338 72
287 3300045051 Ga0451576_2729755 Ga0451576_2729755_165_446 72
288 3300045836 Ga0466958_0001512 Ga0466958_0001512_5879_6142 72
289 3300045976 Ga0466967_0004334 Ga0466967_0004334_2261_2524 72
290 3300046452 Ga0495617_033917 Ga0495617_033917_450_713 72
291 3300046454 Ga0495592_0400340 Ga0495592_0400340_473_736 72
292 3300046455 Ga0495603_0046741 Ga0495603_0046741_335_598 72
293 3300046455 Ga0495603_0657503 Ga0495603_0657503_256_525 72
294 3300046457 Ga0495590_0031614 Ga0495590_0031614_853_1116 72
295 3300046459 Ga0495629_0132812 Ga0495629_0132812_774_1037 72
296 3300046460 Ga0495638_0045651 Ga0495638_0045651_885_1148 72
297 3300046462 Ga0495651_0008937 Ga0495651_0008937_7292_7555 72
298 3300046463 Ga0495653_0358879 Ga0495653_0358879_381_644 72
299 3300046471 Ga0495650_0002433 Ga0495650_0002433_6575_6844 72
300 3300046472 Ga0495580_0167046 Ga0495580_0167046_374_637 72
301 3300046472 Ga0495580_0834437 Ga0495580_0834437_323_586 72
302 3300046473 Ga0495582_0815034 Ga0495582_0815034_149_412 72
303 3300046475 Ga0495639_0078437 Ga0495639_0078437_166_429 72
304 3300046475 Ga0495639_0553121 Ga0495639_0553121_31_294 72
305 3300046475 Ga0495639_0644700 Ga0495639_0644700_38_301 72
306 3300046491 Ga0495584_0060590 Ga0495584_0060590_1012_1275 72
307 3300046492 Ga0495585_0311143 Ga0495585_0311143_28_291 72
308 3300046492 Ga0495585_0593347 Ga0495585_0593347_37_300 72
309 3300046499 Ga0495594_0113906 Ga0495594_0113906_1202_1465 72
310 3300046500 Ga0495596_0000171 Ga0495596_0000171_9964_10233 72
311 3300046501 Ga0495607_0229720 Ga0495607_0229720_263_526 72
312 3300046506 Ga0495583_0376312 Ga0495583_0376312_32_295 72
313 3300046507 Ga0495606_0243565 Ga0495606_0243565_654_923 72
314 3300046511 Ga0495608_0014258 Ga0495608_0014258_3592_3855 72
315 3300046514 Ga0495618_0129657 Ga0495618_0129657_119_382 72
316 3300046515 Ga0495620_0002150 Ga0495620_0002150_2923_3192 72
317 3300046516 Ga0495628_1049962 Ga0495628_1049962_43_306 72
318 3300046518 Ga0495631_0030236 Ga0495631_0030236_877_1140 72
319 3300046519 Ga0495632_0029051 Ga0495632_0029051_876_1139 72
320 3300046522 Ga0495643_0001609 Ga0495643_0001609_8312_8581 72
321 3300046529 Ga0495652_0003657 Ga0495652_0003657_9624_9887 72
322 3300046531 Ga0495665_0461368 Ga0495665_0461368_38_301 72
323 3300046533 Ga0495640_0595416 Ga0495640_0595416_259_522 72
324 3300046536 Ga0495587_0007784 Ga0495587_0007784_5145_5408 72
325 3300046543 Ga0495645_0526977 Ga0495645_0526977_129_392 72
326 3300046557 Ga0495622_0235910 Ga0495622_0235910_263_526 72
327 3300046558 Ga0495633_0295914 Ga0495633_0295914_171_434 72
328 3300046559 Ga0495667_0000267 Ga0495667_0000267_24104_24367 72
329 3300046615 Ga0495656_0141751 Ga0495656_0141751_633_896 72
330 3300046616 Ga0495668_0004073 Ga0495668_0004073_1025_1288 72
331 3300046642 Ga0495634_0291459 Ga0495634_0291459_97_381 72
332 3300046642 Ga0495634_0301141 Ga0495634_0301141_67_330 72
333 3300046642 Ga0495634_0532167 Ga0495634_0532167_346_609 72
334 3300046648 Ga0495611_0167478 Ga0495611_0167478_507_770 72
335 3300046660 Ga0495625_0019072 Ga0495625_0019072_3816_4079 72
336 3300046663 Ga0495635_0036018 Ga0495635_0036018_1989_2252 72
337 3300046674 Ga0495588_0028119 Ga0495588_0028119_2052_2315 72
338 3300046674 Ga0495588_0653536 Ga0495588_0653536_96_359 72
339 3300046675 Ga0495657_0004443 Ga0495657_0004443_1923_2186 72
340 3300046679 Ga0495623_0000216 Ga0495623_0000216_15181_15444 72
341 3300046680 Ga0495646_0238781 Ga0495646_0238781_474_737 72
342 3300046683 Ga0495658_0317811 Ga0495658_0317811_269_532 72
343 3300046684 Ga0495669_0144653 Ga0495669_0144653_507_770 72
344 3300046690 Ga0495624_0799088 Ga0495624_0799088_29_292 72
345 3300046691 Ga0495670_0512332 Ga0495670_0512332_171_434 72
346 3300046794 Ga0495589_0031147 Ga0495589_0031147_1396_1659 72
347 3300046809 Ga0495600_0002526 Ga0495600_0002526_6676_6939 72
348 3300047315 Ga0495581_0024103 Ga0495581_0024103_1314_1577 72
349 3300047317 Ga0495604_0001204 Ga0495604_0001204_16103_16366 72
350 3300047319 Ga0495674_0274038 Ga0495674_0274038_35_298 72
351 3300047321 Ga0495676_0343174 Ga0495676_0343174_219_482 72
352 3300047322 Ga0495680_0003008 Ga0495680_0003008_14876_15139 72
353 3300047323 Ga0495683_0121306 Ga0495683_0121306_504_773 72
354 3300047323 Ga0495683_0225824 Ga0495683_0225824_546_809 72
355 3300047444 Ga0495675_0000122 Ga0495675_0000122_39833_40096 72
356 3300047445 Ga0495677_0133559 Ga0495677_0133559_390_653 72
357 3300047470 Ga0495681_0000209 Ga0495681_0000209_40158_40427 72
358 3300047471 Ga0495684_0034950 Ga0495684_0034950_2211_2474 72
359 3300047673 Ga0495593_0059077 Ga0495593_0059077_849_1112 72
360 3300047673 Ga0495593_0493523 Ga0495593_0493523_280_543 72
361 3300048088 Ga0495602_0003180 Ga0495602_0003180_5173_5436 72
362 3300048089 Ga0495614_0331781 Ga0495614_0331781_418_681 72
363 3300048903 Ga0496100_0318275 Ga0496100_0318275_244_507 72
364 3300048903 Ga0496100_0785286 Ga0496100_0785286_67_330 72
365 3300048905 Ga0496102_0526188 Ga0496102_0526188_102_365 72
366 3300048905 Ga0496102_1207941 Ga0496102_1207941_250_513 72
367 3300048909 Ga0496106_1249646 Ga0496106_1249646_299_568 72
368 3300048912 Ga0496109_1117893 Ga0496109_1117893_352_615 72
369 3300048923 Ga0496120_0000502 Ga0496120_0000502_26408_26689 72
370 3300048924 Ga0496121_0293484 Ga0496121_0293484_758_1021 72
371 3300048929 Ga0496126_0029620 Ga0496126_0029620_3116_3379 72
372 3300048929 Ga0496126_0189323 Ga0496126_0189323_843_1106 72
373 3300048929 Ga0496126_0208371 Ga0496126_0208371_211_477 72
374 3300048929 Ga0496126_0429596 Ga0496126_0429596_662_925 72
375 3300048929 Ga0496126_0934745 Ga0496126_0934745_186_449 72
376 3300049460 Ga0495682_0015256 Ga0495682_0015256_966_1229 72
377 3300049460 Ga0495682_0125617 Ga0495682_0125617_225_488 72
378 3300049460 Ga0495682_0294804 Ga0495682_0294804_266_529 72
379 3300049513 Ga0501290_078485 Ga0501290_078485_121_393 72
380 3300049569 Ga0501032_0032722 Ga0501032_0032722_2347_2616 72
381 3300049570 Ga0501033_0003190 Ga0501033_0003190_5663_5932 72
382 3300049570 Ga0501033_0991766 Ga0501033_0991766_205_477 72
383 3300049571 Ga0501034_0661017 Ga0501034_0661017_569_850 72
384 3300049573 Ga0501037_0161167 Ga0501037_0161167_725_994 72
385 3300049573 Ga0501037_0590158 Ga0501037_0590158_293_547 72
386 3300049574 Ga0501038_0002115 Ga0501038_0002115_17165_17446 72
387 3300049578 Ga0501042_1266550 Ga0501042_1266550_62_316 72
388 3300049579 Ga0501043_0822508 Ga0501043_0822508_35_289 72
389 3300049580 Ga0501046_0112933 Ga0501046_0112933_1063_1317 72
390 3300049581 Ga0501047_0071547 Ga0501047_0071547_1099_1368 72
391 3300049581 Ga0501047_0363183 Ga0501047_0363183_701_964 72
392 3300049590 Ga0501074_0357371 Ga0501074_0357371_659_922 72
393 3300049679 Ga0501249_000034 Ga0501249_000034_53644_53916 72
394 3300049688 Ga0501259_110781 Ga0501259_110781_148_420 72
395 3300049742 Ga0501080_0267743 Ga0501080_0267743_814_1068 72
396 3300049742 Ga0501080_0279622 Ga0501080_0279622_134_397 72
397 3300049743 Ga0501081_1287536 Ga0501081_1287536_216_488 72
398 3300049744 Ga0501083_0450065 Ga0501083_0450065_272_526 72
399 3300049822 Ga0501035_0002894 Ga0501035_0002894_8657_8926 72
400 3300049822 Ga0501035_0558131 Ga0501035_0558131_635_889 72
401 3300049823 Ga0501044_0000058 Ga0501044_0000058_7739_8008 72
402 3300049823 Ga0501044_0079435 Ga0501044_0079435_510_791 72
403 3300049823 Ga0501044_0319226 Ga0501044_0319226_68_322 72
404 3300049850 Ga0501204_000529 Ga0501204_000529_1582_1854 72
405 3300050494 nmdc:mga06z11_445514_c1 nmdc:mga06z11_445514_c1_280_543 72
406 3300053077 Ga0495601_0488927 Ga0495601_0488927_467_730 72
407 3300053084 Ga0495595_0116431 Ga0495595_0116431_397_660 72
408 3300053085 Ga0495619_0004043 Ga0495619_0004043_5140_5403 72
409 3300053086 Ga0500578_0331662 Ga0500578_0331662_157_420 72
410 3300053094 Ga0500566_0345271 Ga0500566_0345271_80_343 72
411 3300053108 Ga0500562_037185 Ga0500562_037185_747_1010 72
412 3300053119 Ga0500595_024977 Ga0500595_024977_561_824 72
413 3300053134 Ga0500658_0002194 Ga0500658_0002194_6016_6279 72
414 3300053147 Ga0500589_108304 Ga0500589_108304_475_738 72
415 3300053150 Ga0500603_079608 Ga0500603_079608_266_529 72
416 3300053163 Ga0500639_088136 Ga0500639_088136_686_949 72
417 3300053177 Ga0500636_0290265 Ga0500636_0290265_421_684 72
418 iso_pu_bacteria 2508501123 2509118904 72
419 iso_pu_bacteria 2513237090 2513613027 72
420 iso_pu_bacteria 2513237094 2513643948 72
421 iso_pu_bacteria 2643221595 2643985673 72
422 iso_pu_bacteria 2643221736 2644746997 72
423 iso_pu_bacteria 2728368998 2728749643 72
424 iso_pu_bacteria 2744054633 2745081893 72
425 iso_pu_bacteria 2852653556 2852655672 72
426 iso_pu_bacteria 2876761206 2876761505 72
427 iso_pu_bacteria 2876761206 2876763585 72
428 iso_pu_bacteria 2903768456 2903769896 72
429 iso_pu_bacteria 2919450847 2919454285 72
430 iso_pu_bacteria 2920760137 2920766716 72
431 iso_pu_bacteria 2932818245 2932824997 72
432 iso_pu_bacteria 2935630451 2935636771 72
433 iso_pu_bacteria 2935819856 2935827733 72
434 iso_pu_bacteria 2935847175 2935855036 72
435 iso_pu_bacteria 2935984226 2935988687 72
436 iso_pu_bacteria 2936055302 2936063305 72
437 iso_pu_bacteria 2941507105 2941513408 72
438 iso_pu_bacteria 2941515067 2941521371 72
439 iso_pu_bacteria 2941523033 2941529125 72
440 iso_pu_bacteria 3000865235 3000867909 72
441 iso_pu_bacteria 8019555841 8019560509 72
442 iso_pu_bacteria 8019565922 8019570605 72
443 iso_pu_bacteria 8019648815 8019651009 72
444 iso_pu_bacteria 8057101203 8057104598 72

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05101

VirB3

Type IV secretory pathway, VirB3-like protein

14

90

0.88

Feature Viewer

pLDDT pTM Quality
77.88 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map