F445240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 444 | 305 | 414 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100650978|Ga0070662_1006509782 |
| Length | 93 |
| Sequence | MMGGVEQGGEIAGYTVPVHRALTEPILLGGAPRGLAILNGTLAGAVGLGLRLWLIGXXXWAIGHVVAVWAAKRDPLFVDVVRRHLRIPGHLSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 6 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 9 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 10 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 11 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 12 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 13 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 14 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 15 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 16 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 17 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 18 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 19 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 20 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 21 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 22 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 23 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 24 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 25 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 26 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 27 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 28 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 71 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 72 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 144 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 155 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 156 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 178 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 179 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 182 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 289 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 290 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 292 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 293 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 294 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 297 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 300 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 303 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 304 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 305 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.24 |
| Metatranscriptomes | 0 |
| Isolates | 6.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.18 |
| Nodule | 4.95 |
| Rhizoplane | 2.25 |
| Rhizosphere | 80.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 2 | JGI25160J50197_1047490 | 3300003354 | Bacteria | 934 |
| 3 | Ga0055525_1000035 | 3300003759 | Bacteria | 300887 |
| 4 | Ga0070660_100278708 | 3300005339 | Bacteria | 1368 |
| 5 | Ga0070691_10616818 | 3300005341 | Bacteria | 642 |
| 6 | Ga0070687_101205694 | 3300005343 | Bacteria | 558 |
| 7 | Ga0070675_100460823 | 3300005354 | Bacteria | 1141 |
| 8 | Ga0070674_100162798 | 3300005356 | Bacteria | 1694 |
| 9 | Ga0070674_100548238 | 3300005356 | Bacteria | 970 |
| 10 | Ga0070674_101094931 | 3300005356 | Bacteria | 703 |
| 11 | Ga0070688_101397773 | 3300005365 | Bacteria | 567 |
| 12 | Ga0070659_100339104 | 3300005366 | Bacteria | 1259 |
| 13 | Ga0070709_10001426 | 3300005434 | Bacteria | 12925 |
| 14 | Ga0070709_10002689 | 3300005434 | Bacteria | 9601 |
| 15 | Ga0070709_11566942 | 3300005434 | Bacteria | 536 |
| 16 | Ga0070709_11754270 | 3300005434 | Bacteria | 507 |
| 17 | Ga0070714_100322051 | 3300005435 | Bacteria | 1446 |
| 18 | Ga0070714_100500704 | 3300005435 | Bacteria | 1158 |
| 19 | Ga0070713_100017236 | 3300005436 | Bacteria | 5457 |
| 20 | Ga0070713_100452103 | 3300005436 | Bacteria | 1206 |
| 21 | Ga0070713_100968599 | 3300005436 | Bacteria | 820 |
| 22 | Ga0070710_10001964 | 3300005437 | Bacteria | 9746 |
| 23 | Ga0070710_10003785 | 3300005437 | Bacteria | 7147 |
| 24 | Ga0070710_10159477 | 3300005437 | Bacteria | 1398 |
| 25 | Ga0070710_10231890 | 3300005437 | Bacteria | 1179 |
| 26 | Ga0070711_100011707 | 3300005439 | Bacteria | 5453 |
| 27 | Ga0070711_100031224 | 3300005439 | Bacteria | 3534 |
| 28 | Ga0070711_100230290 | 3300005439 | Bacteria | 1444 |
| 29 | Ga0070711_100255121 | 3300005439 | Bacteria | 1377 |
| 30 | Ga0070711_100626639 | 3300005439 | Bacteria | 899 |
| 31 | Ga0070705_100781034 | 3300005440 | Bacteria | 758 |
| 32 | Ga0070708_101795993 | 3300005445 | Bacteria | 569 |
| 33 | Ga0070678_101062030 | 3300005456 | Bacteria | 746 |
| 34 | Ga0070662_100650978 | 3300005457 | Bacteria | 889 |
| 35 | Ga0070681_10060046 | 3300005458 | Bacteria | 3781 |
| 36 | Ga0070681_10150638 | 3300005458 | Bacteria | 2252 |
| 37 | Ga0070681_10167788 | 3300005458 | Bacteria | 2117 |
| 38 | Ga0070681_10517783 | 3300005458 | Bacteria | 1106 |
| 39 | Ga0070681_10520510 | 3300005458 | Bacteria | 1103 |
| 40 | Ga0068867_100805002 | 3300005459 | Bacteria | 838 |
| 41 | Ga0070706_100055685 | 3300005467 | Bacteria | 3650 |
| 42 | Ga0070706_100566272 | 3300005467 | Bacteria | 1056 |
| 43 | Ga0070706_100987806 | 3300005467 | Bacteria | 776 |
| 44 | Ga0070707_100110266 | 3300005468 | Bacteria | 2669 |
| 45 | Ga0070707_101107979 | 3300005468 | Bacteria | 758 |
| 46 | Ga0070707_101315606 | 3300005468 | Bacteria | 689 |
| 47 | Ga0070698_100311305 | 3300005471 | Bacteria | 1505 |
| 48 | Ga0070698_100409761 | 3300005471 | Bacteria | 1289 |
| 49 | Ga0070699_100691539 | 3300005518 | Bacteria | 932 |
| 50 | Ga0070699_101567201 | 3300005518 | Bacteria | 604 |
| 51 | Ga0070679_100559963 | 3300005530 | Bacteria | 1087 |
| 52 | Ga0070679_101633238 | 3300005530 | Bacteria | 592 |
| 53 | Ga0070684_100357620 | 3300005535 | Bacteria | 1344 |
| 54 | Ga0070697_100725448 | 3300005536 | Bacteria | 878 |
| 55 | Ga0070697_100745063 | 3300005536 | Bacteria | 866 |
| 56 | Ga0070697_101172030 | 3300005536 | Bacteria | 685 |
| 57 | Ga0068853_100002801 | 3300005539 | Bacteria | 13191 |
| 58 | Ga0068853_100010537 | 3300005539 | Bacteria | 7475 |
| 59 | Ga0070665_101049202 | 3300005548 | Bacteria | 827 |
| 60 | Ga0068855_102617427 | 3300005563 | Bacteria | 500 |
| 61 | Ga0068857_100010210 | 3300005577 | Bacteria | 8164 |
| 62 | Ga0068852_100128879 | 3300005616 | Bacteria | 2327 |
| 63 | Ga0068861_102689332 | 3300005719 | Bacteria | 502 |
| 64 | Ga0068862_100075141 | 3300005844 | Bacteria | 2922 |
| 65 | Ga0081455_10400491 | 3300005937 | Bacteria | 952 |
| 66 | Ga0081540_1021917 | 3300005983 | Bacteria | 3785 |
| 67 | Ga0081540_1026680 | 3300005983 | Bacteria | 3290 |
| 68 | Ga0081540_1237099 | 3300005983 | Bacteria | 641 |
| 69 | Ga0070717_10254414 | 3300006028 | Bacteria | 1552 |
| 70 | Ga0070717_10665079 | 3300006028 | Bacteria | 946 |
| 71 | Ga0070715_10119456 | 3300006163 | Bacteria | 1255 |
| 72 | Ga0070715_10415880 | 3300006163 | Bacteria | 751 |
| 73 | Ga0070716_100092006 | 3300006173 | Bacteria | 1838 |
| 74 | Ga0070716_100477390 | 3300006173 | Bacteria | 915 |
| 75 | Ga0070712_100077132 | 3300006175 | Bacteria | 2401 |
| 76 | Ga0070712_100112975 | 3300006175 | Bacteria | 2030 |
| 77 | Ga0070712_101801714 | 3300006175 | Bacteria | 536 |
| 78 | Ga0075367_10495985 | 3300006178 | Bacteria | 774 |
| 79 | Ga0097621_100885160 | 3300006237 | Bacteria | 831 |
| 80 | Ga0068865_101137370 | 3300006881 | Bacteria | 689 |
| 81 | Ga0099825_1032259 | 3300006941 | Bacteria | 2141 |
| 82 | Ga0099824_1005593 | 3300006942 | Bacteria | 17633 |
| 83 | Ga0079104_1074915 | 3300006946 | Bacteria | 704 |
| 84 | Ga0099794_10000295 | 3300007265 | Bacteria | 17188 |
| 85 | Ga0099795_10001530 | 3300007788 | Bacteria | 5064 |
| 86 | Ga0099795_10002423 | 3300007788 | Bacteria | 4387 |
| 87 | Ga0099795_10055790 | 3300007788 | Bacteria | 1451 |
| 88 | Ga0105240_10179268 | 3300009093 | Bacteria | 2502 |
| 89 | Ga0105240_10930590 | 3300009093 | Bacteria | 933 |
| 90 | Ga0105240_12249293 | 3300009093 | Bacteria | 565 |
| 91 | Ga0105240_12567866 | 3300009093 | Bacteria | 526 |
| 92 | Ga0105243_10350868 | 3300009148 | Bacteria | 1355 |
| 93 | Ga0105243_10621924 | 3300009148 | Bacteria | 1043 |
| 94 | Ga0105242_10443946 | 3300009176 | Bacteria | 1221 |
| 95 | Ga0105242_10728123 | 3300009176 | Bacteria | 974 |
| 96 | Ga0105237_10055611 | 3300009545 | Bacteria | 3963 |
| 97 | Ga0105237_10310566 | 3300009545 | Bacteria | 1580 |
| 98 | Ga0105238_10009276 | 3300009551 | Bacteria | 9848 |
| 99 | Ga0105249_10170282 | 3300009553 | Bacteria | 2111 |
| 100 | Ga0099796_10017044 | 3300010159 | Bacteria | 2156 |
| 101 | Ga0099796_10050250 | 3300010159 | Bacteria | 1445 |
| 102 | Ga0105239_10979850 | 3300010375 | Bacteria | 972 |
| 103 | Ga0105239_13095335 | 3300010375 | Bacteria | 542 |
| 104 | Ga0157373_10840761 | 3300013100 | Bacteria | 679 |
| 105 | Ga0157371_10040556 | 3300013102 | Bacteria | 3324 |
| 106 | Ga0157370_10006168 | 3300013104 | Bacteria | 13298 |
| 107 | Ga0157369_10007094 | 3300013105 | Bacteria | 12922 |
| 108 | Ga0157372_10002242 | 3300013307 | Bacteria | 20986 |
| 109 | Ga0157372_11518971 | 3300013307 | Bacteria | 771 |
| 110 | Ga0157372_12086697 | 3300013307 | Bacteria | 651 |
| 111 | Ga0157379_10658528 | 3300014968 | Bacteria | 981 |
| 112 | Ga0157376_11587315 | 3300014969 | Bacteria | 688 |
| 113 | Ga0157376_12091764 | 3300014969 | Bacteria | 604 |
| 114 | Ga0163161_10535394 | 3300017792 | Bacteria | 958 |
| 115 | Ga0213873_10222946 | 3300021358 | Bacteria | 591 |
| 116 | Ga0213872_10182762 | 3300021361 | Bacteria | 905 |
| 117 | Ga0213876_10000534 | 3300021384 | Bacteria | 28772 |
| 118 | Ga0213875_10204200 | 3300021388 | Bacteria | 930 |
| 119 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 120 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 121 | Ga0209130_1002111 | 3300025284 | Bacteria | 10598 |
| 122 | Ga0209676_1036019 | 3300025292 | Bacteria | 1445 |
| 123 | Ga0207426_1000361 | 3300025302 | Bacteria | 81889 |
| 124 | Ga0207692_10057618 | 3300025898 | Bacteria | 1999 |
| 125 | Ga0207692_10058373 | 3300025898 | Bacteria | 1988 |
| 126 | Ga0207692_10163859 | 3300025898 | Bacteria | 1283 |
| 127 | Ga0207692_10181730 | 3300025898 | Bacteria | 1226 |
| 128 | Ga0207642_10641876 | 3300025899 | Bacteria | 664 |
| 129 | Ga0207647_10217666 | 3300025904 | Bacteria | 1101 |
| 130 | Ga0207685_10048081 | 3300025905 | Bacteria | 1632 |
| 131 | Ga0207685_10210665 | 3300025905 | Bacteria | 919 |
| 132 | Ga0207685_10330905 | 3300025905 | Bacteria | 762 |
| 133 | Ga0207699_10002420 | 3300025906 | Bacteria | 8817 |
| 134 | Ga0207699_10010115 | 3300025906 | Bacteria | 4721 |
| 135 | Ga0207699_10225831 | 3300025906 | Bacteria | 1280 |
| 136 | Ga0207699_10909434 | 3300025906 | Bacteria | 649 |
| 137 | Ga0207699_11452165 | 3300025906 | Bacteria | 507 |
| 138 | Ga0207684_10112062 | 3300025910 | Bacteria | 2335 |
| 139 | Ga0207684_10428968 | 3300025910 | Bacteria | 1135 |
| 140 | Ga0207654_11432667 | 3300025911 | Bacteria | 504 |
| 141 | Ga0207707_10215222 | 3300025912 | Bacteria | 1673 |
| 142 | Ga0207707_10419318 | 3300025912 | Bacteria | 1148 |
| 143 | Ga0207707_11044121 | 3300025912 | Bacteria | 668 |
| 144 | Ga0207707_11646980 | 3300025912 | Bacteria | 504 |
| 145 | Ga0207695_10286417 | 3300025913 | Bacteria | 1540 |
| 146 | Ga0207695_10408291 | 3300025913 | Bacteria | 1242 |
| 147 | Ga0207671_10097099 | 3300025914 | Bacteria | 2227 |
| 148 | Ga0207693_10018518 | 3300025915 | Bacteria | 5545 |
| 149 | Ga0207693_10024050 | 3300025915 | Bacteria | 4836 |
| 150 | Ga0207693_10093939 | 3300025915 | Bacteria | 2351 |
| 151 | Ga0207693_10380136 | 3300025915 | Bacteria | 1104 |
| 152 | Ga0207693_10404329 | 3300025915 | Bacteria | 1067 |
| 153 | Ga0207663_10003384 | 3300025916 | Bacteria | 7794 |
| 154 | Ga0207663_10011370 | 3300025916 | Bacteria | 4778 |
| 155 | Ga0207663_10320022 | 3300025916 | Bacteria | 1165 |
| 156 | Ga0207663_10602671 | 3300025916 | Bacteria | 863 |
| 157 | Ga0207663_10878480 | 3300025916 | Bacteria | 716 |
| 158 | Ga0207660_10176028 | 3300025917 | Bacteria | 1659 |
| 159 | Ga0207657_10193338 | 3300025919 | Bacteria | 1640 |
| 160 | Ga0207652_11825515 | 3300025921 | Bacteria | 513 |
| 161 | Ga0207646_10247230 | 3300025922 | Bacteria | 1611 |
| 162 | Ga0207681_11872138 | 3300025923 | Bacteria | 500 |
| 163 | Ga0207694_10002066 | 3300025924 | Bacteria | 16586 |
| 164 | Ga0207659_10436854 | 3300025926 | Bacteria | 1100 |
| 165 | Ga0207700_10167881 | 3300025928 | Bacteria | 1828 |
| 166 | Ga0207700_10450436 | 3300025928 | Bacteria | 1134 |
| 167 | Ga0207700_11723939 | 3300025928 | Bacteria | 552 |
| 168 | Ga0207664_11888156 | 3300025929 | Bacteria | 520 |
| 169 | Ga0207690_10949658 | 3300025932 | Bacteria | 714 |
| 170 | Ga0207706_10461751 | 3300025933 | Bacteria | 1098 |
| 171 | Ga0207686_10790732 | 3300025934 | Bacteria | 760 |
| 172 | Ga0207669_11316468 | 3300025937 | Bacteria | 614 |
| 173 | Ga0207669_11694391 | 3300025937 | Bacteria | 540 |
| 174 | Ga0207665_10056031 | 3300025939 | Bacteria | 2661 |
| 175 | Ga0207665_10228123 | 3300025939 | Bacteria | 1368 |
| 176 | Ga0207665_10384812 | 3300025939 | Bacteria | 1065 |
| 177 | Ga0207712_10738108 | 3300025961 | Bacteria | 862 |
| 178 | Ga0207639_10005959 | 3300026041 | Bacteria | 8269 |
| 179 | Ga0207639_10008392 | 3300026041 | Bacteria | 7082 |
| 180 | Ga0207678_10530227 | 3300026067 | Bacteria | 1028 |
| 181 | Ga0207641_10046520 | 3300026088 | Bacteria | 3658 |
| 182 | Ga0207641_11870338 | 3300026088 | Bacteria | 602 |
| 183 | Ga0207648_10748913 | 3300026089 | Bacteria | 907 |
| 184 | Ga0207674_10008186 | 3300026116 | Bacteria | 12120 |
| 185 | Ga0207674_11060902 | 3300026116 | Bacteria | 779 |
| 186 | Ga0207675_101904295 | 3300026118 | Bacteria | 613 |
| 187 | Ga0207683_10270472 | 3300026121 | Bacteria | 1552 |
| 188 | Ga0207698_10040518 | 3300026142 | Bacteria | 3462 |
| 189 | Ga0209588_1006494 | 3300027671 | Bacteria | 3401 |
| 190 | Ga0268266_11049852 | 3300028379 | Bacteria | 788 |
| 191 | Ga0268265_10006671 | 3300028380 | Bacteria | 7813 |
| 192 | Ga0265337_1001390 | 3300028556 | Bacteria | 11879 |
| 193 | Ga0265326_10000352 | 3300028558 | Bacteria | 19508 |
| 194 | Ga0265319_1001943 | 3300028563 | Bacteria | 11708 |
| 195 | Ga0265334_10002049 | 3300028573 | Bacteria | 9536 |
| 196 | Ga0265318_10002935 | 3300028577 | Bacteria | 8848 |
| 197 | Ga0265318_10103289 | 3300028577 | Bacteria | 1048 |
| 198 | Ga0265323_10000035 | 3300028653 | Bacteria | 72657 |
| 199 | Ga0265323_10054828 | 3300028653 | Bacteria | 1403 |
| 200 | Ga0265322_10012111 | 3300028654 | Bacteria | 2494 |
| 201 | Ga0265336_10000201 | 3300028666 | Bacteria | 41891 |
| 202 | Ga0265336_10003340 | 3300028666 | Bacteria | 6307 |
| 203 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 204 | Ga0265338_10000572 | 3300028800 | Bacteria | 64902 |
| 205 | Ga0265324_10000236 | 3300029957 | Bacteria | 41791 |
| 206 | Ga0265331_10082856 | 3300031250 | Bacteria | 1488 |
| 207 | Ga0265331_10479326 | 3300031250 | Bacteria | 559 |
| 208 | Ga0307509_10225680 | 3300031507 | Bacteria | 1681 |
| 209 | Ga0307509_10803579 | 3300031507 | Bacteria | 605 |
| 210 | Ga0307508_10364515 | 3300031616 | Bacteria | 1036 |
| 211 | Ga0265314_10030774 | 3300031711 | Bacteria | 3970 |
| 212 | Ga0307412_10121014 | 3300031911 | Bacteria | 1884 |
| 213 | Ga0307412_10194907 | 3300031911 | Bacteria | 1534 |
| 214 | Ga0307414_10000674 | 3300032004 | Bacteria | 17500 |
| 215 | Ga0307510_10330479 | 3300033180 | Bacteria | 979 |
| 216 | Ga0373926_0206527 | 3300035083 | Bacteria | 757 |
| 217 | Ga0373936_0341722 | 3300035113 | Bacteria | 681 |
| 218 | Ga0373945_0354032 | 3300035116 | Bacteria | 637 |
| 219 | Ga0373953_0235917 | 3300035117 | Bacteria | 793 |
| 220 | Ga0373954_0045138 | 3300035118 | Bacteria | 2058 |
| 221 | Ga0373943_0646650 | 3300035170 | Bacteria | 625 |
| 222 | Ga0373943_0699161 | 3300035170 | Bacteria | 601 |
| 223 | Ga0373955_0081338 | 3300035172 | Bacteria | 1831 |
| 224 | Ga0373935_0198676 | 3300035692 | Bacteria | 1385 |
| 225 | Ga0373935_0339656 | 3300035692 | Bacteria | 1069 |
| 226 | Ga0373935_0474751 | 3300035692 | Bacteria | 906 |
| 227 | Ga0373927_0103707 | 3300035695 | Bacteria | 1851 |
| 228 | Ga0373927_0337067 | 3300035695 | Bacteria | 993 |
| 229 | Ga0373933_0017339 | 3300035724 | Bacteria | 4040 |
| 230 | Ga0373947_0367230 | 3300035725 | Bacteria | 967 |
| 231 | Ga0373937_0004074 | 3300036401 | Bacteria | 12396 |
| 232 | Ga0373925_0103874 | 3300037068 | Bacteria | 2188 |
| 233 | Ga0373925_0123792 | 3300037068 | Bacteria | 2010 |
| 234 | Ga0373925_1161781 | 3300037068 | Bacteria | 635 |
| 235 | Ga0395900_0876903 | 3300037418 | Bacteria | 822 |
| 236 | Ga0395898_0077544 | 3300037466 | Bacteria | 3208 |
| 237 | Ga0395905_0053150 | 3300037471 | Bacteria | 3792 |
| 238 | Ga0436364_0304108 | 3300037853 | Bacteria | 697 |
| 239 | Ga0395901_1855334 | 3300038443 | Bacteria | 551 |
| 240 | Ga0436365_0316876 | 3300039437 | Bacteria | 563 |
| 241 | Ga0436365_0915242 | 3300039437 | Bacteria | 771 |
| 242 | Ga0436365_1262966 | 3300039437 | Bacteria | 2109 |
| 243 | Ga0436365_1869782 | 3300039437 | Bacteria | 4722 |
| 244 | Ga0436360_0575863 | 3300039438 | Bacteria | 1857 |
| 245 | Ga0436360_1302090 | 3300039438 | Bacteria | 712 |
| 246 | Ga0436361_0293023 | 3300039447 | Bacteria | 1770 |
| 247 | Ga0436361_0563642 | 3300039447 | Bacteria | 703 |
| 248 | Ga0436361_1006063 | 3300039447 | Bacteria | 540 |
| 249 | Ga0436363_0114580 | 3300039450 | Bacteria | 1821 |
| 250 | Ga0436363_0902215 | 3300039450 | Bacteria | 969 |
| 251 | Ga0436363_1459244 | 3300039450 | Bacteria | 1716 |
| 252 | Ga0436362_0988361 | 3300039453 | Bacteria | 792 |
| 253 | Ga0436362_1280182 | 3300039453 | Bacteria | 975 |
| 254 | Ga0451787_461119 | 3300041441 | Bacteria | 1253 |
| 255 | Ga0466972_0603843 | 3300044658 | Bacteria | 519 |
| 256 | Ga0466964_0352829 | 3300044706 | Bacteria | 756 |
| 257 | Ga0466968_0090820 | 3300044735 | Bacteria | 1353 |
| 258 | Ga0466970_0472219 | 3300044765 | Bacteria | 720 |
| 259 | Ga0466970_0618769 | 3300044765 | Bacteria | 629 |
| 260 | Ga0466959_0217180 | 3300045049 | Bacteria | 1327 |
| 261 | Ga0451576_0241726 | 3300045051 | Bacteria | 1886 |
| 262 | Ga0451576_2729755 | 3300045051 | Bacteria | 502 |
| 263 | Ga0466958_0001512 | 3300045836 | Bacteria | 11127 |
| 264 | Ga0466967_0004334 | 3300045976 | Bacteria | 9545 |
| 265 | Ga0495617_033917 | 3300046452 | Bacteria | 1713 |
| 266 | Ga0495592_0400340 | 3300046454 | Bacteria | 870 |
| 267 | Ga0495592_0914155 | 3300046454 | Bacteria | 515 |
| 268 | Ga0495603_0046741 | 3300046455 | Bacteria | 2578 |
| 269 | Ga0495603_0657503 | 3300046455 | Bacteria | 600 |
| 270 | Ga0495590_0031614 | 3300046457 | Bacteria | 1853 |
| 271 | Ga0495629_0132812 | 3300046459 | Bacteria | 1734 |
| 272 | Ga0495638_0045651 | 3300046460 | Bacteria | 2755 |
| 273 | Ga0495651_0008937 | 3300046462 | Bacteria | 7692 |
| 274 | Ga0495653_0358879 | 3300046463 | Bacteria | 935 |
| 275 | Ga0495650_0002433 | 3300046471 | Bacteria | 15084 |
| 276 | Ga0495650_0163374 | 3300046471 | Bacteria | 792 |
| 277 | Ga0495580_0167046 | 3300046472 | Bacteria | 1522 |
| 278 | Ga0495580_0834437 | 3300046472 | Bacteria | 596 |
| 279 | Ga0495582_0815034 | 3300046473 | Bacteria | 540 |
| 280 | Ga0495639_0078437 | 3300046475 | Bacteria | 1535 |
| 281 | Ga0495639_0553121 | 3300046475 | Bacteria | 590 |
| 282 | Ga0495639_0644700 | 3300046475 | Bacteria | 546 |
| 283 | Ga0495584_0060590 | 3300046491 | Bacteria | 1903 |
| 284 | Ga0495585_0311143 | 3300046492 | Bacteria | 772 |
| 285 | Ga0495585_0593347 | 3300046492 | Bacteria | 521 |
| 286 | Ga0495594_0113906 | 3300046499 | Bacteria | 1526 |
| 287 | Ga0495596_0000171 | 3300046500 | Bacteria | 45024 |
| 288 | Ga0495607_0229720 | 3300046501 | Bacteria | 903 |
| 289 | Ga0495583_0376312 | 3300046506 | Bacteria | 559 |
| 290 | Ga0495606_0243565 | 3300046507 | Bacteria | 1001 |
| 291 | Ga0495608_0014258 | 3300046511 | Bacteria | 5515 |
| 292 | Ga0495618_0129657 | 3300046514 | Bacteria | 1614 |
| 293 | Ga0495620_0002150 | 3300046515 | Bacteria | 11452 |
| 294 | Ga0495628_1049962 | 3300046516 | Bacteria | 558 |
| 295 | Ga0495631_0030236 | 3300046518 | Bacteria | 2458 |
| 296 | Ga0495632_0029051 | 3300046519 | Bacteria | 2882 |
| 297 | Ga0495643_0001609 | 3300046522 | Bacteria | 19996 |
| 298 | Ga0495652_0003657 | 3300046529 | Bacteria | 15059 |
| 299 | Ga0495665_0461368 | 3300046531 | Bacteria | 642 |
| 300 | Ga0495640_0595416 | 3300046533 | Bacteria | 668 |
| 301 | Ga0495587_0007784 | 3300046536 | Bacteria | 6922 |
| 302 | Ga0495645_0526977 | 3300046543 | Bacteria | 735 |
| 303 | Ga0495622_0235910 | 3300046557 | Bacteria | 807 |
| 304 | Ga0495633_0295914 | 3300046558 | Bacteria | 735 |
| 305 | Ga0495667_0000267 | 3300046559 | Bacteria | 33933 |
| 306 | Ga0495656_0141751 | 3300046615 | Bacteria | 1153 |
| 307 | Ga0495668_0004073 | 3300046616 | Bacteria | 10601 |
| 308 | Ga0495634_0291459 | 3300046642 | Bacteria | 989 |
| 309 | Ga0495634_0301141 | 3300046642 | Bacteria | 969 |
| 310 | Ga0495634_0532167 | 3300046642 | Bacteria | 687 |
| 311 | Ga0495611_0167478 | 3300046648 | Bacteria | 1027 |
| 312 | Ga0495625_0019072 | 3300046660 | Bacteria | 5336 |
| 313 | Ga0495635_0036018 | 3300046663 | Bacteria | 3431 |
| 314 | Ga0495588_0028119 | 3300046674 | Bacteria | 2813 |
| 315 | Ga0495588_0653536 | 3300046674 | Bacteria | 550 |
| 316 | Ga0495657_0004443 | 3300046675 | Bacteria | 11202 |
| 317 | Ga0495623_0000216 | 3300046679 | Bacteria | 36827 |
| 318 | Ga0495646_0238781 | 3300046680 | Bacteria | 977 |
| 319 | Ga0495658_0317811 | 3300046683 | Bacteria | 987 |
| 320 | Ga0495669_0144653 | 3300046684 | Bacteria | 1123 |
| 321 | Ga0495624_0799088 | 3300046690 | Bacteria | 558 |
| 322 | Ga0495670_0512332 | 3300046691 | Bacteria | 652 |
| 323 | Ga0495589_0031147 | 3300046794 | Bacteria | 2686 |
| 324 | Ga0495600_0002526 | 3300046809 | Bacteria | 10525 |
| 325 | Ga0495581_0024103 | 3300047315 | Bacteria | 3526 |
| 326 | Ga0495604_0001204 | 3300047317 | Bacteria | 21379 |
| 327 | Ga0495674_0274038 | 3300047319 | Bacteria | 1384 |
| 328 | Ga0495676_0343174 | 3300047321 | Bacteria | 999 |
| 329 | Ga0495680_0003008 | 3300047322 | Bacteria | 16811 |
| 330 | Ga0495683_0121306 | 3300047323 | Bacteria | 1240 |
| 331 | Ga0495683_0225824 | 3300047323 | Bacteria | 833 |
| 332 | Ga0495675_0000122 | 3300047444 | Bacteria | 56354 |
| 333 | Ga0495677_0133559 | 3300047445 | Bacteria | 951 |
| 334 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 335 | Ga0495681_0000209 | 3300047470 | Bacteria | 48667 |
| 336 | Ga0495684_0034950 | 3300047471 | Bacteria | 3856 |
| 337 | Ga0495593_0059077 | 3300047673 | Bacteria | 2010 |
| 338 | Ga0495593_0493523 | 3300047673 | Bacteria | 614 |
| 339 | Ga0495602_0003180 | 3300048088 | Bacteria | 16937 |
| 340 | Ga0495614_0331781 | 3300048089 | Bacteria | 707 |
| 341 | Ga0496100_0318275 | 3300048903 | Bacteria | 1168 |
| 342 | Ga0496100_0333774 | 3300048903 | Bacteria | 1142 |
| 343 | Ga0496100_0785286 | 3300048903 | Bacteria | 746 |
| 344 | Ga0496101_0459547 | 3300048904 | Bacteria | 1005 |
| 345 | Ga0496102_0526188 | 3300048905 | Bacteria | 1105 |
| 346 | Ga0496102_1207941 | 3300048905 | Bacteria | 676 |
| 347 | Ga0496106_1249646 | 3300048909 | Bacteria | 578 |
| 348 | Ga0496109_1117893 | 3300048912 | Bacteria | 725 |
| 349 | Ga0496113_1053730 | 3300048916 | Bacteria | 639 |
| 350 | Ga0496118_0042470 | 3300048921 | Bacteria | 3586 |
| 351 | Ga0496120_0000502 | 3300048923 | Bacteria | 61039 |
| 352 | Ga0496121_0293484 | 3300048924 | Bacteria | 1106 |
| 353 | Ga0496125_0351243 | 3300048928 | Bacteria | 881 |
| 354 | Ga0496126_0029620 | 3300048929 | Bacteria | 5199 |
| 355 | Ga0496126_0189323 | 3300048929 | Bacteria | 1744 |
| 356 | Ga0496126_0208371 | 3300048929 | Bacteria | 1647 |
| 357 | Ga0496126_0429596 | 3300048929 | Bacteria | 1066 |
| 358 | Ga0496126_0934745 | 3300048929 | Bacteria | 655 |
| 359 | Ga0495682_0015256 | 3300049460 | Bacteria | 2912 |
| 360 | Ga0495682_0125617 | 3300049460 | Bacteria | 918 |
| 361 | Ga0495682_0294804 | 3300049460 | Bacteria | 572 |
| 362 | Ga0501290_078485 | 3300049513 | Bacteria | 559 |
| 363 | Ga0501032_0032722 | 3300049569 | Bacteria | 3563 |
| 364 | Ga0501033_0000180 | 3300049570 | Bacteria | 60526 |
| 365 | Ga0501033_0003190 | 3300049570 | Bacteria | 13598 |
| 366 | Ga0501033_0991766 | 3300049570 | Bacteria | 562 |
| 367 | Ga0501034_0661017 | 3300049571 | Bacteria | 946 |
| 368 | Ga0501034_0687909 | 3300049571 | Bacteria | 922 |
| 369 | Ga0501037_0161167 | 3300049573 | Bacteria | 1599 |
| 370 | Ga0501037_0590158 | 3300049573 | Bacteria | 747 |
| 371 | Ga0501038_0002115 | 3300049574 | Bacteria | 18425 |
| 372 | Ga0501042_1266550 | 3300049578 | Bacteria | 538 |
| 373 | Ga0501043_0177935 | 3300049579 | Bacteria | 1658 |
| 374 | Ga0501043_0822508 | 3300049579 | Bacteria | 671 |
| 375 | Ga0501046_0112933 | 3300049580 | Bacteria | 2074 |
| 376 | Ga0501047_0071547 | 3300049581 | Bacteria | 3338 |
| 377 | Ga0501047_0165274 | 3300049581 | Bacteria | 2083 |
| 378 | Ga0501047_0363183 | 3300049581 | Bacteria | 1283 |
| 379 | Ga0501069_0166902 | 3300049585 | Bacteria | 1269 |
| 380 | Ga0501070_0152269 | 3300049586 | Bacteria | 1908 |
| 381 | Ga0501074_0357371 | 3300049590 | Bacteria | 1037 |
| 382 | Ga0501249_000034 | 3300049679 | Bacteria | 72400 |
| 383 | Ga0501259_110781 | 3300049688 | Bacteria | 641 |
| 384 | Ga0501080_0267743 | 3300049742 | Bacteria | 1556 |
| 385 | Ga0501080_0279622 | 3300049742 | Bacteria | 1518 |
| 386 | Ga0501081_1287536 | 3300049743 | Bacteria | 554 |
| 387 | Ga0501083_0450065 | 3300049744 | Bacteria | 838 |
| 388 | Ga0501035_0002894 | 3300049822 | Bacteria | 16541 |
| 389 | Ga0501035_0558131 | 3300049822 | Bacteria | 937 |
| 390 | Ga0501044_0000058 | 3300049823 | Bacteria | 135713 |
| 391 | Ga0501044_0007189 | 3300049823 | Bacteria | 12241 |
| 392 | Ga0501044_0079435 | 3300049823 | Bacteria | 3324 |
| 393 | Ga0501044_0319226 | 3300049823 | Bacteria | 1478 |
| 394 | Ga0501044_0417647 | 3300049823 | Bacteria | 1252 |
| 395 | Ga0501044_0823473 | 3300049823 | Bacteria | 806 |
| 396 | Ga0501204_000529 | 3300049850 | Bacteria | 3318 |
| 397 | nmdc:mga06z11_445514_c1 | 3300050494 | Bacteria | 782 |
| 398 | Ga0495601_0488927 | 3300053077 | Bacteria | 795 |
| 399 | Ga0495595_0116431 | 3300053084 | Bacteria | 1299 |
| 400 | Ga0495619_0004043 | 3300053085 | Bacteria | 9395 |
| 401 | Ga0500578_0331662 | 3300053086 | Bacteria | 894 |
| 402 | Ga0500583_0418219 | 3300053092 | Bacteria | 641 |
| 403 | Ga0500566_0345271 | 3300053094 | Bacteria | 684 |
| 404 | Ga0500562_037185 | 3300053108 | Bacteria | 1292 |
| 405 | Ga0500595_024977 | 3300053119 | Bacteria | 2079 |
| 406 | Ga0500608_000742 | 3300053122 | Bacteria | 11917 |
| 407 | Ga0500658_0002194 | 3300053134 | Bacteria | 7582 |
| 408 | Ga0500568_0168791 | 3300053139 | Bacteria | 806 |
| 409 | Ga0500589_108304 | 3300053147 | Bacteria | 1196 |
| 410 | Ga0500603_079608 | 3300053150 | Bacteria | 947 |
| 411 | Ga0500616_0000170 | 3300053153 | Bacteria | 108126 |
| 412 | Ga0500639_088136 | 3300053163 | Bacteria | 1551 |
| 413 | Ga0500636_0290265 | 3300053177 | Bacteria | 811 |
| 414 | Ga0501082_1210324 | 3300060353 | Bacteria | 660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0163374 | Ga0495650_0163374_532_762 | 65 |
| 2 | 3300053139 | Ga0500568_0168791 | Ga0500568_0168791_12_242 | 65 |
| 3 | 3300047469 | Ga0495673_0000025 | Ga0495673_0000025_130660_130929 | 67 |
| 4 | 3300048921 | Ga0496118_0042470 | Ga0496118_0042470_524_760 | 67 |
| 5 | 3300048928 | Ga0496125_0351243 | Ga0496125_0351243_624_860 | 67 |
| 6 | iso_pu_bacteria | 2824732956 | 2824734173 | 68 |
| 7 | iso_pu_bacteria | 2885374607 | 2885382053 | 68 |
| 8 | 3300005983 | Ga0081540_1021917 | Ga0081540_10219174 | 69 |
| 9 | 3300041441 | Ga0451787_461119 | Ga0451787_461119_481_729 | 69 |
| 10 | 3300049579 | Ga0501043_0177935 | Ga0501043_0177935_1303_1575 | 69 |
| 11 | 3300049581 | Ga0501047_0165274 | Ga0501047_0165274_96_368 | 69 |
| 12 | 3300049823 | Ga0501044_0823473 | Ga0501044_0823473_372_644 | 69 |
| 13 | 3300053092 | Ga0500583_0418219 | Ga0500583_0418219_187_441 | 69 |
| 14 | 3300053122 | Ga0500608_000742 | Ga0500608_000742_2048_2320 | 69 |
| 15 | iso_pu_bacteria | 2508501009 | 2508540353 | 69 |
| 16 | 3300049571 | Ga0501034_0687909 | Ga0501034_0687909_246_515 | 70 |
| 17 | 3300049585 | Ga0501069_0166902 | Ga0501069_0166902_715_984 | 70 |
| 18 | 3300049586 | Ga0501070_0152269 | Ga0501070_0152269_545_814 | 70 |
| 19 | 3300049823 | Ga0501044_0007189 | Ga0501044_0007189_7243_7512 | 70 |
| 20 | 3300060353 | Ga0501082_1210324 | Ga0501082_1210324_21_290 | 70 |
| 21 | 3300005459 | Ga0068867_100805002 | Ga0068867_1008050021 | 71 |
| 22 | 3300005539 | Ga0068853_100010537 | Ga0068853_1000105372 | 71 |
| 23 | 3300005548 | Ga0070665_101049202 | Ga0070665_1010492022 | 71 |
| 24 | 3300005844 | Ga0068862_100075141 | Ga0068862_1000751414 | 71 |
| 25 | 3300009545 | Ga0105237_10055611 | Ga0105237_100556112 | 71 |
| 26 | 3300009553 | Ga0105249_10170282 | Ga0105249_101702822 | 71 |
| 27 | 3300025914 | Ga0207671_10097099 | Ga0207671_100970992 | 71 |
| 28 | 3300026041 | Ga0207639_10008392 | Ga0207639_100083922 | 71 |
| 29 | 3300026067 | Ga0207678_10530227 | Ga0207678_105302273 | 71 |
| 30 | 3300026088 | Ga0207641_11870338 | Ga0207641_118703382 | 71 |
| 31 | 3300026089 | Ga0207648_10748913 | Ga0207648_107489132 | 71 |
| 32 | 3300028379 | Ga0268266_11049852 | Ga0268266_110498522 | 71 |
| 33 | 3300028380 | Ga0268265_10006671 | Ga0268265_100066717 | 71 |
| 34 | 3300031507 | Ga0307509_10803579 | Ga0307509_108035792 | 71 |
| 35 | 3300033180 | Ga0307510_10330479 | Ga0307510_103304792 | 71 |
| 36 | 3300037853 | Ga0436364_0304108 | Ga0436364_0304108_285_548 | 71 |
| 37 | 3300046454 | Ga0495592_0914155 | Ga0495592_0914155_201_461 | 71 |
| 38 | 3300048903 | Ga0496100_0333774 | Ga0496100_0333774_384_653 | 71 |
| 39 | 3300048904 | Ga0496101_0459547 | Ga0496101_0459547_368_637 | 71 |
| 40 | 3300048916 | Ga0496113_1053730 | Ga0496113_1053730_193_462 | 71 |
| 41 | 3300049570 | Ga0501033_0000180 | Ga0501033_0000180_33647_33916 | 71 |
| 42 | 3300049823 | Ga0501044_0417647 | Ga0501044_0417647_292_561 | 71 |
| 43 | 3300053153 | Ga0500616_0000170 | Ga0500616_0000170_83064_83345 | 71 |
| 44 | 3300003214 | JGI25165J46597_1000006 | JGI25165J46597_1000006127 | 72 |
| 45 | 3300003354 | JGI25160J50197_1047490 | JGI25160J50197_10474902 | 72 |
| 46 | 3300003759 | Ga0055525_1000035 | Ga0055525_100003525 | 72 |
| 47 | 3300005339 | Ga0070660_100278708 | Ga0070660_1002787083 | 72 |
| 48 | 3300005341 | Ga0070691_10616818 | Ga0070691_106168181 | 72 |
| 49 | 3300005343 | Ga0070687_101205694 | Ga0070687_1012056942 | 72 |
| 50 | 3300005354 | Ga0070675_100460823 | Ga0070675_1004608233 | 72 |
| 51 | 3300005356 | Ga0070674_100162798 | Ga0070674_1001627983 | 72 |
| 52 | 3300005356 | Ga0070674_100548238 | Ga0070674_1005482381 | 72 |
| 53 | 3300005356 | Ga0070674_101094931 | Ga0070674_1010949312 | 72 |
| 54 | 3300005365 | Ga0070688_101397773 | Ga0070688_1013977731 | 72 |
| 55 | 3300005366 | Ga0070659_100339104 | Ga0070659_1003391042 | 72 |
| 56 | 3300005434 | Ga0070709_10001426 | Ga0070709_1000142614 | 72 |
| 57 | 3300005434 | Ga0070709_10002689 | Ga0070709_100026893 | 72 |
| 58 | 3300005434 | Ga0070709_11566942 | Ga0070709_115669421 | 72 |
| 59 | 3300005434 | Ga0070709_11754270 | Ga0070709_117542701 | 72 |
| 60 | 3300005435 | Ga0070714_100322051 | Ga0070714_1003220511 | 72 |
| 61 | 3300005435 | Ga0070714_100500704 | Ga0070714_1005007042 | 72 |
| 62 | 3300005436 | Ga0070713_100017236 | Ga0070713_1000172362 | 72 |
| 63 | 3300005436 | Ga0070713_100452103 | Ga0070713_1004521031 | 72 |
| 64 | 3300005436 | Ga0070713_100968599 | Ga0070713_1009685992 | 72 |
| 65 | 3300005437 | Ga0070710_10001964 | Ga0070710_100019649 | 72 |
| 66 | 3300005437 | Ga0070710_10003785 | Ga0070710_100037852 | 72 |
| 67 | 3300005437 | Ga0070710_10159477 | Ga0070710_101594771 | 72 |
| 68 | 3300005437 | Ga0070710_10231890 | Ga0070710_102318902 | 72 |
| 69 | 3300005439 | Ga0070711_100011707 | Ga0070711_1000117074 | 72 |
| 70 | 3300005439 | Ga0070711_100031224 | Ga0070711_1000312242 | 72 |
| 71 | 3300005439 | Ga0070711_100230290 | Ga0070711_1002302903 | 72 |
| 72 | 3300005439 | Ga0070711_100255121 | Ga0070711_1002551212 | 72 |
| 73 | 3300005439 | Ga0070711_100626639 | Ga0070711_1006266391 | 72 |
| 74 | 3300005440 | Ga0070705_100781034 | Ga0070705_1007810342 | 72 |
| 75 | 3300005445 | Ga0070708_101795993 | Ga0070708_1017959932 | 72 |
| 76 | 3300005456 | Ga0070678_101062030 | Ga0070678_1010620301 | 72 |
| 77 | 3300005457 | Ga0070662_100650978 | Ga0070662_1006509782 | 72 |
| 78 | 3300005458 | Ga0070681_10060046 | Ga0070681_100600462 | 72 |
| 79 | 3300005458 | Ga0070681_10150638 | Ga0070681_101506383 | 72 |
| 80 | 3300005458 | Ga0070681_10167788 | Ga0070681_101677883 | 72 |
| 81 | 3300005458 | Ga0070681_10517783 | Ga0070681_105177831 | 72 |
| 82 | 3300005458 | Ga0070681_10520510 | Ga0070681_105205102 | 72 |
| 83 | 3300005467 | Ga0070706_100055685 | Ga0070706_1000556853 | 72 |
| 84 | 3300005467 | Ga0070706_100566272 | Ga0070706_1005662722 | 72 |
| 85 | 3300005467 | Ga0070706_100987806 | Ga0070706_1009878063 | 72 |
| 86 | 3300005468 | Ga0070707_100110266 | Ga0070707_1001102663 | 72 |
| 87 | 3300005468 | Ga0070707_101107979 | Ga0070707_1011079792 | 72 |
| 88 | 3300005468 | Ga0070707_101315606 | Ga0070707_1013156061 | 72 |
| 89 | 3300005471 | Ga0070698_100311305 | Ga0070698_1003113051 | 72 |
| 90 | 3300005471 | Ga0070698_100409761 | Ga0070698_1004097612 | 72 |
| 91 | 3300005518 | Ga0070699_100691539 | Ga0070699_1006915392 | 72 |
| 92 | 3300005518 | Ga0070699_101567201 | Ga0070699_1015672012 | 72 |
| 93 | 3300005530 | Ga0070679_100559963 | Ga0070679_1005599632 | 72 |
| 94 | 3300005530 | Ga0070679_101633238 | Ga0070679_1016332382 | 72 |
| 95 | 3300005535 | Ga0070684_100357620 | Ga0070684_1003576202 | 72 |
| 96 | 3300005536 | Ga0070697_100725448 | Ga0070697_1007254482 | 72 |
| 97 | 3300005536 | Ga0070697_100745063 | Ga0070697_1007450632 | 72 |
| 98 | 3300005536 | Ga0070697_101172030 | Ga0070697_1011720302 | 72 |
| 99 | 3300005539 | Ga0068853_100002801 | Ga0068853_1000028017 | 72 |
| 100 | 3300005563 | Ga0068855_102617427 | Ga0068855_1026174272 | 72 |
| 101 | 3300005577 | Ga0068857_100010210 | Ga0068857_1000102109 | 72 |
| 102 | 3300005616 | Ga0068852_100128879 | Ga0068852_1001288792 | 72 |
| 103 | 3300005719 | Ga0068861_102689332 | Ga0068861_1026893322 | 72 |
| 104 | 3300005937 | Ga0081455_10400491 | Ga0081455_104004913 | 72 |
| 105 | 3300005983 | Ga0081540_1026680 | Ga0081540_10266803 | 72 |
| 106 | 3300005983 | Ga0081540_1237099 | Ga0081540_12370991 | 72 |
| 107 | 3300006028 | Ga0070717_10254414 | Ga0070717_102544142 | 72 |
| 108 | 3300006028 | Ga0070717_10665079 | Ga0070717_106650793 | 72 |
| 109 | 3300006163 | Ga0070715_10119456 | Ga0070715_101194562 | 72 |
| 110 | 3300006163 | Ga0070715_10415880 | Ga0070715_104158801 | 72 |
| 111 | 3300006173 | Ga0070716_100092006 | Ga0070716_1000920063 | 72 |
| 112 | 3300006173 | Ga0070716_100477390 | Ga0070716_1004773902 | 72 |
| 113 | 3300006175 | Ga0070712_100077132 | Ga0070712_1000771324 | 72 |
| 114 | 3300006175 | Ga0070712_100112975 | Ga0070712_1001129752 | 72 |
| 115 | 3300006175 | Ga0070712_101801714 | Ga0070712_1018017141 | 72 |
| 116 | 3300006178 | Ga0075367_10495985 | Ga0075367_104959852 | 72 |
| 117 | 3300006237 | Ga0097621_100885160 | Ga0097621_1008851602 | 72 |
| 118 | 3300006881 | Ga0068865_101137370 | Ga0068865_1011373702 | 72 |
| 119 | 3300006941 | Ga0099825_1032259 | Ga0099825_10322594 | 72 |
| 120 | 3300006942 | Ga0099824_1005593 | Ga0099824_100559316 | 72 |
| 121 | 3300006946 | Ga0079104_1074915 | Ga0079104_10749152 | 72 |
| 122 | 3300007265 | Ga0099794_10000295 | Ga0099794_1000029510 | 72 |
| 123 | 3300007788 | Ga0099795_10001530 | Ga0099795_100015305 | 72 |
| 124 | 3300007788 | Ga0099795_10002423 | Ga0099795_100024233 | 72 |
| 125 | 3300007788 | Ga0099795_10055790 | Ga0099795_100557903 | 72 |
| 126 | 3300009093 | Ga0105240_10179268 | Ga0105240_101792684 | 72 |
| 127 | 3300009093 | Ga0105240_10930590 | Ga0105240_109305902 | 72 |
| 128 | 3300009093 | Ga0105240_12249293 | Ga0105240_122492932 | 72 |
| 129 | 3300009093 | Ga0105240_12567866 | Ga0105240_125678662 | 72 |
| 130 | 3300009148 | Ga0105243_10350868 | Ga0105243_103508683 | 72 |
| 131 | 3300009148 | Ga0105243_10621924 | Ga0105243_106219244 | 72 |
| 132 | 3300009176 | Ga0105242_10443946 | Ga0105242_104439462 | 72 |
| 133 | 3300009176 | Ga0105242_10728123 | Ga0105242_107281232 | 72 |
| 134 | 3300009545 | Ga0105237_10310566 | Ga0105237_103105663 | 72 |
| 135 | 3300009551 | Ga0105238_10009276 | Ga0105238_100092764 | 72 |
| 136 | 3300010159 | Ga0099796_10017044 | Ga0099796_100170442 | 72 |
| 137 | 3300010159 | Ga0099796_10050250 | Ga0099796_100502502 | 72 |
| 138 | 3300010375 | Ga0105239_10979850 | Ga0105239_109798502 | 72 |
| 139 | 3300010375 | Ga0105239_13095335 | Ga0105239_130953351 | 72 |
| 140 | 3300013100 | Ga0157373_10840761 | Ga0157373_108407611 | 72 |
| 141 | 3300013102 | Ga0157371_10040556 | Ga0157371_100405562 | 72 |
| 142 | 3300013104 | Ga0157370_10006168 | Ga0157370_100061687 | 72 |
| 143 | 3300013105 | Ga0157369_10007094 | Ga0157369_100070946 | 72 |
| 144 | 3300013307 | Ga0157372_10002242 | Ga0157372_1000224217 | 72 |
| 145 | 3300013307 | Ga0157372_11518971 | Ga0157372_115189713 | 72 |
| 146 | 3300013307 | Ga0157372_12086697 | Ga0157372_120866972 | 72 |
| 147 | 3300014968 | Ga0157379_10658528 | Ga0157379_106585282 | 72 |
| 148 | 3300014969 | Ga0157376_11587315 | Ga0157376_115873152 | 72 |
| 149 | 3300014969 | Ga0157376_12091764 | Ga0157376_120917642 | 72 |
| 150 | 3300017792 | Ga0163161_10535394 | Ga0163161_105353941 | 72 |
| 151 | 3300021358 | Ga0213873_10222946 | Ga0213873_102229461 | 72 |
| 152 | 3300021361 | Ga0213872_10182762 | Ga0213872_101827622 | 72 |
| 153 | 3300021384 | Ga0213876_10000534 | Ga0213876_1000053420 | 72 |
| 154 | 3300021388 | Ga0213875_10204200 | Ga0213875_102042002 | 72 |
| 155 | 3300025230 | Ga0209563_100047 | Ga0209563_100047325 | 72 |
| 156 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010707 | 72 |
| 157 | 3300025284 | Ga0209130_1002111 | Ga0209130_10021119 | 72 |
| 158 | 3300025292 | Ga0209676_1036019 | Ga0209676_10360192 | 72 |
| 159 | 3300025302 | Ga0207426_1000361 | Ga0207426_100036136 | 72 |
| 160 | 3300025898 | Ga0207692_10057618 | Ga0207692_100576183 | 72 |
| 161 | 3300025898 | Ga0207692_10058373 | Ga0207692_100583733 | 72 |
| 162 | 3300025898 | Ga0207692_10163859 | Ga0207692_101638593 | 72 |
| 163 | 3300025898 | Ga0207692_10181730 | Ga0207692_101817302 | 72 |
| 164 | 3300025899 | Ga0207642_10641876 | Ga0207642_106418762 | 72 |
| 165 | 3300025904 | Ga0207647_10217666 | Ga0207647_102176662 | 72 |
| 166 | 3300025905 | Ga0207685_10048081 | Ga0207685_100480813 | 72 |
| 167 | 3300025905 | Ga0207685_10210665 | Ga0207685_102106652 | 72 |
| 168 | 3300025905 | Ga0207685_10330905 | Ga0207685_103309053 | 72 |
| 169 | 3300025906 | Ga0207699_10002420 | Ga0207699_100024206 | 72 |
| 170 | 3300025906 | Ga0207699_10010115 | Ga0207699_100101152 | 72 |
| 171 | 3300025906 | Ga0207699_10225831 | Ga0207699_102258312 | 72 |
| 172 | 3300025906 | Ga0207699_10909434 | Ga0207699_109094342 | 72 |
| 173 | 3300025906 | Ga0207699_11452165 | Ga0207699_114521651 | 72 |
| 174 | 3300025910 | Ga0207684_10112062 | Ga0207684_101120623 | 72 |
| 175 | 3300025910 | Ga0207684_10428968 | Ga0207684_104289682 | 72 |
| 176 | 3300025911 | Ga0207654_11432667 | Ga0207654_114326671 | 72 |
| 177 | 3300025912 | Ga0207707_10215222 | Ga0207707_102152223 | 72 |
| 178 | 3300025912 | Ga0207707_10419318 | Ga0207707_104193182 | 72 |
| 179 | 3300025912 | Ga0207707_11044121 | Ga0207707_110441212 | 72 |
| 180 | 3300025912 | Ga0207707_11646980 | Ga0207707_116469801 | 72 |
| 181 | 3300025913 | Ga0207695_10286417 | Ga0207695_102864172 | 72 |
| 182 | 3300025913 | Ga0207695_10408291 | Ga0207695_104082912 | 72 |
| 183 | 3300025915 | Ga0207693_10018518 | Ga0207693_100185185 | 72 |
| 184 | 3300025915 | Ga0207693_10024050 | Ga0207693_100240502 | 72 |
| 185 | 3300025915 | Ga0207693_10093939 | Ga0207693_100939392 | 72 |
| 186 | 3300025915 | Ga0207693_10380136 | Ga0207693_103801362 | 72 |
| 187 | 3300025915 | Ga0207693_10404329 | Ga0207693_104043293 | 72 |
| 188 | 3300025916 | Ga0207663_10003384 | Ga0207663_100033848 | 72 |
| 189 | 3300025916 | Ga0207663_10011370 | Ga0207663_100113703 | 72 |
| 190 | 3300025916 | Ga0207663_10320022 | Ga0207663_103200222 | 72 |
| 191 | 3300025916 | Ga0207663_10602671 | Ga0207663_106026712 | 72 |
| 192 | 3300025916 | Ga0207663_10878480 | Ga0207663_108784802 | 72 |
| 193 | 3300025917 | Ga0207660_10176028 | Ga0207660_101760282 | 72 |
| 194 | 3300025919 | Ga0207657_10193338 | Ga0207657_101933383 | 72 |
| 195 | 3300025921 | Ga0207652_11825515 | Ga0207652_118255152 | 72 |
| 196 | 3300025922 | Ga0207646_10247230 | Ga0207646_102472302 | 72 |
| 197 | 3300025923 | Ga0207681_11872138 | Ga0207681_118721382 | 72 |
| 198 | 3300025924 | Ga0207694_10002066 | Ga0207694_1000206612 | 72 |
| 199 | 3300025926 | Ga0207659_10436854 | Ga0207659_104368543 | 72 |
| 200 | 3300025928 | Ga0207700_10167881 | Ga0207700_101678813 | 72 |
| 201 | 3300025928 | Ga0207700_10450436 | Ga0207700_104504362 | 72 |
| 202 | 3300025928 | Ga0207700_11723939 | Ga0207700_117239391 | 72 |
| 203 | 3300025929 | Ga0207664_11888156 | Ga0207664_118881562 | 72 |
| 204 | 3300025932 | Ga0207690_10949658 | Ga0207690_109496582 | 72 |
| 205 | 3300025933 | Ga0207706_10461751 | Ga0207706_104617512 | 72 |
| 206 | 3300025934 | Ga0207686_10790732 | Ga0207686_107907321 | 72 |
| 207 | 3300025937 | Ga0207669_11316468 | Ga0207669_113164681 | 72 |
| 208 | 3300025937 | Ga0207669_11694391 | Ga0207669_116943911 | 72 |
| 209 | 3300025939 | Ga0207665_10056031 | Ga0207665_100560312 | 72 |
| 210 | 3300025939 | Ga0207665_10228123 | Ga0207665_102281232 | 72 |
| 211 | 3300025939 | Ga0207665_10384812 | Ga0207665_103848121 | 72 |
| 212 | 3300025961 | Ga0207712_10738108 | Ga0207712_107381082 | 72 |
| 213 | 3300026041 | Ga0207639_10005959 | Ga0207639_100059597 | 72 |
| 214 | 3300026088 | Ga0207641_10046520 | Ga0207641_100465204 | 72 |
| 215 | 3300026116 | Ga0207674_10008186 | Ga0207674_100081866 | 72 |
| 216 | 3300026116 | Ga0207674_11060902 | Ga0207674_110609022 | 72 |
| 217 | 3300026118 | Ga0207675_101904295 | Ga0207675_1019042952 | 72 |
| 218 | 3300026121 | Ga0207683_10270472 | Ga0207683_102704723 | 72 |
| 219 | 3300026142 | Ga0207698_10040518 | Ga0207698_100405183 | 72 |
| 220 | 3300027671 | Ga0209588_1006494 | Ga0209588_10064944 | 72 |
| 221 | 3300028556 | Ga0265337_1001390 | Ga0265337_10013905 | 72 |
| 222 | 3300028558 | Ga0265326_10000352 | Ga0265326_1000035213 | 72 |
| 223 | 3300028563 | Ga0265319_1001943 | Ga0265319_10019435 | 72 |
| 224 | 3300028573 | Ga0265334_10002049 | Ga0265334_100020495 | 72 |
| 225 | 3300028577 | Ga0265318_10002935 | Ga0265318_100029355 | 72 |
| 226 | 3300028577 | Ga0265318_10103289 | Ga0265318_101032892 | 72 |
| 227 | 3300028653 | Ga0265323_10000035 | Ga0265323_1000003545 | 72 |
| 228 | 3300028653 | Ga0265323_10054828 | Ga0265323_100548283 | 72 |
| 229 | 3300028654 | Ga0265322_10012111 | Ga0265322_100121113 | 72 |
| 230 | 3300028666 | Ga0265336_10000201 | Ga0265336_1000020128 | 72 |
| 231 | 3300028666 | Ga0265336_10003340 | Ga0265336_100033402 | 72 |
| 232 | 3300028800 | Ga0265338_10000018 | Ga0265338_1000001828 | 72 |
| 233 | 3300028800 | Ga0265338_10000572 | Ga0265338_1000057230 | 72 |
| 234 | 3300029957 | Ga0265324_10000236 | Ga0265324_100002368 | 72 |
| 235 | 3300031250 | Ga0265331_10082856 | Ga0265331_100828562 | 72 |
| 236 | 3300031250 | Ga0265331_10479326 | Ga0265331_104793261 | 72 |
| 237 | 3300031507 | Ga0307509_10225680 | Ga0307509_102256802 | 72 |
| 238 | 3300031616 | Ga0307508_10364515 | Ga0307508_103645151 | 72 |
| 239 | 3300031711 | Ga0265314_10030774 | Ga0265314_100307745 | 72 |
| 240 | 3300031911 | Ga0307412_10121014 | Ga0307412_101210142 | 72 |
| 241 | 3300031911 | Ga0307412_10194907 | Ga0307412_101949072 | 72 |
| 242 | 3300032004 | Ga0307414_10000674 | Ga0307414_1000067414 | 72 |
| 243 | 3300035083 | Ga0373926_0206527 | Ga0373926_0206527_42_305 | 72 |
| 244 | 3300035113 | Ga0373936_0341722 | Ga0373936_0341722_387_650 | 72 |
| 245 | 3300035116 | Ga0373945_0354032 | Ga0373945_0354032_83_346 | 72 |
| 246 | 3300035117 | Ga0373953_0235917 | Ga0373953_0235917_476_739 | 72 |
| 247 | 3300035118 | Ga0373954_0045138 | Ga0373954_0045138_636_899 | 72 |
| 248 | 3300035170 | Ga0373943_0646650 | Ga0373943_0646650_42_305 | 72 |
| 249 | 3300035170 | Ga0373943_0699161 | Ga0373943_0699161_314_577 | 72 |
| 250 | 3300035172 | Ga0373955_0081338 | Ga0373955_0081338_1204_1467 | 72 |
| 251 | 3300035692 | Ga0373935_0198676 | Ga0373935_0198676_72_335 | 72 |
| 252 | 3300035692 | Ga0373935_0339656 | Ga0373935_0339656_66_329 | 72 |
| 253 | 3300035692 | Ga0373935_0474751 | Ga0373935_0474751_163_426 | 72 |
| 254 | 3300035695 | Ga0373927_0103707 | Ga0373927_0103707_1044_1307 | 72 |
| 255 | 3300035695 | Ga0373927_0337067 | Ga0373927_0337067_422_685 | 72 |
| 256 | 3300035724 | Ga0373933_0017339 | Ga0373933_0017339_3481_3744 | 72 |
| 257 | 3300035725 | Ga0373947_0367230 | Ga0373947_0367230_351_614 | 72 |
| 258 | 3300036401 | Ga0373937_0004074 | Ga0373937_0004074_10777_11040 | 72 |
| 259 | 3300037068 | Ga0373925_0103874 | Ga0373925_0103874_1681_1944 | 72 |
| 260 | 3300037068 | Ga0373925_0123792 | Ga0373925_0123792_101_364 | 72 |
| 261 | 3300037068 | Ga0373925_1161781 | Ga0373925_1161781_331_594 | 72 |
| 262 | 3300037418 | Ga0395900_0876903 | Ga0395900_0876903_380_643 | 72 |
| 263 | 3300037466 | Ga0395898_0077544 | Ga0395898_0077544_814_1077 | 72 |
| 264 | 3300037471 | Ga0395905_0053150 | Ga0395905_0053150_2058_2330 | 72 |
| 265 | 3300038443 | Ga0395901_1855334 | Ga0395901_1855334_172_435 | 72 |
| 266 | 3300039437 | Ga0436365_0316876 | Ga0436365_0316876_185_448 | 72 |
| 267 | 3300039437 | Ga0436365_0915242 | Ga0436365_0915242_417_680 | 72 |
| 268 | 3300039437 | Ga0436365_1262966 | Ga0436365_1262966_593_856 | 72 |
| 269 | 3300039437 | Ga0436365_1869782 | Ga0436365_1869782_1079_1342 | 72 |
| 270 | 3300039438 | Ga0436360_0575863 | Ga0436360_0575863_138_401 | 72 |
| 271 | 3300039438 | Ga0436360_1302090 | Ga0436360_1302090_328_591 | 72 |
| 272 | 3300039447 | Ga0436361_0293023 | Ga0436361_0293023_934_1197 | 72 |
| 273 | 3300039447 | Ga0436361_0563642 | Ga0436361_0563642_415_678 | 72 |
| 274 | 3300039447 | Ga0436361_1006063 | Ga0436361_1006063_88_351 | 72 |
| 275 | 3300039450 | Ga0436363_0114580 | Ga0436363_0114580_1067_1330 | 72 |
| 276 | 3300039450 | Ga0436363_0902215 | Ga0436363_0902215_47_310 | 72 |
| 277 | 3300039450 | Ga0436363_1459244 | Ga0436363_1459244_999_1262 | 72 |
| 278 | 3300039453 | Ga0436362_0988361 | Ga0436362_0988361_192_455 | 72 |
| 279 | 3300039453 | Ga0436362_1280182 | Ga0436362_1280182_326_589 | 72 |
| 280 | 3300044658 | Ga0466972_0603843 | Ga0466972_0603843_222_494 | 72 |
| 281 | 3300044706 | Ga0466964_0352829 | Ga0466964_0352829_155_418 | 72 |
| 282 | 3300044735 | Ga0466968_0090820 | Ga0466968_0090820_408_671 | 72 |
| 283 | 3300044765 | Ga0466970_0472219 | Ga0466970_0472219_421_684 | 72 |
| 284 | 3300044765 | Ga0466970_0618769 | Ga0466970_0618769_28_294 | 72 |
| 285 | 3300045049 | Ga0466959_0217180 | Ga0466959_0217180_325_588 | 72 |
| 286 | 3300045051 | Ga0451576_0241726 | Ga0451576_0241726_57_338 | 72 |
| 287 | 3300045051 | Ga0451576_2729755 | Ga0451576_2729755_165_446 | 72 |
| 288 | 3300045836 | Ga0466958_0001512 | Ga0466958_0001512_5879_6142 | 72 |
| 289 | 3300045976 | Ga0466967_0004334 | Ga0466967_0004334_2261_2524 | 72 |
| 290 | 3300046452 | Ga0495617_033917 | Ga0495617_033917_450_713 | 72 |
| 291 | 3300046454 | Ga0495592_0400340 | Ga0495592_0400340_473_736 | 72 |
| 292 | 3300046455 | Ga0495603_0046741 | Ga0495603_0046741_335_598 | 72 |
| 293 | 3300046455 | Ga0495603_0657503 | Ga0495603_0657503_256_525 | 72 |
| 294 | 3300046457 | Ga0495590_0031614 | Ga0495590_0031614_853_1116 | 72 |
| 295 | 3300046459 | Ga0495629_0132812 | Ga0495629_0132812_774_1037 | 72 |
| 296 | 3300046460 | Ga0495638_0045651 | Ga0495638_0045651_885_1148 | 72 |
| 297 | 3300046462 | Ga0495651_0008937 | Ga0495651_0008937_7292_7555 | 72 |
| 298 | 3300046463 | Ga0495653_0358879 | Ga0495653_0358879_381_644 | 72 |
| 299 | 3300046471 | Ga0495650_0002433 | Ga0495650_0002433_6575_6844 | 72 |
| 300 | 3300046472 | Ga0495580_0167046 | Ga0495580_0167046_374_637 | 72 |
| 301 | 3300046472 | Ga0495580_0834437 | Ga0495580_0834437_323_586 | 72 |
| 302 | 3300046473 | Ga0495582_0815034 | Ga0495582_0815034_149_412 | 72 |
| 303 | 3300046475 | Ga0495639_0078437 | Ga0495639_0078437_166_429 | 72 |
| 304 | 3300046475 | Ga0495639_0553121 | Ga0495639_0553121_31_294 | 72 |
| 305 | 3300046475 | Ga0495639_0644700 | Ga0495639_0644700_38_301 | 72 |
| 306 | 3300046491 | Ga0495584_0060590 | Ga0495584_0060590_1012_1275 | 72 |
| 307 | 3300046492 | Ga0495585_0311143 | Ga0495585_0311143_28_291 | 72 |
| 308 | 3300046492 | Ga0495585_0593347 | Ga0495585_0593347_37_300 | 72 |
| 309 | 3300046499 | Ga0495594_0113906 | Ga0495594_0113906_1202_1465 | 72 |
| 310 | 3300046500 | Ga0495596_0000171 | Ga0495596_0000171_9964_10233 | 72 |
| 311 | 3300046501 | Ga0495607_0229720 | Ga0495607_0229720_263_526 | 72 |
| 312 | 3300046506 | Ga0495583_0376312 | Ga0495583_0376312_32_295 | 72 |
| 313 | 3300046507 | Ga0495606_0243565 | Ga0495606_0243565_654_923 | 72 |
| 314 | 3300046511 | Ga0495608_0014258 | Ga0495608_0014258_3592_3855 | 72 |
| 315 | 3300046514 | Ga0495618_0129657 | Ga0495618_0129657_119_382 | 72 |
| 316 | 3300046515 | Ga0495620_0002150 | Ga0495620_0002150_2923_3192 | 72 |
| 317 | 3300046516 | Ga0495628_1049962 | Ga0495628_1049962_43_306 | 72 |
| 318 | 3300046518 | Ga0495631_0030236 | Ga0495631_0030236_877_1140 | 72 |
| 319 | 3300046519 | Ga0495632_0029051 | Ga0495632_0029051_876_1139 | 72 |
| 320 | 3300046522 | Ga0495643_0001609 | Ga0495643_0001609_8312_8581 | 72 |
| 321 | 3300046529 | Ga0495652_0003657 | Ga0495652_0003657_9624_9887 | 72 |
| 322 | 3300046531 | Ga0495665_0461368 | Ga0495665_0461368_38_301 | 72 |
| 323 | 3300046533 | Ga0495640_0595416 | Ga0495640_0595416_259_522 | 72 |
| 324 | 3300046536 | Ga0495587_0007784 | Ga0495587_0007784_5145_5408 | 72 |
| 325 | 3300046543 | Ga0495645_0526977 | Ga0495645_0526977_129_392 | 72 |
| 326 | 3300046557 | Ga0495622_0235910 | Ga0495622_0235910_263_526 | 72 |
| 327 | 3300046558 | Ga0495633_0295914 | Ga0495633_0295914_171_434 | 72 |
| 328 | 3300046559 | Ga0495667_0000267 | Ga0495667_0000267_24104_24367 | 72 |
| 329 | 3300046615 | Ga0495656_0141751 | Ga0495656_0141751_633_896 | 72 |
| 330 | 3300046616 | Ga0495668_0004073 | Ga0495668_0004073_1025_1288 | 72 |
| 331 | 3300046642 | Ga0495634_0291459 | Ga0495634_0291459_97_381 | 72 |
| 332 | 3300046642 | Ga0495634_0301141 | Ga0495634_0301141_67_330 | 72 |
| 333 | 3300046642 | Ga0495634_0532167 | Ga0495634_0532167_346_609 | 72 |
| 334 | 3300046648 | Ga0495611_0167478 | Ga0495611_0167478_507_770 | 72 |
| 335 | 3300046660 | Ga0495625_0019072 | Ga0495625_0019072_3816_4079 | 72 |
| 336 | 3300046663 | Ga0495635_0036018 | Ga0495635_0036018_1989_2252 | 72 |
| 337 | 3300046674 | Ga0495588_0028119 | Ga0495588_0028119_2052_2315 | 72 |
| 338 | 3300046674 | Ga0495588_0653536 | Ga0495588_0653536_96_359 | 72 |
| 339 | 3300046675 | Ga0495657_0004443 | Ga0495657_0004443_1923_2186 | 72 |
| 340 | 3300046679 | Ga0495623_0000216 | Ga0495623_0000216_15181_15444 | 72 |
| 341 | 3300046680 | Ga0495646_0238781 | Ga0495646_0238781_474_737 | 72 |
| 342 | 3300046683 | Ga0495658_0317811 | Ga0495658_0317811_269_532 | 72 |
| 343 | 3300046684 | Ga0495669_0144653 | Ga0495669_0144653_507_770 | 72 |
| 344 | 3300046690 | Ga0495624_0799088 | Ga0495624_0799088_29_292 | 72 |
| 345 | 3300046691 | Ga0495670_0512332 | Ga0495670_0512332_171_434 | 72 |
| 346 | 3300046794 | Ga0495589_0031147 | Ga0495589_0031147_1396_1659 | 72 |
| 347 | 3300046809 | Ga0495600_0002526 | Ga0495600_0002526_6676_6939 | 72 |
| 348 | 3300047315 | Ga0495581_0024103 | Ga0495581_0024103_1314_1577 | 72 |
| 349 | 3300047317 | Ga0495604_0001204 | Ga0495604_0001204_16103_16366 | 72 |
| 350 | 3300047319 | Ga0495674_0274038 | Ga0495674_0274038_35_298 | 72 |
| 351 | 3300047321 | Ga0495676_0343174 | Ga0495676_0343174_219_482 | 72 |
| 352 | 3300047322 | Ga0495680_0003008 | Ga0495680_0003008_14876_15139 | 72 |
| 353 | 3300047323 | Ga0495683_0121306 | Ga0495683_0121306_504_773 | 72 |
| 354 | 3300047323 | Ga0495683_0225824 | Ga0495683_0225824_546_809 | 72 |
| 355 | 3300047444 | Ga0495675_0000122 | Ga0495675_0000122_39833_40096 | 72 |
| 356 | 3300047445 | Ga0495677_0133559 | Ga0495677_0133559_390_653 | 72 |
| 357 | 3300047470 | Ga0495681_0000209 | Ga0495681_0000209_40158_40427 | 72 |
| 358 | 3300047471 | Ga0495684_0034950 | Ga0495684_0034950_2211_2474 | 72 |
| 359 | 3300047673 | Ga0495593_0059077 | Ga0495593_0059077_849_1112 | 72 |
| 360 | 3300047673 | Ga0495593_0493523 | Ga0495593_0493523_280_543 | 72 |
| 361 | 3300048088 | Ga0495602_0003180 | Ga0495602_0003180_5173_5436 | 72 |
| 362 | 3300048089 | Ga0495614_0331781 | Ga0495614_0331781_418_681 | 72 |
| 363 | 3300048903 | Ga0496100_0318275 | Ga0496100_0318275_244_507 | 72 |
| 364 | 3300048903 | Ga0496100_0785286 | Ga0496100_0785286_67_330 | 72 |
| 365 | 3300048905 | Ga0496102_0526188 | Ga0496102_0526188_102_365 | 72 |
| 366 | 3300048905 | Ga0496102_1207941 | Ga0496102_1207941_250_513 | 72 |
| 367 | 3300048909 | Ga0496106_1249646 | Ga0496106_1249646_299_568 | 72 |
| 368 | 3300048912 | Ga0496109_1117893 | Ga0496109_1117893_352_615 | 72 |
| 369 | 3300048923 | Ga0496120_0000502 | Ga0496120_0000502_26408_26689 | 72 |
| 370 | 3300048924 | Ga0496121_0293484 | Ga0496121_0293484_758_1021 | 72 |
| 371 | 3300048929 | Ga0496126_0029620 | Ga0496126_0029620_3116_3379 | 72 |
| 372 | 3300048929 | Ga0496126_0189323 | Ga0496126_0189323_843_1106 | 72 |
| 373 | 3300048929 | Ga0496126_0208371 | Ga0496126_0208371_211_477 | 72 |
| 374 | 3300048929 | Ga0496126_0429596 | Ga0496126_0429596_662_925 | 72 |
| 375 | 3300048929 | Ga0496126_0934745 | Ga0496126_0934745_186_449 | 72 |
| 376 | 3300049460 | Ga0495682_0015256 | Ga0495682_0015256_966_1229 | 72 |
| 377 | 3300049460 | Ga0495682_0125617 | Ga0495682_0125617_225_488 | 72 |
| 378 | 3300049460 | Ga0495682_0294804 | Ga0495682_0294804_266_529 | 72 |
| 379 | 3300049513 | Ga0501290_078485 | Ga0501290_078485_121_393 | 72 |
| 380 | 3300049569 | Ga0501032_0032722 | Ga0501032_0032722_2347_2616 | 72 |
| 381 | 3300049570 | Ga0501033_0003190 | Ga0501033_0003190_5663_5932 | 72 |
| 382 | 3300049570 | Ga0501033_0991766 | Ga0501033_0991766_205_477 | 72 |
| 383 | 3300049571 | Ga0501034_0661017 | Ga0501034_0661017_569_850 | 72 |
| 384 | 3300049573 | Ga0501037_0161167 | Ga0501037_0161167_725_994 | 72 |
| 385 | 3300049573 | Ga0501037_0590158 | Ga0501037_0590158_293_547 | 72 |
| 386 | 3300049574 | Ga0501038_0002115 | Ga0501038_0002115_17165_17446 | 72 |
| 387 | 3300049578 | Ga0501042_1266550 | Ga0501042_1266550_62_316 | 72 |
| 388 | 3300049579 | Ga0501043_0822508 | Ga0501043_0822508_35_289 | 72 |
| 389 | 3300049580 | Ga0501046_0112933 | Ga0501046_0112933_1063_1317 | 72 |
| 390 | 3300049581 | Ga0501047_0071547 | Ga0501047_0071547_1099_1368 | 72 |
| 391 | 3300049581 | Ga0501047_0363183 | Ga0501047_0363183_701_964 | 72 |
| 392 | 3300049590 | Ga0501074_0357371 | Ga0501074_0357371_659_922 | 72 |
| 393 | 3300049679 | Ga0501249_000034 | Ga0501249_000034_53644_53916 | 72 |
| 394 | 3300049688 | Ga0501259_110781 | Ga0501259_110781_148_420 | 72 |
| 395 | 3300049742 | Ga0501080_0267743 | Ga0501080_0267743_814_1068 | 72 |
| 396 | 3300049742 | Ga0501080_0279622 | Ga0501080_0279622_134_397 | 72 |
| 397 | 3300049743 | Ga0501081_1287536 | Ga0501081_1287536_216_488 | 72 |
| 398 | 3300049744 | Ga0501083_0450065 | Ga0501083_0450065_272_526 | 72 |
| 399 | 3300049822 | Ga0501035_0002894 | Ga0501035_0002894_8657_8926 | 72 |
| 400 | 3300049822 | Ga0501035_0558131 | Ga0501035_0558131_635_889 | 72 |
| 401 | 3300049823 | Ga0501044_0000058 | Ga0501044_0000058_7739_8008 | 72 |
| 402 | 3300049823 | Ga0501044_0079435 | Ga0501044_0079435_510_791 | 72 |
| 403 | 3300049823 | Ga0501044_0319226 | Ga0501044_0319226_68_322 | 72 |
| 404 | 3300049850 | Ga0501204_000529 | Ga0501204_000529_1582_1854 | 72 |
| 405 | 3300050494 | nmdc:mga06z11_445514_c1 | nmdc:mga06z11_445514_c1_280_543 | 72 |
| 406 | 3300053077 | Ga0495601_0488927 | Ga0495601_0488927_467_730 | 72 |
| 407 | 3300053084 | Ga0495595_0116431 | Ga0495595_0116431_397_660 | 72 |
| 408 | 3300053085 | Ga0495619_0004043 | Ga0495619_0004043_5140_5403 | 72 |
| 409 | 3300053086 | Ga0500578_0331662 | Ga0500578_0331662_157_420 | 72 |
| 410 | 3300053094 | Ga0500566_0345271 | Ga0500566_0345271_80_343 | 72 |
| 411 | 3300053108 | Ga0500562_037185 | Ga0500562_037185_747_1010 | 72 |
| 412 | 3300053119 | Ga0500595_024977 | Ga0500595_024977_561_824 | 72 |
| 413 | 3300053134 | Ga0500658_0002194 | Ga0500658_0002194_6016_6279 | 72 |
| 414 | 3300053147 | Ga0500589_108304 | Ga0500589_108304_475_738 | 72 |
| 415 | 3300053150 | Ga0500603_079608 | Ga0500603_079608_266_529 | 72 |
| 416 | 3300053163 | Ga0500639_088136 | Ga0500639_088136_686_949 | 72 |
| 417 | 3300053177 | Ga0500636_0290265 | Ga0500636_0290265_421_684 | 72 |
| 418 | iso_pu_bacteria | 2508501123 | 2509118904 | 72 |
| 419 | iso_pu_bacteria | 2513237090 | 2513613027 | 72 |
| 420 | iso_pu_bacteria | 2513237094 | 2513643948 | 72 |
| 421 | iso_pu_bacteria | 2643221595 | 2643985673 | 72 |
| 422 | iso_pu_bacteria | 2643221736 | 2644746997 | 72 |
| 423 | iso_pu_bacteria | 2728368998 | 2728749643 | 72 |
| 424 | iso_pu_bacteria | 2744054633 | 2745081893 | 72 |
| 425 | iso_pu_bacteria | 2852653556 | 2852655672 | 72 |
| 426 | iso_pu_bacteria | 2876761206 | 2876761505 | 72 |
| 427 | iso_pu_bacteria | 2876761206 | 2876763585 | 72 |
| 428 | iso_pu_bacteria | 2903768456 | 2903769896 | 72 |
| 429 | iso_pu_bacteria | 2919450847 | 2919454285 | 72 |
| 430 | iso_pu_bacteria | 2920760137 | 2920766716 | 72 |
| 431 | iso_pu_bacteria | 2932818245 | 2932824997 | 72 |
| 432 | iso_pu_bacteria | 2935630451 | 2935636771 | 72 |
| 433 | iso_pu_bacteria | 2935819856 | 2935827733 | 72 |
| 434 | iso_pu_bacteria | 2935847175 | 2935855036 | 72 |
| 435 | iso_pu_bacteria | 2935984226 | 2935988687 | 72 |
| 436 | iso_pu_bacteria | 2936055302 | 2936063305 | 72 |
| 437 | iso_pu_bacteria | 2941507105 | 2941513408 | 72 |
| 438 | iso_pu_bacteria | 2941515067 | 2941521371 | 72 |
| 439 | iso_pu_bacteria | 2941523033 | 2941529125 | 72 |
| 440 | iso_pu_bacteria | 3000865235 | 3000867909 | 72 |
| 441 | iso_pu_bacteria | 8019555841 | 8019560509 | 72 |
| 442 | iso_pu_bacteria | 8019565922 | 8019570605 | 72 |
| 443 | iso_pu_bacteria | 8019648815 | 8019651009 | 72 |
| 444 | iso_pu_bacteria | 8057101203 | 8057104598 | 72 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar